F428253

General Info

Members Datasets Scaffolds Average Seq Length
379 268 758 142

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100241827|Ga0070682_1002418271
Length 151
Sequence LNDCLNDGMTVLDSPIPRFHLAMPVDDLDAARHFYGEVLGLEQGRSSETWIDWNLRGHQFVTHLAPERQQRIHNPVDGHDVPVPHFGLILTVEQFQAFAERLKAAGTEFVIEPYVRFEGQTGEQWTMFFLDPAGNALEFKAFADDSQVFAA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
92 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
162 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
163 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
164 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
165 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
184 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
185 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
249 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
252 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
253 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 2582580736 Prauserella sp. Am3 Isolate Unclassified
257 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
258 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
259 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
260 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
261 2862574272 Streptomyces sp. AcE210 Isolate Nodule
262 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
263 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
264 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
265 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
266 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
267 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
268 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 0
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0.26
Rhizoplane 7.65
Rhizosphere 81
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100241827 3300005337 Bacteria 1296
2 JGI24740J21852_10012372 3300001979 Bacteria 3218
3 JGI24739J22299_10015276 3300001989 Bacteria 2789
4 JGI24739J22299_10165925 3300001989 Bacteria 651
5 JGI24737J22298_10006123 3300001990 Bacteria 4121
6 JGI24735J21928_10113113 3300002067 Bacteria 781
7 JGI24735J21928_10177148 3300002067 Bacteria 617
8 JGI24750J21931_1025539 3300002070 Bacteria 847
9 JGI24748J21848_1002823 3300002074 Bacteria 1976
10 JGI24749J21850_1052414 3300002076 Bacteria 610
11 JGI24744J21845_10029769 3300002077 Bacteria 1048
12 JGI24034J26672_10003156 3300002239 Bacteria 2289
13 JGI24742J22300_10012669 3300002244 Bacteria 1407
14 JGI25406J46586_10013105 3300003203 Bacteria 3576
15 Ga0055540_1012653 3300003792 Bacteria 2635
16 Ga0070676_10044018 3300005328 Bacteria 2596
17 Ga0070690_100074061 3300005330 Bacteria 2217
18 Ga0068869_100007426 3300005334 Bacteria 7005
19 Ga0070666_10124469 3300005335 Bacteria 1789
20 Ga0070680_100193124 3300005336 Bacteria 1716
21 Ga0070682_100161074 3300005337 Bacteria 1550
22 Ga0068868_100170155 3300005338 Bacteria 1803
23 Ga0068868_100516512 3300005338 Bacteria 1048
24 Ga0070660_100502262 3300005339 Bacteria 1009
25 Ga0070689_100000990 3300005340 Bacteria 17780
26 Ga0070687_100037239 3300005343 Bacteria 2430
27 Ga0070668_100001103 3300005347 Bacteria 19039
28 Ga0070668_100004518 3300005347 Bacteria 10319
29 Ga0070668_100087658 3300005347 Bacteria 2449
30 Ga0070669_100028965 3300005353 Bacteria 3991
31 Ga0070675_100077723 3300005354 Bacteria 2763
32 Ga0070671_100082203 3300005355 Bacteria 2693
33 Ga0070674_100000673 3300005356 Bacteria 17282
34 Ga0070674_100068783 3300005356 Bacteria 2496
35 Ga0070688_100036687 3300005365 Bacteria 2983
36 Ga0070688_100836741 3300005365 Bacteria 722
37 Ga0070659_100012189 3300005366 Bacteria 6372
38 Ga0070667_100117012 3300005367 Bacteria 2315
39 Ga0070667_100189279 3300005367 Bacteria 1822
40 Ga0070703_10238964 3300005406 Bacteria 731
41 Ga0070709_10058578 3300005434 Bacteria 2443
42 Ga0070714_100380185 3300005435 Bacteria 1331
43 Ga0070710_10000142 3300005437 Bacteria 33366
44 Ga0070710_10000303 3300005437 Bacteria 23421
45 Ga0070701_10005940 3300005438 Bacteria 5098
46 Ga0070701_10473406 3300005438 Bacteria 808
47 Ga0070711_100000758 3300005439 Bacteria 16795
48 Ga0070700_100033691 3300005441 Bacteria 3087
49 Ga0070694_100009581 3300005444 Bacteria 5942
50 Ga0070663_100015543 3300005455 Bacteria 4918
51 Ga0070663_100799579 3300005455 Bacteria 809
52 Ga0070678_100009950 3300005456 Bacteria 5783
53 Ga0070678_100130433 3300005456 Bacteria 1996
54 Ga0070678_100423979 3300005456 Bacteria 1160
55 Ga0070662_100010480 3300005457 Bacteria 6085
56 Ga0070662_100914255 3300005457 Bacteria 749
57 Ga0068867_100041891 3300005459 Bacteria 3346
58 Ga0070685_10104989 3300005466 Bacteria 1731
59 Ga0070698_100549818 3300005471 Bacteria 1094
60 Ga0068853_100009537 3300005539 Bacteria 7822
61 Ga0068853_101666923 3300005539 Bacteria 618
62 Ga0070672_100557072 3300005543 Bacteria 996
63 Ga0070686_100025532 3300005544 Bacteria 3556
64 Ga0070686_100404800 3300005544 Bacteria 1039
65 Ga0070695_100018020 3300005545 Bacteria 4287
66 Ga0070696_100018976 3300005546 Bacteria 4655
67 Ga0070693_100007670 3300005547 Bacteria 5284
68 Ga0070665_100008504 3300005548 Bacteria 10380
69 Ga0070665_100047291 3300005548 Bacteria 4319
70 Ga0070665_100200898 3300005548 Bacteria 1994
71 Ga0070704_100009490 3300005549 Bacteria 5883
72 Ga0068855_100009246 3300005563 Bacteria 11906
73 Ga0068855_100094543 3300005563 Bacteria 3446
74 Ga0068857_100271006 3300005577 Bacteria 1560
75 Ga0068854_100000552 3300005578 Bacteria 22587
76 Ga0068854_100003387 3300005578 Bacteria 9937
77 Ga0068854_100322902 3300005578 Bacteria 1255
78 Ga0068854_100464958 3300005578 Bacteria 1059
79 Ga0068856_100129802 3300005614 Bacteria 2525
80 Ga0068856_100231712 3300005614 Bacteria 1862
81 Ga0070702_100030641 3300005615 Bacteria 2934
82 Ga0070702_100363694 3300005615 Bacteria 1023
83 Ga0070702_101016400 3300005615 Bacteria 657
84 Ga0068852_100015881 3300005616 Bacteria 5856
85 Ga0068852_100125217 3300005616 Bacteria 2359
86 Ga0068852_102608376 3300005616 Bacteria 525
87 Ga0068859_100038220 3300005617 Bacteria 4816
88 Ga0068864_101616512 3300005618 Bacteria 652
89 Ga0068866_10075039 3300005718 Bacteria 1799
90 Ga0068866_10532660 3300005718 Bacteria 782
91 Ga0068861_100005501 3300005719 Bacteria 8582
92 Ga0068851_10066977 3300005834 Bacteria 1851
93 Ga0068863_100150958 3300005841 Bacteria 2223
94 Ga0068858_100018868 3300005842 Bacteria 6453
95 Ga0068860_100000694 3300005843 Bacteria 38692
96 Ga0068860_100154328 3300005843 Bacteria 2212
97 Ga0068862_100012356 3300005844 Bacteria 7059
98 Ga0068862_100261514 3300005844 Bacteria 1580
99 Ga0081455_10175069 3300005937 Bacteria 1630
100 Ga0081539_10000146 3300005985 Bacteria 164571
101 Ga0070717_11514959 3300006028 Unclassified 608
102 Ga0075364_10178572 3300006051 Bacteria 1436
103 Ga0070715_10002537 3300006163 Bacteria 5629
104 Ga0070716_100489088 3300006173 Bacteria 905
105 Ga0070712_100000640 3300006175 Bacteria 20589
106 Ga0068871_100035218 3300006358 Bacteria 3976
107 Ga0068871_100041018 3300006358 Bacteria 3710
108 Ga0075428_100001529 3300006844 Bacteria 24749
109 Ga0075431_100016579 3300006847 Bacteria 7478
110 Ga0068865_100000497 3300006881 Bacteria 22023
111 Ga0068865_100075210 3300006881 Bacteria 2408
112 Ga0097620_100038219 3300006931 Bacteria 4816
113 Ga0105240_10033577 3300009093 Bacteria 6625
114 Ga0105240_10986834 3300009093 Bacteria 902
115 Ga0105245_10108207 3300009098 Bacteria 2581
116 Ga0105245_10467879 3300009098 Bacteria 1272
117 Ga0105247_10000541 3300009101 Bacteria 30700
118 Ga0114129_10107240 3300009147 Bacteria 3858
119 Ga0105243_10001274 3300009148 Bacteria 22612
120 Ga0105243_11090708 3300009148 Bacteria 806
121 Ga0105241_10002372 3300009174 Bacteria 14154
122 Ga0105241_10030092 3300009174 Bacteria 4055
123 Ga0105242_10000572 3300009176 Bacteria 29126
124 Ga0105242_10001978 3300009176 Bacteria 16115
125 Ga0105248_10014365 3300009177 Bacteria 8714
126 Ga0105248_10113619 3300009177 Bacteria 3054
127 Ga0105237_10014665 3300009545 Bacteria 8185
128 Ga0105237_10027200 3300009545 Bacteria 5840
129 Ga0105238_10006231 3300009551 Bacteria 11849
130 Ga0105238_10976421 3300009551 Bacteria 867
131 Ga0105249_10007752 3300009553 Bacteria 9357
132 Ga0105029_104528 3300009984 Bacteria 958
133 Ga0105035_117970 3300009988 Bacteria 662
134 Ga0105239_10018086 3300010375 Bacteria 7794
135 Ga0157369_10186403 3300013105 Bacteria 2182
136 Ga0157369_10226803 3300013105 Bacteria 1954
137 Ga0157369_10387341 3300013105 Bacteria 1451
138 Ga0157374_11035585 3300013296 Bacteria 840
139 Ga0157378_10004026 3300013297 Bacteria 12978
140 Ga0157378_10143608 3300013297 Bacteria 2218
141 Ga0163162_10003207 3300013306 Bacteria 15651
142 Ga0157372_10015696 3300013307 Bacteria 8122
143 Ga0157372_10795302 3300013307 Bacteria 1099
144 Ga0157375_10003918 3300013308 Bacteria 12910
145 Ga0157375_10274664 3300013308 Bacteria 1847
146 Ga0157515_152242 3300013875 Bacteria 935
147 Ga0157380_10003265 3300014326 Bacteria 11111
148 Ga0157380_11910795 3300014326 Bacteria 654
149 Ga0157377_10627112 3300014745 Bacteria 771
150 Ga0157379_10019220 3300014968 Bacteria 6034
151 Ga0157379_10620130 3300014968 Bacteria 1011
152 Ga0157376_10141967 3300014969 Bacteria 2156
153 Ga0157376_10252946 3300014969 Bacteria 1646
154 Ga0163161_10002789 3300017792 Bacteria 12383
155 Ga0163161_10432256 3300017792 Bacteria 1061
156 Ga0209051_1002075 3300025303 Bacteria 15149
157 Ga0207656_10190742 3300025321 Bacteria 987
158 Ga0207692_10002753 3300025898 Bacteria 6775
159 Ga0207692_10139169 3300025898 Bacteria 1379
160 Ga0207642_10170446 3300025899 Bacteria 1177
161 Ga0207642_10295018 3300025899 Bacteria 938
162 Ga0207710_10012255 3300025900 Bacteria 3607
163 Ga0207688_10007262 3300025901 Bacteria 6030
164 Ga0207680_10066790 3300025903 Bacteria 2213
165 Ga0207647_10055836 3300025904 Bacteria 2425
166 Ga0207647_10060815 3300025904 Bacteria 2308
167 Ga0207647_10141367 3300025904 Bacteria 1410
168 Ga0207645_10020933 3300025907 Bacteria 4272
169 Ga0207654_10148603 3300025911 Bacteria 1502
170 Ga0207695_10006099 3300025913 Bacteria 15728
171 Ga0207695_10580963 3300025913 Bacteria 1002
172 Ga0207671_10000550 3300025914 Bacteria 50545
173 Ga0207671_10025319 3300025914 Bacteria 4457
174 Ga0207693_10000174 3300025915 Bacteria 58853
175 Ga0207663_10118838 3300025916 Bacteria 1806
176 Ga0207660_10290761 3300025917 Bacteria 1299
177 Ga0207662_10018651 3300025918 Bacteria 3941
178 Ga0207662_10328753 3300025918 Bacteria 1022
179 Ga0207657_10369804 3300025919 Bacteria 1130
180 Ga0207681_10073333 3300025923 Bacteria 2394
181 Ga0207694_10000877 3300025924 Bacteria 26760
182 Ga0207694_10001865 3300025924 Bacteria 17518
183 Ga0207694_10570059 3300025924 Bacteria 951
184 Ga0207687_10091251 3300025927 Bacteria 2222
185 Ga0207687_10252103 3300025927 Bacteria 1404
186 Ga0207644_10106081 3300025931 Bacteria 2118
187 Ga0207690_10142962 3300025932 Bacteria 1765
188 Ga0207706_10013520 3300025933 Bacteria 7418
189 Ga0207706_11212052 3300025933 Bacteria 627
190 Ga0207686_10015617 3300025934 Bacteria 4248
191 Ga0207709_10006274 3300025935 Bacteria 6679
192 Ga0207670_10082126 3300025936 Bacteria 2258
193 Ga0207670_10668744 3300025936 Bacteria 857
194 Ga0207669_10033826 3300025937 Bacteria 2890
195 Ga0207669_10071353 3300025937 Bacteria 2181
196 Ga0207704_10017267 3300025938 Bacteria 3735
197 Ga0207704_10026536 3300025938 Bacteria 3180
198 Ga0207665_10265041 3300025939 Bacteria 1274
199 Ga0207665_10542245 3300025939 Bacteria 903
200 Ga0207691_10159789 3300025940 Bacteria 1978
201 Ga0207711_10030471 3300025941 Bacteria 4550
202 Ga0207711_10125675 3300025941 Bacteria 2294
203 Ga0207711_10446707 3300025941 Bacteria 1203
204 Ga0207689_10020342 3300025942 Bacteria 5588
205 Ga0207667_10047533 3300025949 Bacteria 4542
206 Ga0207667_12040056 3300025949 Bacteria 533
207 Ga0207651_11255048 3300025960 Bacteria 666
208 Ga0207712_10205801 3300025961 Bacteria 1564
209 Ga0207668_10001110 3300025972 Bacteria 16019
210 Ga0207668_10072339 3300025972 Bacteria 2466
211 Ga0207668_10157070 3300025972 Bacteria 1768
212 Ga0207640_10010974 3300025981 Bacteria 5115
213 Ga0207640_10407742 3300025981 Bacteria 1108
214 Ga0207658_10021232 3300025986 Bacteria 4504
215 Ga0207658_10061441 3300025986 Bacteria 2808
216 Ga0207677_10028745 3300026023 Bacteria 3522
217 Ga0207703_10273925 3300026035 Bacteria 1530
218 Ga0207639_10088249 3300026041 Bacteria 2474
219 Ga0207639_11216564 3300026041 Bacteria 707
220 Ga0207678_10015747 3300026067 Bacteria 6645
221 Ga0207678_10766347 3300026067 Bacteria 851
222 Ga0207708_10063527 3300026075 Bacteria 2821
223 Ga0207702_10075837 3300026078 Bacteria 2905
224 Ga0207641_10085856 3300026088 Bacteria 2743
225 Ga0207648_10002050 3300026089 Bacteria 21946
226 Ga0207648_10010060 3300026089 Bacteria 8998
227 Ga0207676_12053074 3300026095 Bacteria 570
228 Ga0207674_10492175 3300026116 Bacteria 1185
229 Ga0207675_100000185 3300026118 Bacteria 56425
230 Ga0207683_10032027 3300026121 Bacteria 4565
231 Ga0207683_10155491 3300026121 Bacteria 2065
232 Ga0207698_10026638 3300026142 Bacteria 4092
233 Ga0207698_10125931 3300026142 Bacteria 2178
234 Ga0268266_10085435 3300028379 Bacteria 2757
235 Ga0268266_10092837 3300028379 Bacteria 2649
236 Ga0268266_10257874 3300028379 Bacteria 1615
237 Ga0268265_10113115 3300028380 Bacteria 2220
238 Ga0268264_10001293 3300028381 Bacteria 23636
239 Ga0307515_10310579 3300028794 Bacteria 1252
240 Ga0307515_10574980 3300028794 Bacteria 737
241 Ga0307512_10059518 3300030522 Bacteria 2963
242 Ga0307512_10225727 3300030522 Bacteria 971
243 Ga0316177_1219150 3300030731 Bacteria 2628
244 Ga0316176_1059859 3300030732 Bacteria 5341
245 Ga0316178_1113448 3300030735 Bacteria 1688
246 Ga0316180_1083973 3300030736 Bacteria 1559
247 Ga0307513_10103137 3300031456 Bacteria 2869
248 Ga0307508_10281656 3300031616 Bacteria 1256
249 Ga0307508_10372523 3300031616 Bacteria 1019
250 Ga0307514_10118299 3300031649 Bacteria 1856
251 Ga0307516_10018442 3300031730 Bacteria 7252
252 Ga0307516_10207877 3300031730 Bacteria 1673
253 Ga0307405_10308930 3300031731 Bacteria 1203
254 Ga0307413_10001375 3300031824 Bacteria 9145
255 Ga0307413_10027742 3300031824 Bacteria 3143
256 Ga0307518_10000213 3300031838 Bacteria 43894
257 Ga0307518_10057442 3300031838 Bacteria 2827
258 Ga0307518_10131959 3300031838 Bacteria 1754
259 Ga0307518_10170892 3300031838 Bacteria 1482
260 Ga0307406_10286941 3300031901 Bacteria 1258
261 Ga0307407_10730704 3300031903 Bacteria 748
262 Ga0307407_10989074 3300031903 Bacteria 649
263 Ga0307411_10002289 3300032005 Bacteria 8388
264 Ga0307510_10047996 3300033180 Bacteria 4562
265 Ga0373928_0031971 3300035084 Bacteria 1171
266 Ga0373940_0009562 3300035088 Bacteria 2257
267 Ga0373952_0155424 3300035092 Bacteria 644
268 Ga0373942_0001801 3300035207 Bacteria 5426
269 Ga0373931_0251243 3300035691 Bacteria 1075
270 Ga0395898_0016590 3300037466 Bacteria 7530
271 Ga0451787_136281 3300041441 Bacteria 759
272 Ga0451797_0504512 3300041453 Bacteria 1069
273 Ga0451800_0070477 3300041459 Bacteria 842
274 Ga0451802_0610132 3300041460 Bacteria 608
275 Ga0451841_0830456 3300041498 Bacteria 799
276 Ga0466972_0001234 3300044658 Bacteria 12313
277 Ga0466965_0007070 3300044683 Bacteria 5137
278 Ga0466965_0060464 3300044683 Bacteria 1892
279 Ga0466965_0233272 3300044683 Bacteria 983
280 Ga0466960_0142889 3300044901 Bacteria 1272
281 Ga0466958_0181726 3300045836 Bacteria 1335
282 Ga0466967_0000285 3300045976 Bacteria 22474
283 Ga0466967_0086634 3300045976 Bacteria 2838
284 Ga0495627_023126 3300046453 Bacteria 2039
285 Ga0495603_0072167 3300046455 Bacteria 2028
286 Ga0495638_0008852 3300046460 Bacteria 7104
287 Ga0495638_0093616 3300046460 Bacteria 1807
288 Ga0495650_0258908 3300046471 Bacteria 590
289 Ga0495607_0303188 3300046501 Bacteria 751
290 Ga0495583_0294243 3300046506 Bacteria 646
291 Ga0495618_0209662 3300046514 Bacteria 1232
292 Ga0495631_0122413 3300046518 Bacteria 1119
293 Ga0495666_0244223 3300046526 Bacteria 819
294 Ga0495597_0135064 3300046542 Bacteria 1021
295 Ga0495622_0340124 3300046557 Bacteria 650
296 Ga0495611_0018063 3300046648 Bacteria 3023
297 Ga0495625_0032615 3300046660 Bacteria 3860
298 Ga0495625_0056345 3300046660 Bacteria 2799
299 Ga0495625_0088226 3300046660 Bacteria 2149
300 Ga0495659_0366901 3300046664 Bacteria 617
301 Ga0495647_0092677 3300046681 Bacteria 1241
302 Ga0495613_0035293 3300046689 Bacteria 3711
303 Ga0495624_0866770 3300046690 Bacteria 532
304 Ga0495670_0332947 3300046691 Bacteria 816
305 Ga0495589_0007507 3300046794 Bacteria 5712
306 Ga0495581_0100086 3300047315 Bacteria 1684
307 Ga0495676_0036255 3300047321 Bacteria 4120
308 Ga0495676_0117688 3300047321 Bacteria 1938
309 Ga0495687_101251 3300047443 Bacteria 1080
310 Ga0495685_002808 3300047447 Bacteria 5489
311 Ga0495685_032643 3300047447 Bacteria 1789
312 Ga0495593_0136926 3300047673 Bacteria 1241
313 Ga0495626_0246807 3300048091 Bacteria 717
314 Ga0496100_0002206 3300048903 Bacteria 9828
315 Ga0496100_0003057 3300048903 Bacteria 8644
316 Ga0496101_0000176 3300048904 Bacteria 51135
317 Ga0496101_0026152 3300048904 Bacteria 4056
318 Ga0496102_0001430 3300048905 Bacteria 21187
319 Ga0496103_0000570 3300048906 Bacteria 29250
320 Ga0496103_0498023 3300048906 Bacteria 780
321 Ga0496104_0015578 3300048907 Bacteria 6890
322 Ga0496104_0033594 3300048907 Bacteria 4781
323 Ga0496105_0013734 3300048908 Bacteria 6431
324 Ga0496105_0040407 3300048908 Bacteria 3846
325 Ga0496106_0000351 3300048909 Bacteria 32650
326 Ga0496106_0001063 3300048909 Bacteria 20256
327 Ga0496107_0009908 3300048910 Bacteria 6612
328 Ga0496107_0013016 3300048910 Bacteria 5812
329 Ga0496108_0203571 3300048911 Bacteria 1718
330 Ga0496109_0266834 3300048912 Bacteria 1613
331 Ga0496110_0986918 3300048913 Bacteria 749
332 Ga0496111_0066608 3300048914 Bacteria 2616
333 Ga0496113_0396545 3300048916 Bacteria 1108
334 Ga0496114_0005152 3300048917 Bacteria 10196
335 Ga0496114_0021466 3300048917 Bacteria 5254
336 Ga0496114_0077566 3300048917 Bacteria 2801
337 Ga0496115_0024950 3300048918 Bacteria 4651
338 Ga0496115_0039425 3300048918 Bacteria 3751
339 Ga0501032_0983026 3300049569 Bacteria 530
340 Ga0501036_0265430 3300049572 Bacteria 1438
341 Ga0501038_0058219 3300049574 Bacteria 3314
342 Ga0501043_0242951 3300049579 Bacteria 1388
343 Ga0501072_0020702 3300049588 Bacteria 5098
344 Ga0501035_0281982 3300049822 Bacteria 1404
345 Ga0501044_0196363 3300049823 Bacteria 1978
346 Ga0501044_0489914 3300049823 Bacteria 1131
347 nmdc:mga05p37_72343_c1 3300050507 Bacteria 4242
348 nmdc:mga0qj67_109733_c1 3300050509 Bacteria 2227
349 nmdc:mga06r32_7364_c2 3300050510 Bacteria 7262
350 nmdc:mga0sz30_260780_c1 3300050516 Bacteria 772
351 Ga0495655_0149573 3300053083 Bacteria 733
352 Ga0500644_0202718 3300053088 Bacteria 821
353 Ga0500644_0468475 3300053088 Bacteria 553
354 Ga0500660_011837 3300053100 Bacteria 4706
355 Ga0500556_0206318 3300053104 Bacteria 776
356 Ga0500562_014512 3300053108 Bacteria 2017
357 Ga0500569_266418 3300053109 Bacteria 580
358 Ga0500568_0278936 3300053139 Bacteria 607
359 Ga0500589_227419 3300053147 Bacteria 699
360 Ga0500600_0084994 3300053149 Bacteria 1702
361 Ga0500600_0135920 3300053149 Bacteria 1245
362 Ga0500604_0055669 3300053151 Bacteria 1231
363 Ga0500616_0004538 3300053153 Bacteria 9841
364 Ga0500616_0085212 3300053153 Bacteria 1579
365 Ga0501084_0000252 3300054114 Bacteria 40523
366 Ga0501084_1589953 3300054114 Bacteria 547
367 2583150905 2582580736 Bacteria 5325865
368 2585312732 2582581314 Bacteria 11452267
369 2586060861 2585427649 Bacteria 9053857
370 2616693591 2616644814 Bacteria 11555299
371 2809590131 2808606522 Bacteria 9488490
372 2862580857 2862574272 Bacteria 10567477
373 2867307365 2867302475 Bacteria 7087181
374 2867315008 2867312974 Bacteria 7058875
375 2867319995 2867319477 Bacteria 7069771
376 2939589238 2939582691 Bacteria 7088898
377 8003317512 8003314358 Bacteria 10575343
378 8047713048 8047710418 Bacteria 11023148
379 8056063541 8056060235 Bacteria 7259403
380 Ga0070682_100241827
381 JGI24740J21852_10012372
382 JGI24739J22299_10015276
383 JGI24739J22299_10165925
384 JGI24737J22298_10006123
385 JGI24735J21928_10113113
386 JGI24735J21928_10177148
387 JGI24750J21931_1025539
388 JGI24748J21848_1002823
389 JGI24749J21850_1052414
390 JGI24744J21845_10029769
391 JGI24034J26672_10003156
392 JGI24742J22300_10012669
393 JGI25406J46586_10013105
394 Ga0055540_1012653
395 Ga0070676_10044018
396 Ga0070690_100074061
397 Ga0068869_100007426
398 Ga0070666_10124469
399 Ga0070680_100193124
400 Ga0070682_100161074
401 Ga0068868_100170155
402 Ga0068868_100516512
403 Ga0070660_100502262
404 Ga0070689_100000990
405 Ga0070687_100037239
406 Ga0070668_100001103
407 Ga0070668_100004518
408 Ga0070668_100087658
409 Ga0070669_100028965
410 Ga0070675_100077723
411 Ga0070671_100082203
412 Ga0070674_100000673
413 Ga0070674_100068783
414 Ga0070688_100036687
415 Ga0070688_100836741
416 Ga0070659_100012189
417 Ga0070667_100117012
418 Ga0070667_100189279
419 Ga0070703_10238964
420 Ga0070709_10058578
421 Ga0070714_100380185
422 Ga0070710_10000142
423 Ga0070710_10000303
424 Ga0070701_10005940
425 Ga0070701_10473406
426 Ga0070711_100000758
427 Ga0070700_100033691
428 Ga0070694_100009581
429 Ga0070663_100015543
430 Ga0070663_100799579
431 Ga0070678_100009950
432 Ga0070678_100130433
433 Ga0070678_100423979
434 Ga0070662_100010480
435 Ga0070662_100914255
436 Ga0068867_100041891
437 Ga0070685_10104989
438 Ga0070698_100549818
439 Ga0068853_100009537
440 Ga0068853_101666923
441 Ga0070672_100557072
442 Ga0070686_100025532
443 Ga0070686_100404800
444 Ga0070695_100018020
445 Ga0070696_100018976
446 Ga0070693_100007670
447 Ga0070665_100008504
448 Ga0070665_100047291
449 Ga0070665_100200898
450 Ga0070704_100009490
451 Ga0068855_100009246
452 Ga0068855_100094543
453 Ga0068857_100271006
454 Ga0068854_100000552
455 Ga0068854_100003387
456 Ga0068854_100322902
457 Ga0068854_100464958
458 Ga0068856_100129802
459 Ga0068856_100231712
460 Ga0070702_100030641
461 Ga0070702_100363694
462 Ga0070702_101016400
463 Ga0068852_100015881
464 Ga0068852_100125217
465 Ga0068852_102608376
466 Ga0068859_100038220
467 Ga0068864_101616512
468 Ga0068866_10075039
469 Ga0068866_10532660
470 Ga0068861_100005501
471 Ga0068851_10066977
472 Ga0068863_100150958
473 Ga0068858_100018868
474 Ga0068860_100000694
475 Ga0068860_100154328
476 Ga0068862_100012356
477 Ga0068862_100261514
478 Ga0081455_10175069
479 Ga0081539_10000146
480 Ga0070717_11514959
481 Ga0075364_10178572
482 Ga0070715_10002537
483 Ga0070716_100489088
484 Ga0070712_100000640
485 Ga0068871_100035218
486 Ga0068871_100041018
487 Ga0075428_100001529
488 Ga0075431_100016579
489 Ga0068865_100000497
490 Ga0068865_100075210
491 Ga0097620_100038219
492 Ga0105240_10033577
493 Ga0105240_10986834
494 Ga0105245_10108207
495 Ga0105245_10467879
496 Ga0105247_10000541
497 Ga0114129_10107240
498 Ga0105243_10001274
499 Ga0105243_11090708
500 Ga0105241_10002372
501 Ga0105241_10030092
502 Ga0105242_10000572
503 Ga0105242_10001978
504 Ga0105248_10014365
505 Ga0105248_10113619
506 Ga0105237_10014665
507 Ga0105237_10027200
508 Ga0105238_10006231
509 Ga0105238_10976421
510 Ga0105249_10007752
511 Ga0105029_104528
512 Ga0105035_117970
513 Ga0105239_10018086
514 Ga0157369_10186403
515 Ga0157369_10226803
516 Ga0157369_10387341
517 Ga0157374_11035585
518 Ga0157378_10004026
519 Ga0157378_10143608
520 Ga0163162_10003207
521 Ga0157372_10015696
522 Ga0157372_10795302
523 Ga0157375_10003918
524 Ga0157375_10274664
525 Ga0157515_152242
526 Ga0157380_10003265
527 Ga0157380_11910795
528 Ga0157377_10627112
529 Ga0157379_10019220
530 Ga0157379_10620130
531 Ga0157376_10141967
532 Ga0157376_10252946
533 Ga0163161_10002789
534 Ga0163161_10432256
535 Ga0209051_1002075
536 Ga0207656_10190742
537 Ga0207692_10002753
538 Ga0207692_10139169
539 Ga0207642_10170446
540 Ga0207642_10295018
541 Ga0207710_10012255
542 Ga0207688_10007262
543 Ga0207680_10066790
544 Ga0207647_10055836
545 Ga0207647_10060815
546 Ga0207647_10141367
547 Ga0207645_10020933
548 Ga0207654_10148603
549 Ga0207695_10006099
550 Ga0207695_10580963
551 Ga0207671_10000550
552 Ga0207671_10025319
553 Ga0207693_10000174
554 Ga0207663_10118838
555 Ga0207660_10290761
556 Ga0207662_10018651
557 Ga0207662_10328753
558 Ga0207657_10369804
559 Ga0207681_10073333
560 Ga0207694_10000877
561 Ga0207694_10001865
562 Ga0207694_10570059
563 Ga0207687_10091251
564 Ga0207687_10252103
565 Ga0207644_10106081
566 Ga0207690_10142962
567 Ga0207706_10013520
568 Ga0207706_11212052
569 Ga0207686_10015617
570 Ga0207709_10006274
571 Ga0207670_10082126
572 Ga0207670_10668744
573 Ga0207669_10033826
574 Ga0207669_10071353
575 Ga0207704_10017267
576 Ga0207704_10026536
577 Ga0207665_10265041
578 Ga0207665_10542245
579 Ga0207691_10159789
580 Ga0207711_10030471
581 Ga0207711_10125675
582 Ga0207711_10446707
583 Ga0207689_10020342
584 Ga0207667_10047533
585 Ga0207667_12040056
586 Ga0207651_11255048
587 Ga0207712_10205801
588 Ga0207668_10001110
589 Ga0207668_10072339
590 Ga0207668_10157070
591 Ga0207640_10010974
592 Ga0207640_10407742
593 Ga0207658_10021232
594 Ga0207658_10061441
595 Ga0207677_10028745
596 Ga0207703_10273925
597 Ga0207639_10088249
598 Ga0207639_11216564
599 Ga0207678_10015747
600 Ga0207678_10766347
601 Ga0207708_10063527
602 Ga0207702_10075837
603 Ga0207641_10085856
604 Ga0207648_10002050
605 Ga0207648_10010060
606 Ga0207676_12053074
607 Ga0207674_10492175
608 Ga0207675_100000185
609 Ga0207683_10032027
610 Ga0207683_10155491
611 Ga0207698_10026638
612 Ga0207698_10125931
613 Ga0268266_10085435
614 Ga0268266_10092837
615 Ga0268266_10257874
616 Ga0268265_10113115
617 Ga0268264_10001293
618 Ga0307515_10310579
619 Ga0307515_10574980
620 Ga0307512_10059518
621 Ga0307512_10225727
622 Ga0316177_1219150
623 Ga0316176_1059859
624 Ga0316178_1113448
625 Ga0316180_1083973
626 Ga0307513_10103137
627 Ga0307508_10281656
628 Ga0307508_10372523
629 Ga0307514_10118299
630 Ga0307516_10018442
631 Ga0307516_10207877
632 Ga0307405_10308930
633 Ga0307413_10001375
634 Ga0307413_10027742
635 Ga0307518_10000213
636 Ga0307518_10057442
637 Ga0307518_10131959
638 Ga0307518_10170892
639 Ga0307406_10286941
640 Ga0307407_10730704
641 Ga0307407_10989074
642 Ga0307411_10002289
643 Ga0307510_10047996
644 Ga0373928_0031971
645 Ga0373940_0009562
646 Ga0373952_0155424
647 Ga0373942_0001801
648 Ga0373931_0251243
649 Ga0395898_0016590
650 Ga0451787_136281
651 Ga0451797_0504512
652 Ga0451800_0070477
653 Ga0451802_0610132
654 Ga0451841_0830456
655 Ga0466972_0001234
656 Ga0466965_0007070
657 Ga0466965_0060464
658 Ga0466965_0233272
659 Ga0466960_0142889
660 Ga0466958_0181726
661 Ga0466967_0000285
662 Ga0466967_0086634
663 Ga0495627_023126
664 Ga0495603_0072167
665 Ga0495638_0008852
666 Ga0495638_0093616
667 Ga0495650_0258908
668 Ga0495607_0303188
669 Ga0495583_0294243
670 Ga0495618_0209662
671 Ga0495631_0122413
672 Ga0495666_0244223
673 Ga0495597_0135064
674 Ga0495622_0340124
675 Ga0495611_0018063
676 Ga0495625_0032615
677 Ga0495625_0056345
678 Ga0495625_0088226
679 Ga0495659_0366901
680 Ga0495647_0092677
681 Ga0495613_0035293
682 Ga0495624_0866770
683 Ga0495670_0332947
684 Ga0495589_0007507
685 Ga0495581_0100086
686 Ga0495676_0036255
687 Ga0495676_0117688
688 Ga0495687_101251
689 Ga0495685_002808
690 Ga0495685_032643
691 Ga0495593_0136926
692 Ga0495626_0246807
693 Ga0496100_0002206
694 Ga0496100_0003057
695 Ga0496101_0000176
696 Ga0496101_0026152
697 Ga0496102_0001430
698 Ga0496103_0000570
699 Ga0496103_0498023
700 Ga0496104_0015578
701 Ga0496104_0033594
702 Ga0496105_0013734
703 Ga0496105_0040407
704 Ga0496106_0000351
705 Ga0496106_0001063
706 Ga0496107_0009908
707 Ga0496107_0013016
708 Ga0496108_0203571
709 Ga0496109_0266834
710 Ga0496110_0986918
711 Ga0496111_0066608
712 Ga0496113_0396545
713 Ga0496114_0005152
714 Ga0496114_0021466
715 Ga0496114_0077566
716 Ga0496115_0024950
717 Ga0496115_0039425
718 Ga0501032_0983026
719 Ga0501036_0265430
720 Ga0501038_0058219
721 Ga0501043_0242951
722 Ga0501072_0020702
723 Ga0501035_0281982
724 Ga0501044_0196363
725 Ga0501044_0489914
726 nmdc:mga05p37_72343_c1
727 nmdc:mga0qj67_109733_c1
728 nmdc:mga06r32_7364_c2
729 nmdc:mga0sz30_260780_c1
730 Ga0495655_0149573
731 Ga0500644_0202718
732 Ga0500644_0468475
733 Ga0500660_011837
734 Ga0500556_0206318
735 Ga0500562_014512
736 Ga0500569_266418
737 Ga0500568_0278936
738 Ga0500589_227419
739 Ga0500600_0084994
740 Ga0500600_0135920
741 Ga0500604_0055669
742 Ga0500616_0004538
743 Ga0500616_0085212
744 Ga0501084_0000252
745 Ga0501084_1589953
746 2583150905
747 2585312732
748 2586060861
749 2616693591
750 2809590131
751 2862580857
752 2867307365
753 2867315008
754 2867319995
755 2939589238
756 8003317512
757 8047713048
758 8056063541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

19

44

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

139

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8578 5 141
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8562 6 131
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8459 5 141
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8216 6 143
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8212 6 142
ID Description Score Start End Superfamily
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8711 6 137 3.10.180.10
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.846 6 137 3.10.180.10
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8384 10 59 3.30.720.120
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8167 11 57 3.30.720.120
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8117 10 134 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3S2FG49-F1-model_v4 deleted 0.9558 8 58
AF-A0A0R2PN11-F1-model_v4 Glyoxalase 0.9542 8 136
AF-A0A2G7BP53-F1-model_v4 deleted 0.9459 1 143
AF-A0A0R2PN11-F1-model_v4 Glyoxalase 0.9401 8 136
AF-A0A2E4M6N9-F1-model_v4 Glyoxalase 0.94 8 143

Map