F428297

General Info

Members Datasets Scaffolds Average Seq Length
379 241 369 170

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10266319|Ga0068870_102663192
Length 185
Sequence MIGSVSDADDETLSPEREQALAALRQVFEDGELEYKAISPTSLMVELPGEKKLQTPCRFDVGRHALEVHAFVCRKPDENFEGVYRWLLERNMKMYAVAFGLDPMGDIYLDARLPLAAVTTEEIDTLLGAVLEYADGSFNTILELGFASSIRKEWEWRISRGEPIRNLEAFRGPLALDELGSPADE

Samples

Sample ID Description Type Environment
1 2643221576 Nocardioides sp. Root614 Isolate Unclassified
2 2643221590 Nocardioides sp. Root682 Isolate Unclassified
3 2643221615 Nocardioides sp. Root224 Isolate Unclassified
4 2643221641 Nocardioides sp. Root122 Isolate Unclassified
5 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
6 2739367898 Nocardioides sp. CF479 Isolate Unclassified
7 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
8 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
9 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
10 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
130 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
131 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
136 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
144 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
218 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
219 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
235 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.25
Metatranscriptomes 2.11
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 2.37
Nodule 0.26
Rhizoplane 3.96
Rhizosphere 89.18
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c010133 3300000041 Bacteria 802
2 JGI24739J22299_10160459 3300001989 Bacteria 664
3 JGI24738J21930_10056494 3300002075 Bacteria 803
4 Ga0070658_10024216 3300005327 Bacteria 4871
5 Ga0070658_10056974 3300005327 Bacteria 3178
6 Ga0070683_100331011 3300005329 Bacteria 1450
7 Ga0070670_100623592 3300005331 Bacteria 966
8 Ga0068869_100514586 3300005334 Bacteria 1001
9 Ga0070682_100006569 3300005337 Bacteria 6524
10 Ga0070682_100009539 3300005337 Bacteria 5493
11 Ga0070682_100182533 3300005337 Bacteria 1467
12 Ga0070660_100069523 3300005339 Bacteria 2746
13 Ga0070660_100304509 3300005339 Bacteria 1307
14 Ga0070689_100209129 3300005340 Bacteria 1596
15 Ga0070691_10224767 3300005341 Unclassified 996
16 Ga0070661_100498035 3300005344 Bacteria 975
17 Ga0070692_10082640 3300005345 Bacteria 1732
18 Ga0070692_10419850 3300005345 Bacteria 849
19 Ga0070692_10553160 3300005345 Bacteria 754
20 Ga0070668_100115593 3300005347 Bacteria 2139
21 Ga0070668_100199545 3300005347 Bacteria 1642
22 Ga0070668_100723563 3300005347 Bacteria 879
23 Ga0070669_100322586 3300005353 Bacteria 1247
24 Ga0070674_100019414 3300005356 Bacteria 4317
25 Ga0070674_100085169 3300005356 Bacteria 2268
26 Ga0070659_100055788 3300005366 Bacteria 3114
27 Ga0070701_10122068 3300005438 Bacteria 1469
28 Ga0070700_100030348 3300005441 Bacteria 3230
29 Ga0070700_100040944 3300005441 Bacteria 2838
30 Ga0070700_100172822 3300005441 Bacteria 1497
31 Ga0070662_100059353 3300005457 Bacteria 2786
32 Ga0070662_100096231 3300005457 Bacteria 2233
33 Ga0068867_100037751 3300005459 Bacteria 3513
34 Ga0068867_100317248 3300005459 Bacteria 1290
35 Ga0068867_100744481 3300005459 Bacteria 869
36 Ga0070685_10042611 3300005466 Bacteria 2591
37 Ga0070684_100036813 3300005535 Bacteria 4194
38 Ga0070684_100535790 3300005535 Bacteria 1086
39 Ga0068853_100348803 3300005539 Bacteria 1376
40 Ga0070672_100228246 3300005543 Bacteria 1563
41 Ga0070695_100400646 3300005545 Bacteria 1040
42 Ga0068855_100684517 3300005563 Bacteria 1099
43 Ga0070664_100779948 3300005564 Bacteria 893
44 Ga0068854_100104812 3300005578 Bacteria 2125
45 Ga0070702_100008408 3300005615 Bacteria 4997
46 Ga0068852_100215777 3300005616 Bacteria 1823
47 Ga0068852_100268210 3300005616 Bacteria 1642
48 Ga0068866_10005428 3300005718 Bacteria 5261
49 Ga0068866_10162122 3300005718 Bacteria 1305
50 Ga0068861_100028845 3300005719 Bacteria 4052
51 Ga0068861_100043493 3300005719 Bacteria 3372
52 Ga0068861_100085876 3300005719 Bacteria 2472
53 Ga0068870_10266319 3300005840 Bacteria 1069
54 Ga0068870_10272954 3300005840 Bacteria 1057
55 Ga0068863_101056707 3300005841 Bacteria 816
56 Ga0068862_100942455 3300005844 Bacteria 851
57 Ga0081538_10000380 3300005981 Bacteria 50675
58 Ga0081539_10110687 3300005985 Bacteria 1383
59 Ga0075365_10012967 3300006038 Bacteria 4970
60 Ga0075365_10103192 3300006038 Bacteria 1954
61 Ga0075365_10419551 3300006038 Bacteria 945
62 Ga0075364_10378213 3300006051 Bacteria 966
63 Ga0075432_10000008 3300006058 Bacteria 38971
64 Ga0075367_10051848 3300006178 Bacteria 2427
65 Ga0097621_100130999 3300006237 Bacteria 2135
66 Ga0068871_100328151 3300006358 Bacteria 1349
67 Ga0075428_100238375 3300006844 Bacteria 1963
68 Ga0075433_10000386 3300006852 Bacteria 27949
69 Ga0075434_100000345 3300006871 Bacteria 33484
70 Ga0068865_100015713 3300006881 Bacteria 4830
71 Ga0068865_100016161 3300006881 Bacteria 4768
72 Ga0075436_100001303 3300006914 Bacteria 16951
73 Ga0075435_100003134 3300007076 Bacteria 11172
74 Ga0111539_10000866 3300009094 Bacteria 39504
75 Ga0105245_10008651 3300009098 Bacteria 8878
76 Ga0105245_10180540 3300009098 Bacteria 2016
77 Ga0105245_10408559 3300009098 Bacteria 1358
78 Ga0105245_11061947 3300009098 Bacteria 855
79 Ga0105243_10014806 3300009148 Bacteria 5901
80 Ga0105243_10018433 3300009148 Bacteria 5287
81 Ga0105243_10196512 3300009148 Bacteria 1766
82 Ga0105242_10135368 3300009176 Bacteria 2132
83 Ga0105242_10619241 3300009176 Bacteria 1048
84 Ga0105242_10626594 3300009176 Bacteria 1043
85 Ga0105248_10105013 3300009177 Bacteria 3185
86 Ga0105249_10019089 3300009553 Bacteria 6116
87 Ga0105249_10757588 3300009553 Bacteria 1033
88 Ga0105249_10830341 3300009553 Bacteria 989
89 Ga0105239_10060569 3300010375 Bacteria 4154
90 Ga0105239_10097436 3300010375 Bacteria 3250
91 Ga0105239_10373942 3300010375 Bacteria 1611
92 Ga0105239_10976166 3300010375 Bacteria 974
93 Ga0105246_11049350 3300011119 Bacteria 741
94 Ga0157339_1037384 3300012505 Bacteria 595
95 Ga0157371_10147914 3300013102 Bacteria 1675
96 Ga0163162_10088223 3300013306 Bacteria 3181
97 Ga0157372_10021482 3300013307 Bacteria 6974
98 Ga0157372_10301051 3300013307 Bacteria 1865
99 Ga0157372_10311410 3300013307 Bacteria 1832
100 Ga0157372_10683614 3300013307 Bacteria 1194
101 Ga0157375_10185085 3300013308 Bacteria 2235
102 Ga0157380_10006588 3300014326 Bacteria 8193
103 Ga0157380_10025139 3300014326 Bacteria 4514
104 Ga0157380_10681342 3300014326 Bacteria 1030
105 Ga0157377_10294111 3300014745 Bacteria 1069
106 Ga0163161_10173745 3300017792 Bacteria 1648
107 Ga0163161_10273839 3300017792 Bacteria 1322
108 Ga0206355_1608402 3300020076 Bacteria 860
109 Ga0206353_10736996 3300020082 Bacteria 10186
110 Ga0206353_11433528 3300020082 Bacteria 640
111 Ga0154015_1143945 3300020610 Bacteria 1031
112 Ga0207642_10037414 3300025899 Bacteria 2091
113 Ga0207688_10073176 3300025901 Bacteria 1947
114 Ga0207688_10084509 3300025901 Bacteria 1817
115 Ga0207643_10003380 3300025908 Bacteria 8599
116 Ga0207705_10099660 3300025909 Bacteria 2136
117 Ga0207705_10191706 3300025909 Bacteria 1546
118 Ga0207662_10015232 3300025918 Bacteria 4326
119 Ga0207657_10027101 3300025919 Bacteria 5254
120 Ga0207681_10273158 3300025923 Bacteria 1328
121 Ga0207687_10020190 3300025927 Bacteria 4419
122 Ga0207690_10076158 3300025932 Bacteria 2329
123 Ga0207690_10139237 3300025932 Bacteria 1786
124 Ga0207706_10005805 3300025933 Bacteria 11481
125 Ga0207706_10035334 3300025933 Bacteria 4444
126 Ga0207686_10006898 3300025934 Bacteria 6114
127 Ga0207686_10863542 3300025934 Bacteria 728
128 Ga0207709_10092418 3300025935 Bacteria 1981
129 Ga0207709_10125672 3300025935 Bacteria 1739
130 Ga0207670_10160941 3300025936 Bacteria 1675
131 Ga0207669_10020623 3300025937 Bacteria 3461
132 Ga0207669_10054690 3300025937 Bacteria 2413
133 Ga0207669_10106848 3300025937 Bacteria 1865
134 Ga0207704_10055277 3300025938 Bacteria 2425
135 Ga0207704_10207503 3300025938 Bacteria 1439
136 Ga0207704_10902500 3300025938 Bacteria 743
137 Ga0207691_10002292 3300025940 Bacteria 18735
138 Ga0207691_10938876 3300025940 Bacteria 723
139 Ga0207661_10116963 3300025944 Bacteria 2264
140 Ga0207661_11023074 3300025944 Bacteria 761
141 Ga0207667_10218956 3300025949 Bacteria 1951
142 Ga0207712_10027428 3300025961 Bacteria 3803
143 Ga0207640_10154328 3300025981 Bacteria 1691
144 Ga0207677_10071623 3300026023 Bacteria 2447
145 Ga0207639_10791524 3300026041 Bacteria 883
146 Ga0207678_10027692 3300026067 Bacteria 4947
147 Ga0207678_10432160 3300026067 Bacteria 1143
148 Ga0207708_10002424 3300026075 Bacteria 13694
149 Ga0207708_10121685 3300026075 Bacteria 2034
150 Ga0207648_10008058 3300026089 Bacteria 10266
151 Ga0207648_10193919 3300026089 Bacteria 1801
152 Ga0207674_10056459 3300026116 Bacteria 3987
153 Ga0207675_100014733 3300026118 Bacteria 7293
154 Ga0207675_100020281 3300026118 Bacteria 6198
155 Ga0207675_100771248 3300026118 Bacteria 974
156 Ga0207683_10296155 3300026121 Bacteria 1480
157 Ga0207428_10000346 3300027907 Bacteria 60257
158 Ga0268264_10067413 3300028381 Bacteria 3021
159 Ga0316183_1036099 3300030742 Bacteria 810
160 Ga0316181_1117826 3300030744 Bacteria 1182
161 Ga0307513_10293803 3300031456 Bacteria 1395
162 Ga0307513_10881373 3300031456 Bacteria 602
163 Ga0307408_100001891 3300031548 Bacteria 15240
164 Ga0307408_100005986 3300031548 Bacteria 8096
165 Ga0307408_100451455 3300031548 Bacteria 1115
166 Ga0307408_101358298 3300031548 Bacteria 668
167 Ga0307405_10000281 3300031731 Bacteria 18836
168 Ga0307405_10055088 3300031731 Bacteria 2487
169 Ga0307405_10512043 3300031731 Unclassified 964
170 Ga0307413_10525961 3300031824 Bacteria 955
171 Ga0307410_10000218 3300031852 Bacteria 21611
172 Ga0307410_10022164 3300031852 Bacteria 3920
173 Ga0307410_10472345 3300031852 Bacteria 1027
174 Ga0307406_10000008 3300031901 Bacteria 120233
175 Ga0307406_10023184 3300031901 Bacteria 3690
176 Ga0307406_10053255 3300031901 Bacteria 2577
177 Ga0307406_10614075 3300031901 Bacteria 898
178 Ga0307407_10000362 3300031903 Bacteria 13722
179 Ga0307407_10005246 3300031903 Bacteria 5599
180 Ga0307412_10045429 3300031911 Bacteria 2871
181 Ga0307412_10650578 3300031911 Unclassified 899
182 Ga0307409_100000014 3300031995 Bacteria 62867
183 Ga0307409_100007199 3300031995 Bacteria 6631
184 Ga0307409_100089657 3300031995 Bacteria 2514
185 Ga0307409_100422173 3300031995 Bacteria 1280
186 Ga0307416_100000467 3300032002 Bacteria 20665
187 Ga0307416_100035088 3300032002 Bacteria 3825
188 Ga0307416_100354186 3300032002 Bacteria 1487
189 Ga0307414_10001630 3300032004 Bacteria 11687
190 Ga0307414_10077482 3300032004 Bacteria 2420
191 Ga0307414_10120741 3300032004 Bacteria 2014
192 Ga0307414_10193992 3300032004 Bacteria 1646
193 Ga0307411_10002628 3300032005 Bacteria 8036
194 Ga0307411_10126824 3300032005 Bacteria 1858
195 Ga0307411_10220665 3300032005 Bacteria 1470
196 Ga0307415_100018267 3300032126 Bacteria 4230
197 Ga0307415_100044641 3300032126 Bacteria 2964
198 Ga0307415_100211497 3300032126 Bacteria 1547
199 Ga0307415_101206621 3300032126 Bacteria 713
200 Ga0373960_0019271 3300035121 Bacteria 1791
201 Ga0395898_1141161 3300037466 Bacteria 712
202 Ga0395905_0149952 3300037471 Bacteria 2194
203 Ga0395905_0230613 3300037471 Bacteria 1731
204 Ga0395901_0061078 3300038443 Bacteria 3922
205 Ga0436365_1356560 3300039437 Bacteria 796
206 Ga0439447_037662 3300041407 Bacteria 1191
207 Ga0439453_0074616 3300041408 Bacteria 723
208 Ga0439461_0072423 3300041410 Bacteria 800
209 Ga0439465_0033370 3300041413 Bacteria 1646
210 Ga0439465_0078300 3300041413 Bacteria 1117
211 Ga0451793_0821381 3300041452 Bacteria 1278
212 Ga0451800_1378682 3300041459 Bacteria 1362
213 Ga0451802_0053470 3300041460 Bacteria 687
214 Ga0451833_0343967 3300041491 Bacteria 15518
215 Ga0451837_0500960 3300041494 Bacteria 4417
216 Ga0451843_1607780 3300041509 Bacteria 1437
217 Ga0451853_2021982 3300041512 Bacteria 1379
218 Ga0451853_2800325 3300041512 Bacteria 1632
219 Ga0439431_0006028 3300041997 Bacteria 2676
220 Ga0439442_002972 3300042002 Bacteria 3342
221 Ga0439448_0101974 3300042005 Bacteria 976
222 Ga0439450_014201 3300042008 Bacteria 1612
223 Ga0450915_007292 3300042119 Bacteria 721
224 Ga0439446_0003939 3300042156 Bacteria 3731
225 Ga0439458_0150949 3300042157 Unclassified 622
226 Ga0439434_0059144 3300042435 Bacteria 1196
227 Ga0439434_0165737 3300042435 Bacteria 736
228 Ga0439444_0004218 3300042437 Bacteria 2077
229 Ga0439464_0013809 3300042439 Bacteria 2168
230 Ga0450901_024363 3300042533 Unclassified 656
231 Ga0466969_0190342 3300044656 Bacteria 938
232 Ga0466972_0084566 3300044658 Bacteria 1508
233 Ga0466972_0329541 3300044658 Bacteria 714
234 Ga0466965_0006625 3300044683 Bacteria 5276
235 Ga0466965_0017641 3300044683 Bacteria 3415
236 Ga0466966_0028655 3300044684 Bacteria 3625
237 Ga0466966_0125593 3300044684 Bacteria 1574
238 Ga0466966_0505322 3300044684 Bacteria 727
239 Ga0466961_0085715 3300044693 Bacteria 1991
240 Ga0466961_0275325 3300044693 Bacteria 1031
241 Ga0466963_0033440 3300044694 Bacteria 3338
242 Ga0466964_0001380 3300044706 Bacteria 8290
243 Ga0466964_0705878 3300044706 Bacteria 563
244 Ga0466971_0010688 3300044719 Bacteria 4016
245 Ga0466971_0155194 3300044719 Bacteria 1070
246 Ga0466968_0509056 3300044735 Bacteria 601
247 Ga0466970_0004641 3300044765 Bacteria 6779
248 Ga0466970_0005375 3300044765 Bacteria 6354
249 Ga0466970_0014592 3300044765 Bacteria 4035
250 Ga0466970_0027426 3300044765 Bacteria 2989
251 Ga0466970_0056148 3300044765 Bacteria 2104
252 Ga0466957_0019683 3300044842 Bacteria 3970
253 Ga0466957_0093468 3300044842 Bacteria 1887
254 Ga0466957_0114977 3300044842 Bacteria 1710
255 Ga0466960_0025624 3300044901 Bacteria 2670
256 Ga0466960_0049704 3300044901 Bacteria 2019
257 Ga0466960_0142080 3300044901 Bacteria 1276
258 Ga0466960_0576252 3300044901 Bacteria 666
259 Ga0466959_0114122 3300045049 Bacteria 1926
260 Ga0466959_0195362 3300045049 Bacteria 1410
261 Ga0466958_0021965 3300045836 Bacteria 3732
262 Ga0466967_0017891 3300045976 Bacteria 5646
263 Ga0466967_0093660 3300045976 Bacteria 2734
264 Ga0466967_0189625 3300045976 Bacteria 1942
265 Ga0466967_0424762 3300045976 Bacteria 1296
266 Ga0466967_0702624 3300045976 Bacteria 1001
267 Ga0495627_197697 3300046453 Bacteria 554
268 Ga0495629_0502909 3300046459 Bacteria 817
269 Ga0495605_0141565 3300046474 Bacteria 1079
270 Ga0495639_0096526 3300046475 Bacteria 1392
271 Ga0495585_0032158 3300046492 Bacteria 2974
272 Ga0495596_0128756 3300046500 Bacteria 983
273 Ga0495596_0155015 3300046500 Bacteria 890
274 Ga0495618_0128949 3300046514 Bacteria 1619
275 Ga0495631_0049855 3300046518 Bacteria 1832
276 Ga0495658_0692076 3300046683 Bacteria 653
277 Ga0495613_0362999 3300046689 Bacteria 993
278 Ga0495670_0351134 3300046691 Bacteria 794
279 Ga0495671_0414150 3300046692 Bacteria 645
280 Ga0495649_0397673 3300046694 Bacteria 692
281 Ga0495581_0218240 3300047315 Bacteria 1115
282 Ga0495614_0629857 3300048089 Bacteria 516
283 Ga0496105_0047204 3300048908 Bacteria 3554
284 Ga0496106_0045616 3300048909 Bacteria 3293
285 Ga0496108_0038286 3300048911 Bacteria 3995
286 Ga0496109_0086062 3300048912 Bacteria 2903
287 Ga0496109_0203641 3300048912 Bacteria 1861
288 Ga0496110_0215775 3300048913 Bacteria 1745
289 Ga0496110_0393466 3300048913 Bacteria 1263
290 Ga0496111_0322198 3300048914 Bacteria 1145
291 Ga0496111_0652208 3300048914 Bacteria 768
292 Ga0496114_0014262 3300048917 Bacteria 6376
293 Ga0496114_0054215 3300048917 Bacteria 3344
294 Ga0496114_0105136 3300048917 Bacteria 2415
295 Ga0501311_018112 3300049527 Bacteria 933
296 Ga0501317_072554 3300049533 Bacteria 583
297 Ga0501322_023133 3300049538 Bacteria 555
298 Ga0501330_017883 3300049546 Bacteria 553
299 Ga0501031_0011181 3300049568 Bacteria 5849
300 Ga0501031_0811767 3300049568 Bacteria 600
301 Ga0501032_0035942 3300049569 Bacteria 3384
302 Ga0501032_0132844 3300049569 Bacteria 1641
303 Ga0501033_0749514 3300049570 Bacteria 662
304 Ga0501034_0009633 3300049571 Bacteria 10103
305 Ga0501034_0012168 3300049571 Bacteria 8898
306 Ga0501034_0757846 3300049571 Bacteria 866
307 Ga0501034_1129956 3300049571 Bacteria 664
308 Ga0501036_0013319 3300049572 Bacteria 6829
309 Ga0501036_0054227 3300049572 Bacteria 3395
310 Ga0501036_0173849 3300049572 Bacteria 1814
311 Ga0501036_0665230 3300049572 Bacteria 862
312 Ga0501037_0275469 3300049573 Bacteria 1173
313 Ga0501038_0005151 3300049574 Bacteria 12146
314 Ga0501038_0087080 3300049574 Bacteria 2623
315 Ga0501038_0520199 3300049574 Bacteria 908
316 Ga0501039_0008109 3300049575 Bacteria 8000
317 Ga0501039_0078256 3300049575 Bacteria 2572
318 Ga0501040_0007015 3300049576 Bacteria 7301
319 Ga0501041_0047010 3300049577 Bacteria 2626
320 Ga0501042_0017690 3300049578 Bacteria 4920
321 Ga0501043_0132287 3300049579 Bacteria 1955
322 Ga0501046_0156159 3300049580 Bacteria 1718
323 Ga0501047_0048961 3300049581 Bacteria 4081
324 Ga0501047_0351137 3300049581 Bacteria 1311
325 Ga0501048_0021598 3300049582 Bacteria 4712
326 Ga0501067_0000281 3300049583 Bacteria 27873
327 Ga0501067_0031064 3300049583 Bacteria 2964
328 Ga0501068_0002654 3300049584 Bacteria 9479
329 Ga0501068_0111337 3300049584 Bacteria 1702
330 Ga0501070_0001910 3300049586 Bacteria 18394
331 Ga0501070_0235849 3300049586 Bacteria 1498
332 Ga0501070_0823051 3300049586 Bacteria 728
333 Ga0501071_0004275 3300049587 Bacteria 9046
334 Ga0501071_0016011 3300049587 Bacteria 5152
335 Ga0501072_0018569 3300049588 Bacteria 5359
336 Ga0501072_0186303 3300049588 Bacteria 1655
337 Ga0501073_0068178 3300049589 Bacteria 2479
338 Ga0501074_0000114 3300049590 Bacteria 40265
339 Ga0501075_0071175 3300049591 Bacteria 2628
340 Ga0501076_0190950 3300049592 Bacteria 1671
341 Ga0501077_0017895 3300049593 Bacteria 4479
342 Ga0501077_0038426 3300049593 Bacteria 3047
343 Ga0501217_053059 3300049661 Bacteria 1065
344 Ga0501243_007056 3300049675 Bacteria 1712
345 Ga0501259_011284 3300049688 Bacteria 1475
346 Ga0501234_047237 3300049707 Bacteria 712
347 Ga0501079_0116871 3300049741 Bacteria 2073
348 Ga0501080_0001132 3300049742 Bacteria 21939
349 Ga0501080_0151618 3300049742 Bacteria 2142
350 Ga0501081_0010763 3300049743 Bacteria 5973
351 Ga0501083_0058955 3300049744 Bacteria 2568
352 Ga0501035_0079211 3300049822 Bacteria 2902
353 Ga0501045_0041798 3300049824 Bacteria 3336
354 nmdc:mga07m45_331651_c1 3300050496 Bacteria 884
355 nmdc:mga08y16_5866_c1 3300050511 Bacteria 12866
356 nmdc:mga0n895_3207_c1 3300050512 Bacteria 13095
357 nmdc:mga0rr50_12227_c1 3300050513 Bacteria 5537
358 nmdc:mga08x19_5155_c1 3300050514 Bacteria 7726
359 nmdc:mga0a205_920_c1 3300050515 Bacteria 24255
360 nmdc:mga0sz30_211269_c1 3300050516 Bacteria 862
361 Ga0495655_0043121 3300053083 Bacteria 1162
362 Ga0495655_0239561 3300053083 Bacteria 607
363 Ga0500654_189250 3300053099 Bacteria 641
364 Ga0500556_0000769 3300053104 Bacteria 19005
365 Ga0501084_0011642 3300054114 Bacteria 7282
366 Ga0501084_0015627 3300054114 Bacteria 6295
367 Ga0590077_132844 3300059426 Bacteria 591
368 Ga0501082_0054602 3300060353 Bacteria 3443
369 Ga0530510_0065376 3300061734 Bacteria 2635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049533 Ga0501317_072554 Ga0501317_072554_93_551 144
2 3300046500 Ga0495596_0155015 Ga0495596_0155015_387_851 150
3 3300053083 Ga0495655_0239561 Ga0495655_0239561_34_498 150
4 iso_pu_bacteria 2643221641 2644229803 153
5 3300048089 Ga0495614_0629857 Ga0495614_0629857_17_505 154
6 3300048914 Ga0496111_0652208 Ga0496111_0652208_126_590 154
7 3300049574 Ga0501038_0520199 Ga0501038_0520199_17_517 155
8 3300032005 Ga0307411_10126824 Ga0307411_101268242 156
9 iso_pu_bacteria 2643221576 2643890337 156
10 iso_pu_bacteria 2643221590 2643959393 156
11 iso_pu_bacteria 8054609563 8054613624 156
12 3300006358 Ga0068871_100328151 Ga0068871_1003281512 157
13 3300009098 Ga0105245_11061947 Ga0105245_110619472 157
14 3300039437 Ga0436365_1356560 Ga0436365_1356560_116_634 157
15 3300045976 Ga0466967_0093660 Ga0466967_0093660_525_1031 157
16 3300045976 Ga0466967_0424762 Ga0466967_0424762_695_1201 157
17 3300046459 Ga0495629_0502909 Ga0495629_0502909_65_571 157
18 3300046475 Ga0495639_0096526 Ga0495639_0096526_150_656 157
19 3300047315 Ga0495581_0218240 Ga0495581_0218240_85_591 157
20 3300049571 Ga0501034_0009633 Ga0501034_0009633_8374_8880 157
21 3300049581 Ga0501047_0048961 Ga0501047_0048961_2931_3437 157
22 3300049583 Ga0501067_0000281 Ga0501067_0000281_15767_16273 157
23 3300049584 Ga0501068_0002654 Ga0501068_0002654_3911_4417 157
24 3300049586 Ga0501070_0001910 Ga0501070_0001910_759_1265 157
25 3300049587 Ga0501071_0004275 Ga0501071_0004275_1103_1609 157
26 3300049588 Ga0501072_0018569 Ga0501072_0018569_2320_2826 157
27 3300049589 Ga0501073_0068178 Ga0501073_0068178_820_1326 157
28 3300049590 Ga0501074_0000114 Ga0501074_0000114_23265_23771 157
29 3300049593 Ga0501077_0038426 Ga0501077_0038426_2120_2626 157
30 3300049741 Ga0501079_0116871 Ga0501079_0116871_490_996 157
31 3300049742 Ga0501080_0001132 Ga0501080_0001132_11632_12138 157
32 3300049744 Ga0501083_0058955 Ga0501083_0058955_1265_1771 157
33 3300054114 Ga0501084_0015627 Ga0501084_0015627_4251_4757 157
34 3300060353 Ga0501082_0054602 Ga0501082_0054602_2565_3071 157
35 3300001989 JGI24739J22299_10160459 JGI24739J22299_101604592 158
36 3300025901 Ga0207688_10073176 Ga0207688_100731763 158
37 3300044656 Ga0466969_0190342 Ga0466969_0190342_117_686 158
38 3300044694 Ga0466963_0033440 Ga0466963_0033440_2741_3325 158
39 3300044706 Ga0466964_0001380 Ga0466964_0001380_3514_4098 158
40 3300044719 Ga0466971_0155194 Ga0466971_0155194_46_645 158
41 3300044842 Ga0466957_0093468 Ga0466957_0093468_363_947 158
42 3300045049 Ga0466959_0114122 Ga0466959_0114122_1415_1900 158
43 3300045976 Ga0466967_0017891 Ga0466967_0017891_4934_5518 158
44 iso_pu_bacteria 2816332119 2816423279 158
45 3300005334 Ga0068869_100514586 Ga0068869_1005145861 159
46 3300005340 Ga0070689_100209129 Ga0070689_1002091292 159
47 3300005441 Ga0070700_100040944 Ga0070700_1000409441 159
48 3300005459 Ga0068867_100744481 Ga0068867_1007444812 159
49 3300005719 Ga0068861_100085876 Ga0068861_1000858763 159
50 3300009148 Ga0105243_10196512 Ga0105243_101965122 159
51 3300009176 Ga0105242_10626594 Ga0105242_106265942 159
52 3300009553 Ga0105249_10757588 Ga0105249_107575882 159
53 3300012505 Ga0157339_1037384 Ga0157339_10373841 159
54 3300020076 Ga0206355_1608402 Ga0206355_16084022 159
55 3300020082 Ga0206353_10736996 Ga0206353_107369966 159
56 3300020610 Ga0154015_1143945 Ga0154015_11439452 159
57 3300025935 Ga0207709_10125672 Ga0207709_101256722 159
58 3300026075 Ga0207708_10121685 Ga0207708_101216853 159
59 3300026118 Ga0207675_100771248 Ga0207675_1007712482 159
60 3300031852 Ga0307410_10472345 Ga0307410_104723452 159
61 3300044683 Ga0466965_0006625 Ga0466965_0006625_1188_1706 159
62 3300044684 Ga0466966_0505322 Ga0466966_0505322_174_692 159
63 3300044693 Ga0466961_0085715 Ga0466961_0085715_366_884 159
64 3300044693 Ga0466961_0275325 Ga0466961_0275325_435_941 159
65 3300044706 Ga0466964_0705878 Ga0466964_0705878_14_520 159
66 3300044719 Ga0466971_0010688 Ga0466971_0010688_2975_3493 159
67 3300044735 Ga0466968_0509056 Ga0466968_0509056_47_565 159
68 3300044765 Ga0466970_0056148 Ga0466970_0056148_149_655 159
69 3300044842 Ga0466957_0019683 Ga0466957_0019683_881_1399 159
70 3300045836 Ga0466958_0021965 Ga0466958_0021965_2775_3293 159
71 3300045976 Ga0466967_0189625 Ga0466967_0189625_201_719 159
72 3300046500 Ga0495596_0128756 Ga0495596_0128756_476_958 159
73 3300046514 Ga0495618_0128949 Ga0495618_0128949_311_808 159
74 3300049527 Ga0501311_018112 Ga0501311_018112_210_692 159
75 3300049571 Ga0501034_0012168 Ga0501034_0012168_6977_7480 159
76 3300049572 Ga0501036_0054227 Ga0501036_0054227_2251_2754 159
77 3300049574 Ga0501038_0005151 Ga0501038_0005151_2224_2727 159
78 3300049579 Ga0501043_0132287 Ga0501043_0132287_1079_1582 159
79 3300049581 Ga0501047_0351137 Ga0501047_0351137_362_865 159
80 3300053083 Ga0495655_0043121 Ga0495655_0043121_73_555 159
81 iso_pu_bacteria 2739367898 2740168181 159
82 3300009176 Ga0105242_10619241 Ga0105242_106192412 160
83 3300013307 Ga0157372_10683614 Ga0157372_106836142 160
84 3300014326 Ga0157380_10681342 Ga0157380_106813422 160
85 3300020082 Ga0206353_11433528 Ga0206353_114335281 160
86 3300025934 Ga0207686_10863542 Ga0207686_108635421 160
87 3300030742 Ga0316183_1036099 Ga0316183_10360992 160
88 3300031548 Ga0307408_101358298 Ga0307408_1013582982 160
89 3300032004 Ga0307414_10193992 Ga0307414_101939922 160
90 3300041407 Ga0439447_037662 Ga0439447_037662_551_1033 160
91 3300041408 Ga0439453_0074616 Ga0439453_0074616_32_553 160
92 3300041410 Ga0439461_0072423 Ga0439461_0072423_42_524 160
93 3300041413 Ga0439465_0033370 Ga0439465_0033370_1040_1549 160
94 3300041997 Ga0439431_0006028 Ga0439431_0006028_1111_1593 160
95 3300042002 Ga0439442_002972 Ga0439442_002972_21_503 160
96 3300042156 Ga0439446_0003939 Ga0439446_0003939_804_1286 160
97 3300042435 Ga0439434_0059144 Ga0439434_0059144_419_901 160
98 3300044658 Ga0466972_0329541 Ga0466972_0329541_88_585 160
99 3300044765 Ga0466970_0004641 Ga0466970_0004641_2639_3154 160
100 3300044765 Ga0466970_0027426 Ga0466970_0027426_1191_1700 160
101 3300045049 Ga0466959_0195362 Ga0466959_0195362_203_718 160
102 3300045976 Ga0466967_0702624 Ga0466967_0702624_18_533 160
103 3300046689 Ga0495613_0362999 Ga0495613_0362999_41_523 160
104 3300049568 Ga0501031_0811767 Ga0501031_0811767_76_576 160
105 3300049569 Ga0501032_0132844 Ga0501032_0132844_881_1381 160
106 3300049572 Ga0501036_0173849 Ga0501036_0173849_18_518 160
107 3300049573 Ga0501037_0275469 Ga0501037_0275469_175_675 160
108 3300049575 Ga0501039_0078256 Ga0501039_0078256_133_633 160
109 3300049583 Ga0501067_0031064 Ga0501067_0031064_1640_2176 160
110 3300049587 Ga0501071_0016011 Ga0501071_0016011_86_586 160
111 3300050496 nmdc:mga07m45_331651_c1 nmdc:mga07m45_331651_c1_190_693 160
112 3300005329 Ga0070683_100331011 Ga0070683_1003310112 161
113 3300005337 Ga0070682_100182533 Ga0070682_1001825332 161
114 3300005345 Ga0070692_10419850 Ga0070692_104198501 161
115 3300005840 Ga0068870_10266319 Ga0068870_102663192 161
116 3300005841 Ga0068863_101056707 Ga0068863_1010567072 161
117 3300005985 Ga0081539_10110687 Ga0081539_101106872 161
118 3300006038 Ga0075365_10103192 Ga0075365_101031922 161
119 3300006038 Ga0075365_10419551 Ga0075365_104195512 161
120 3300006051 Ga0075364_10378213 Ga0075364_103782131 161
121 3300006178 Ga0075367_10051848 Ga0075367_100518483 161
122 3300013307 Ga0157372_10301051 Ga0157372_103010512 161
123 3300017792 Ga0163161_10273839 Ga0163161_102738392 161
124 3300025937 Ga0207669_10054690 Ga0207669_100546901 161
125 3300025938 Ga0207704_10902500 Ga0207704_109025002 161
126 3300025940 Ga0207691_10938876 Ga0207691_109388761 161
127 3300025944 Ga0207661_10116963 Ga0207661_101169632 161
128 3300031995 Ga0307409_100422173 Ga0307409_1004221732 161
129 3300037471 Ga0395905_0230613 Ga0395905_0230613_506_1021 161
130 3300038443 Ga0395901_0061078 Ga0395901_0061078_2531_3046 161
131 3300041452 Ga0451793_0821381 Ga0451793_0821381_539_1030 161
132 3300041459 Ga0451800_1378682 Ga0451800_1378682_360_881 161
133 3300041460 Ga0451802_0053470 Ga0451802_0053470_101_619 161
134 3300041491 Ga0451833_0343967 Ga0451833_0343967_12735_13226 161
135 3300041494 Ga0451837_0500960 Ga0451837_0500960_3143_3634 161
136 3300041509 Ga0451843_1607780 Ga0451843_1607780_62_583 161
137 3300041512 Ga0451853_2800325 Ga0451853_2800325_1041_1562 161
138 3300044683 Ga0466965_0017641 Ga0466965_0017641_244_747 161
139 3300044684 Ga0466966_0125593 Ga0466966_0125593_330_842 161
140 3300044842 Ga0466957_0114977 Ga0466957_0114977_1145_1654 161
141 3300044901 Ga0466960_0142080 Ga0466960_0142080_560_1072 161
142 3300044901 Ga0466960_0576252 Ga0466960_0576252_29_541 161
143 3300046453 Ga0495627_197697 Ga0495627_197697_38_523 161
144 3300046492 Ga0495585_0032158 Ga0495585_0032158_430_915 161
145 3300048912 Ga0496109_0203641 Ga0496109_0203641_399_908 161
146 3300048913 Ga0496110_0393466 Ga0496110_0393466_163_672 161
147 3300048914 Ga0496111_0322198 Ga0496111_0322198_493_1002 161
148 3300048917 Ga0496114_0014262 Ga0496114_0014262_938_1483 161
149 3300048917 Ga0496114_0054215 Ga0496114_0054215_48_593 161
150 3300048917 Ga0496114_0105136 Ga0496114_0105136_889_1434 161
151 3300049546 Ga0501330_017883 Ga0501330_017883_20_517 161
152 3300050516 nmdc:mga0sz30_211269_c1 nmdc:mga0sz30_211269_c1_262_780 161
153 iso_pu_bacteria 2643221615 2644090921 161
154 iso_pu_bacteria 2643221657 2644320724 161
155 3300000041 ARcpr5oldR_c010133 ARcpr5oldR_0101332 162
156 3300002075 JGI24738J21930_10056494 JGI24738J21930_100564942 162
157 3300005327 Ga0070658_10024216 Ga0070658_100242163 162
158 3300005327 Ga0070658_10056974 Ga0070658_100569744 162
159 3300005331 Ga0070670_100623592 Ga0070670_1006235921 162
160 3300005337 Ga0070682_100006569 Ga0070682_1000065692 162
161 3300005337 Ga0070682_100009539 Ga0070682_1000095395 162
162 3300005339 Ga0070660_100069523 Ga0070660_1000695232 162
163 3300005339 Ga0070660_100304509 Ga0070660_1003045091 162
164 3300005341 Ga0070691_10224767 Ga0070691_102247671 162
165 3300005344 Ga0070661_100498035 Ga0070661_1004980352 162
166 3300005345 Ga0070692_10082640 Ga0070692_100826402 162
167 3300005345 Ga0070692_10553160 Ga0070692_105531601 162
168 3300005347 Ga0070668_100115593 Ga0070668_1001155932 162
169 3300005347 Ga0070668_100199545 Ga0070668_1001995452 162
170 3300005347 Ga0070668_100723563 Ga0070668_1007235632 162
171 3300005353 Ga0070669_100322586 Ga0070669_1003225862 162
172 3300005356 Ga0070674_100019414 Ga0070674_1000194144 162
173 3300005356 Ga0070674_100085169 Ga0070674_1000851692 162
174 3300005366 Ga0070659_100055788 Ga0070659_1000557882 162
175 3300005438 Ga0070701_10122068 Ga0070701_101220682 162
176 3300005441 Ga0070700_100030348 Ga0070700_1000303482 162
177 3300005441 Ga0070700_100172822 Ga0070700_1001728222 162
178 3300005457 Ga0070662_100059353 Ga0070662_1000593532 162
179 3300005457 Ga0070662_100096231 Ga0070662_1000962312 162
180 3300005459 Ga0068867_100037751 Ga0068867_1000377513 162
181 3300005459 Ga0068867_100317248 Ga0068867_1003172482 162
182 3300005466 Ga0070685_10042611 Ga0070685_100426113 162
183 3300005535 Ga0070684_100036813 Ga0070684_1000368133 162
184 3300005535 Ga0070684_100535790 Ga0070684_1005357902 162
185 3300005539 Ga0068853_100348803 Ga0068853_1003488032 162
186 3300005543 Ga0070672_100228246 Ga0070672_1002282462 162
187 3300005545 Ga0070695_100400646 Ga0070695_1004006462 162
188 3300005563 Ga0068855_100684517 Ga0068855_1006845172 162
189 3300005564 Ga0070664_100779948 Ga0070664_1007799482 162
190 3300005578 Ga0068854_100104812 Ga0068854_1001048122 162
191 3300005615 Ga0070702_100008408 Ga0070702_1000084083 162
192 3300005616 Ga0068852_100215777 Ga0068852_1002157772 162
193 3300005616 Ga0068852_100268210 Ga0068852_1002682102 162
194 3300005718 Ga0068866_10005428 Ga0068866_100054284 162
195 3300005718 Ga0068866_10162122 Ga0068866_101621222 162
196 3300005719 Ga0068861_100028845 Ga0068861_1000288453 162
197 3300005719 Ga0068861_100043493 Ga0068861_1000434934 162
198 3300005840 Ga0068870_10272954 Ga0068870_102729542 162
199 3300005844 Ga0068862_100942455 Ga0068862_1009424552 162
200 3300005981 Ga0081538_10000380 Ga0081538_1000038010 162
201 3300006038 Ga0075365_10012967 Ga0075365_100129676 162
202 3300006058 Ga0075432_10000008 Ga0075432_1000000838 162
203 3300006237 Ga0097621_100130999 Ga0097621_1001309992 162
204 3300006844 Ga0075428_100238375 Ga0075428_1002383752 162
205 3300006852 Ga0075433_10000386 Ga0075433_1000038615 162
206 3300006871 Ga0075434_100000345 Ga0075434_10000034515 162
207 3300006881 Ga0068865_100015713 Ga0068865_1000157132 162
208 3300006881 Ga0068865_100016161 Ga0068865_1000161613 162
209 3300006914 Ga0075436_100001303 Ga0075436_1000013038 162
210 3300007076 Ga0075435_100003134 Ga0075435_1000031343 162
211 3300009094 Ga0111539_10000866 Ga0111539_1000086631 162
212 3300009098 Ga0105245_10008651 Ga0105245_100086514 162
213 3300009098 Ga0105245_10180540 Ga0105245_101805402 162
214 3300009098 Ga0105245_10408559 Ga0105245_104085593 162
215 3300009148 Ga0105243_10014806 Ga0105243_100148065 162
216 3300009148 Ga0105243_10018433 Ga0105243_100184333 162
217 3300009176 Ga0105242_10135368 Ga0105242_101353682 162
218 3300009177 Ga0105248_10105013 Ga0105248_101050133 162
219 3300009553 Ga0105249_10019089 Ga0105249_100190893 162
220 3300009553 Ga0105249_10830341 Ga0105249_108303412 162
221 3300010375 Ga0105239_10060569 Ga0105239_100605693 162
222 3300010375 Ga0105239_10097436 Ga0105239_100974365 162
223 3300010375 Ga0105239_10373942 Ga0105239_103739422 162
224 3300010375 Ga0105239_10976166 Ga0105239_109761662 162
225 3300011119 Ga0105246_11049350 Ga0105246_110493501 162
226 3300013102 Ga0157371_10147914 Ga0157371_101479142 162
227 3300013306 Ga0163162_10088223 Ga0163162_100882232 162
228 3300013307 Ga0157372_10021482 Ga0157372_100214824 162
229 3300013307 Ga0157372_10311410 Ga0157372_103114102 162
230 3300013308 Ga0157375_10185085 Ga0157375_101850852 162
231 3300014326 Ga0157380_10006588 Ga0157380_100065885 162
232 3300014326 Ga0157380_10025139 Ga0157380_100251393 162
233 3300014745 Ga0157377_10294111 Ga0157377_102941112 162
234 3300017792 Ga0163161_10173745 Ga0163161_101737452 162
235 3300025899 Ga0207642_10037414 Ga0207642_100374141 162
236 3300025901 Ga0207688_10084509 Ga0207688_100845092 162
237 3300025908 Ga0207643_10003380 Ga0207643_1000338010 162
238 3300025909 Ga0207705_10099660 Ga0207705_100996603 162
239 3300025909 Ga0207705_10191706 Ga0207705_101917062 162
240 3300025918 Ga0207662_10015232 Ga0207662_100152323 162
241 3300025919 Ga0207657_10027101 Ga0207657_100271012 162
242 3300025923 Ga0207681_10273158 Ga0207681_102731582 162
243 3300025927 Ga0207687_10020190 Ga0207687_100201904 162
244 3300025932 Ga0207690_10076158 Ga0207690_100761583 162
245 3300025932 Ga0207690_10139237 Ga0207690_101392372 162
246 3300025933 Ga0207706_10005805 Ga0207706_100058052 162
247 3300025933 Ga0207706_10035334 Ga0207706_100353342 162
248 3300025934 Ga0207686_10006898 Ga0207686_100068982 162
249 3300025935 Ga0207709_10092418 Ga0207709_100924183 162
250 3300025936 Ga0207670_10160941 Ga0207670_101609412 162
251 3300025937 Ga0207669_10020623 Ga0207669_100206233 162
252 3300025937 Ga0207669_10106848 Ga0207669_101068482 162
253 3300025938 Ga0207704_10055277 Ga0207704_100552772 162
254 3300025938 Ga0207704_10207503 Ga0207704_102075032 162
255 3300025940 Ga0207691_10002292 Ga0207691_100022923 162
256 3300025944 Ga0207661_11023074 Ga0207661_110230742 162
257 3300025949 Ga0207667_10218956 Ga0207667_102189562 162
258 3300025961 Ga0207712_10027428 Ga0207712_100274282 162
259 3300025981 Ga0207640_10154328 Ga0207640_101543282 162
260 3300026023 Ga0207677_10071623 Ga0207677_100716232 162
261 3300026041 Ga0207639_10791524 Ga0207639_107915242 162
262 3300026067 Ga0207678_10027692 Ga0207678_100276924 162
263 3300026067 Ga0207678_10432160 Ga0207678_104321602 162
264 3300026075 Ga0207708_10002424 Ga0207708_1000242411 162
265 3300026089 Ga0207648_10008058 Ga0207648_100080589 162
266 3300026089 Ga0207648_10193919 Ga0207648_101939192 162
267 3300026116 Ga0207674_10056459 Ga0207674_100564592 162
268 3300026118 Ga0207675_100014733 Ga0207675_1000147334 162
269 3300026118 Ga0207675_100020281 Ga0207675_1000202814 162
270 3300026121 Ga0207683_10296155 Ga0207683_102961552 162
271 3300027907 Ga0207428_10000346 Ga0207428_1000034616 162
272 3300028381 Ga0268264_10067413 Ga0268264_100674135 162
273 3300030744 Ga0316181_1117826 Ga0316181_11178262 162
274 3300031456 Ga0307513_10293803 Ga0307513_102938032 162
275 3300031456 Ga0307513_10881373 Ga0307513_108813731 162
276 3300031548 Ga0307408_100001891 Ga0307408_1000018919 162
277 3300031548 Ga0307408_100005986 Ga0307408_1000059862 162
278 3300031548 Ga0307408_100451455 Ga0307408_1004514552 162
279 3300031731 Ga0307405_10000281 Ga0307405_100002815 162
280 3300031731 Ga0307405_10055088 Ga0307405_100550882 162
281 3300031731 Ga0307405_10512043 Ga0307405_105120432 162
282 3300031824 Ga0307413_10525961 Ga0307413_105259612 162
283 3300031852 Ga0307410_10000218 Ga0307410_100002184 162
284 3300031852 Ga0307410_10022164 Ga0307410_100221642 162
285 3300031901 Ga0307406_10000008 Ga0307406_1000000872 162
286 3300031901 Ga0307406_10023184 Ga0307406_100231842 162
287 3300031901 Ga0307406_10053255 Ga0307406_100532552 162
288 3300031901 Ga0307406_10614075 Ga0307406_106140752 162
289 3300031903 Ga0307407_10000362 Ga0307407_100003625 162
290 3300031903 Ga0307407_10005246 Ga0307407_100052464 162
291 3300031911 Ga0307412_10045429 Ga0307412_100454293 162
292 3300031911 Ga0307412_10650578 Ga0307412_106505782 162
293 3300031995 Ga0307409_100000014 Ga0307409_10000001462 162
294 3300031995 Ga0307409_100007199 Ga0307409_1000071993 162
295 3300031995 Ga0307409_100089657 Ga0307409_1000896572 162
296 3300032002 Ga0307416_100000467 Ga0307416_1000004671 162
297 3300032002 Ga0307416_100035088 Ga0307416_1000350883 162
298 3300032002 Ga0307416_100354186 Ga0307416_1003541862 162
299 3300032004 Ga0307414_10001630 Ga0307414_100016302 162
300 3300032004 Ga0307414_10077482 Ga0307414_100774822 162
301 3300032004 Ga0307414_10120741 Ga0307414_101207412 162
302 3300032005 Ga0307411_10002628 Ga0307411_100026284 162
303 3300032005 Ga0307411_10220665 Ga0307411_102206651 162
304 3300032126 Ga0307415_100018267 Ga0307415_1000182673 162
305 3300032126 Ga0307415_100044641 Ga0307415_1000446412 162
306 3300032126 Ga0307415_100211497 Ga0307415_1002114972 162
307 3300032126 Ga0307415_101206621 Ga0307415_1012066212 162
308 3300035121 Ga0373960_0019271 Ga0373960_0019271_412_921 162
309 3300037466 Ga0395898_1141161 Ga0395898_1141161_30_527 162
310 3300037471 Ga0395905_0149952 Ga0395905_0149952_945_1466 162
311 3300041413 Ga0439465_0078300 Ga0439465_0078300_309_812 162
312 3300041512 Ga0451853_2021982 Ga0451853_2021982_181_699 162
313 3300042005 Ga0439448_0101974 Ga0439448_0101974_331_843 162
314 3300042008 Ga0439450_014201 Ga0439450_014201_718_1227 162
315 3300042119 Ga0450915_007292 Ga0450915_007292_136_645 162
316 3300042157 Ga0439458_0150949 Ga0439458_0150949_83_592 162
317 3300042435 Ga0439434_0165737 Ga0439434_0165737_102_605 162
318 3300042437 Ga0439444_0004218 Ga0439444_0004218_222_731 162
319 3300042439 Ga0439464_0013809 Ga0439464_0013809_1221_1733 162
320 3300042533 Ga0450901_024363 Ga0450901_024363_137_646 162
321 3300044658 Ga0466972_0084566 Ga0466972_0084566_844_1377 162
322 3300044684 Ga0466966_0028655 Ga0466966_0028655_1099_1704 162
323 3300044765 Ga0466970_0005375 Ga0466970_0005375_2293_2826 162
324 3300044765 Ga0466970_0014592 Ga0466970_0014592_20_544 162
325 3300044901 Ga0466960_0025624 Ga0466960_0025624_1732_2229 162
326 3300044901 Ga0466960_0049704 Ga0466960_0049704_35_565 162
327 3300046474 Ga0495605_0141565 Ga0495605_0141565_207_710 162
328 3300046518 Ga0495631_0049855 Ga0495631_0049855_292_795 162
329 3300046683 Ga0495658_0692076 Ga0495658_0692076_143_631 162
330 3300046691 Ga0495670_0351134 Ga0495670_0351134_145_648 162
331 3300046692 Ga0495671_0414150 Ga0495671_0414150_98_601 162
332 3300046694 Ga0495649_0397673 Ga0495649_0397673_112_615 162
333 3300048908 Ga0496105_0047204 Ga0496105_0047204_1627_2223 162
334 3300048909 Ga0496106_0045616 Ga0496106_0045616_940_1488 162
335 3300048911 Ga0496108_0038286 Ga0496108_0038286_1530_2081 162
336 3300048912 Ga0496109_0086062 Ga0496109_0086062_1311_1859 162
337 3300048913 Ga0496110_0215775 Ga0496110_0215775_648_1202 162
338 3300049538 Ga0501322_023133 Ga0501322_023133_25_531 162
339 3300049568 Ga0501031_0011181 Ga0501031_0011181_3771_4265 162
340 3300049569 Ga0501032_0035942 Ga0501032_0035942_2561_3055 162
341 3300049570 Ga0501033_0749514 Ga0501033_0749514_106_600 162
342 3300049571 Ga0501034_0757846 Ga0501034_0757846_91_597 162
343 3300049571 Ga0501034_1129956 Ga0501034_1129956_41_550 162
344 3300049572 Ga0501036_0013319 Ga0501036_0013319_6144_6638 162
345 3300049572 Ga0501036_0665230 Ga0501036_0665230_275_802 162
346 3300049574 Ga0501038_0087080 Ga0501038_0087080_864_1358 162
347 3300049575 Ga0501039_0008109 Ga0501039_0008109_6403_6897 162
348 3300049576 Ga0501040_0007015 Ga0501040_0007015_1537_2031 162
349 3300049577 Ga0501041_0047010 Ga0501041_0047010_1068_1562 162
350 3300049578 Ga0501042_0017690 Ga0501042_0017690_2905_3399 162
351 3300049580 Ga0501046_0156159 Ga0501046_0156159_1155_1649 162
352 3300049582 Ga0501048_0021598 Ga0501048_0021598_1219_1713 162
353 3300049584 Ga0501068_0111337 Ga0501068_0111337_33_527 162
354 3300049586 Ga0501070_0235849 Ga0501070_0235849_309_803 162
355 3300049586 Ga0501070_0823051 Ga0501070_0823051_190_696 162
356 3300049588 Ga0501072_0186303 Ga0501072_0186303_657_1151 162
357 3300049591 Ga0501075_0071175 Ga0501075_0071175_1160_1654 162
358 3300049592 Ga0501076_0190950 Ga0501076_0190950_193_687 162
359 3300049593 Ga0501077_0017895 Ga0501077_0017895_2717_3211 162
360 3300049661 Ga0501217_053059 Ga0501217_053059_328_837 162
361 3300049675 Ga0501243_007056 Ga0501243_007056_910_1419 162
362 3300049688 Ga0501259_011284 Ga0501259_011284_853_1362 162
363 3300049707 Ga0501234_047237 Ga0501234_047237_187_696 162
364 3300049742 Ga0501080_0151618 Ga0501080_0151618_1581_2075 162
365 3300049743 Ga0501081_0010763 Ga0501081_0010763_3974_4468 162
366 3300049822 Ga0501035_0079211 Ga0501035_0079211_1219_1713 162
367 3300049824 Ga0501045_0041798 Ga0501045_0041798_1683_2177 162
368 3300050511 nmdc:mga08y16_5866_c1 nmdc:mga08y16_5866_c1_732_1283 162
369 3300050512 nmdc:mga0n895_3207_c1 nmdc:mga0n895_3207_c1_2109_2660 162
370 3300050513 nmdc:mga0rr50_12227_c1 nmdc:mga0rr50_12227_c1_1693_2244 162
371 3300050514 nmdc:mga08x19_5155_c1 nmdc:mga08x19_5155_c1_5337_5888 162
372 3300050515 nmdc:mga0a205_920_c1 nmdc:mga0a205_920_c1_23054_23605 162
373 3300053099 Ga0500654_189250 Ga0500654_189250_17_505 162
374 3300053104 Ga0500556_0000769 Ga0500556_0000769_2555_3088 162
375 3300054114 Ga0501084_0011642 Ga0501084_0011642_6443_6937 162
376 3300059426 Ga0590077_132844 Ga0590077_132844_89_580 162
377 3300061734 Ga0530510_0065376 Ga0530510_0065376_1485_1979 162
378 iso_pu_bacteria 2984576629 2984579369 162
379 iso_pu_bacteria 2990256926 2990256979 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10722

YbjN

Putative bacterial sensory transduction regulator

20

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c9j-assembly1.cif.gz_A amp-activated protein kinase bound to pharmacological activator r734 0.8294 5 45
2plg-assembly1.cif.gz_A crystal structure of t110839 protein from synechococcus elongatus 0.7665 5 126
1jyo-assembly1.cif.gz_D structure of the salmonella virulence effector sptp in complex with its secretion chaperone sicp 0.756 5 130
4h5b-assembly1.cif.gz_A crystal structure of dr_1245 from deinococcus radiodurans 0.7496 6 126
1k6z-assembly1.cif.gz_B crystal structure of the yersinia secretion chaperone syce 0.7428 4 121
ID Description Score Start End Superfamily
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9779 34 134 3.30.1460.10
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9592 34 134 3.30.1460.10
af_P0AF76_2_132_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8031 7 129 3.30.1460.10
2plgA01 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7616 5 126 3.30.1460.10
af_A4I6G8_183_310_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7611 5 117 3.30.1460.10
ID Description Score Start End GO Terms
AF-A0A4Q9HN89-F1-model_v4 YbjN domain-containing protein 0.9916 9 139
AF-A0A6I5UEV1-F1-model_v4 deleted 0.9905 6 162
AF-A0A2W2CFL9-F1-model_v4 YbjN domain-containing protein 0.9902 8 162
AF-A0A4R0GR80-F1-model_v4 YbjN domain-containing protein 0.9899 5 162
AF-A0A7W7SRN9-F1-model_v4 Sensory transduction regulator 0.9893 6 162

Feature Viewer

pLDDT pTM Quality
89.96 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map