F428205

General Info

Members Datasets Scaffolds Average Seq Length
378 267 342 221

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904479285|2904481885
Length 251
Sequence PASSPHAPAPVNILLAGFEPFDRDSVNPSWEVARALDGWQPDRAAVPGTGSGEATGETGQAGDRAAGRAVVHALQLRCVFGQATAQLDEAIATLRPALVICLGLAGGRADITPERVAINIDDARIADNAGLQPVDRAVVSGAPAAYFSSLPIKAIVHALRAAGLPASVSNTAGTFVCNHVFFALMHRLAQAGPGVQARGGFIHVPYLPEQAARVPGAPSMALETQIAALRSVIRTSLAVSQDLRETAGRLH

Samples

Sample ID Description Type Environment
1 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
2 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
3 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
4 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
5 2643221683 Variovorax sp. Root473 Isolate Unclassified
6 2721755523 Delftia sp. HK171 Isolate Unclassified
7 2738541277 Variovorax sp. GV051 Isolate Unclassified
8 2738541307 Variovorax sp. GV008 Isolate Unclassified
9 2738543013 Variovorax sp. BT01 Isolate Unclassified
10 2738543019 Variovorax sp. GV040 Isolate Unclassified
11 2818991446 Variovorax sp. 1180 Isolate Unclassified
12 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
13 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
14 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
15 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
16 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
17 2857472729 Cohnella sp. R-74144 Isolate Unclassified
18 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
19 2885198086 Variovorax sp. 679 Isolate Unclassified
20 2885211737 Variovorax sp. 553 Isolate Unclassified
21 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
22 2899924645 Variovorax sp. 369 Isolate Unclassified
23 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
24 2909042592 Labrys sp. LIt4 Isolate Nodule
25 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
26 2928037797 Variovorax sp. 1126 Isolate Unclassified
27 2928044640 Variovorax sp. 1128 Isolate Unclassified
28 2928051484 Variovorax sp. 1133 Isolate Unclassified
29 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
30 2928070936 Variovorax gossypii 1167 Isolate Unclassified
31 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
32 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
33 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
34 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
35 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
36 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
39 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
40 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
41 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
251 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
252 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
257 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
258 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
262 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
267 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.95
Metatranscriptomes 0.53
Isolates 9.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.34
Nodule 1.32
Rhizoplane 2.91
Rhizosphere 56.61
Stem 0
Stem Tuber 0
Unclassified 14.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005403 3300001979 Bacteria 5409
2 JGI25156J39149_1014513 3300002705 Bacteria 1621
3 JGI25154J39366_1000653 3300002738 Bacteria 16170
4 JGI25157J39369_1000045 3300002741 Bacteria 122406
5 JGI25150J39212_1001446 3300002774 Bacteria 6627
6 JGI25406J46586_10030045 3300003203 Bacteria 2049
7 rootH1_10010099 3300003316 Bacteria 4008
8 rootH2_10003406 3300003320 Bacteria 3285
9 rootH2_10123470 3300003320 Bacteria 1137
10 rootH1_10050453 3300003323 Bacteria 3646
11 JGI25160J50197_1032513 3300003354 Bacteria 1324
12 Ga0006562J51391_1094764 3300003578 Bacteria 4740
13 Ga0055539_1000277 3300003752 Bacteria 29675
14 Ga0055533_1000026 3300003756 Bacteria 323407
15 Ga0055525_1001182 3300003759 Bacteria 5947
16 Ga0055535_1000056 3300003761 Bacteria 128204
17 Ga0055535_1000522 3300003761 Bacteria 33444
18 Ga0055542_1000003 3300003762 Bacteria 582721
19 Ga0055529_1000165 3300003763 Bacteria 91442
20 Ga0055536_1001522 3300003781 Bacteria 13907
21 Ga0055536_1002089 3300003781 Bacteria 11385
22 Ga0055534_1003358 3300003784 Bacteria 5062
23 Ga0055534_1026891 3300003784 Bacteria 911
24 Ga0055530_10000773 3300003791 Bacteria 26694
25 Ga0055540_1001603 3300003792 Bacteria 13189
26 Ga0055540_1020962 3300003792 Bacteria 1713
27 Ga0065704_10074797 3300005289 Bacteria 6000
28 Ga0065704_10228391 3300005289 Bacteria 1051
29 Ga0070658_10063217 3300005327 Bacteria 3017
30 Ga0070676_10166633 3300005328 Bacteria 1422
31 Ga0070683_100015508 3300005329 Bacteria 6696
32 Ga0070660_100030644 3300005339 Bacteria 4035
33 Ga0070689_100287642 3300005340 Bacteria 1365
34 Ga0070661_100042701 3300005344 Bacteria 3310
35 Ga0070661_100221435 3300005344 Bacteria 1451
36 Ga0070673_100002753 3300005364 Bacteria 10798
37 Ga0070673_100745345 3300005364 Bacteria 902
38 Ga0070659_100135718 3300005366 Bacteria 2001
39 Ga0070659_100275252 3300005366 Bacteria 1399
40 Ga0070710_10135195 3300005437 Bacteria 1507
41 Ga0070708_100046726 3300005445 Bacteria 3820
42 Ga0070678_100163895 3300005456 Bacteria 1804
43 Ga0070662_100016695 3300005457 Bacteria 4933
44 Ga0068867_100228517 3300005459 Bacteria 1503
45 Ga0070698_100003981 3300005471 Bacteria 16258
46 Ga0070684_100042463 3300005535 Bacteria 3925
47 Ga0068853_100034356 3300005539 Bacteria 4304
48 Ga0070665_100002531 3300005548 Bacteria 20087
49 Ga0070665_100039521 3300005548 Bacteria 4743
50 Ga0068855_100043418 3300005563 Bacteria 5325
51 Ga0068855_100135535 3300005563 Bacteria 2809
52 Ga0068855_100276618 3300005563 Bacteria 1866
53 Ga0070664_100078272 3300005564 Bacteria 2844
54 Ga0070664_100150493 3300005564 Bacteria 2054
55 Ga0068857_100003768 3300005577 Bacteria 12751
56 Ga0068857_100033686 3300005577 Bacteria 4531
57 Ga0068857_100172372 3300005577 Bacteria 1967
58 Ga0068857_100629517 3300005577 Bacteria 1015
59 Ga0068854_100106673 3300005578 Bacteria 2108
60 Ga0068854_100144633 3300005578 Bacteria 1828
61 Ga0068856_100000820 3300005614 Bacteria 33500
62 Ga0068856_100104206 3300005614 Bacteria 2830
63 Ga0068852_100160065 3300005616 Bacteria 2101
64 Ga0068851_10006934 3300005834 Bacteria 5194
65 Ga0068863_100470121 3300005841 Bacteria 1236
66 Ga0081455_10014633 3300005937 Bacteria 7675
67 Ga0081455_10021483 3300005937 Bacteria 6054
68 Ga0075365_10039511 3300006038 Bacteria 3073
69 Ga0075365_10223906 3300006038 Bacteria 1320
70 Ga0075364_10024636 3300006051 Bacteria 3823
71 Ga0075362_10106410 3300006177 Bacteria 1316
72 Ga0097621_100545214 3300006237 Bacteria 1055
73 Ga0075370_10078613 3300006353 Bacteria 1894
74 Ga0075370_10158289 3300006353 Bacteria 1328
75 Ga0068871_101047880 3300006358 Bacteria 761
76 Ga0079104_1000016 3300006946 Bacteria 313865
77 Ga0105240_10013955 3300009093 Bacteria 10999
78 Ga0105240_10049305 3300009093 Bacteria 5316
79 Ga0105240_10059662 3300009093 Bacteria 4760
80 Ga0105240_10164701 3300009093 Bacteria 2630
81 Ga0105240_10495513 3300009093 Bacteria 1359
82 Ga0105245_10383940 3300009098 Bacteria 1399
83 Ga0114129_10008026 3300009147 Bacteria 15035
84 Ga0105243_10002952 3300009148 Bacteria 14064
85 Ga0105243_10004882 3300009148 Bacteria 10523
86 Ga0105243_10012585 3300009148 Bacteria 6396
87 Ga0105243_10716764 3300009148 Bacteria 977
88 Ga0105243_11045638 3300009148 Bacteria 822
89 Ga0105248_10866269 3300009177 Bacteria 1020
90 Ga0105237_10105794 3300009545 Bacteria 2805
91 Ga0105237_10293515 3300009545 Bacteria 1628
92 Ga0105237_10535650 3300009545 Bacteria 1178
93 Ga0105238_10063704 3300009551 Bacteria 3687
94 Ga0105238_10182838 3300009551 Bacteria 2073
95 Ga0105249_10201597 3300009553 Bacteria 1947
96 Ga0105239_10006672 3300010375 Bacteria 13334
97 Ga0105239_10036950 3300010375 Bacteria 5358
98 Ga0105239_10427887 3300010375 Bacteria 1500
99 Ga0105246_10143076 3300011119 Bacteria 1801
100 Ga0105246_10432096 3300011119 Bacteria 1102
101 Ga0157373_10351397 3300013100 Bacteria 1052
102 Ga0157371_10084415 3300013102 Bacteria 2250
103 Ga0157370_10003589 3300013104 Bacteria 18150
104 Ga0157370_10011155 3300013104 Bacteria 9418
105 Ga0157370_10200945 3300013104 Bacteria 1849
106 Ga0157369_10026307 3300013105 Bacteria 6456
107 Ga0157369_10105203 3300013105 Bacteria 3005
108 Ga0157369_10562854 3300013105 Bacteria 1178
109 Ga0157378_10251415 3300013297 Bacteria 1692
110 Ga0157372_10189287 3300013307 Bacteria 2383
111 Ga0157372_10363692 3300013307 Bacteria 1686
112 Ga0157375_10635829 3300013308 Bacteria 1224
113 Ga0157380_10515985 3300014326 Bacteria 1164
114 Ga0182008_10000566 3300014497 Bacteria 27335
115 Ga0182008_10009747 3300014497 Bacteria 5170
116 Ga0182008_10018023 3300014497 Bacteria 3657
117 Ga0182008_10238445 3300014497 Bacteria 935
118 Ga0157376_10992181 3300014969 Bacteria 862
119 Ga0182006_1001767 3300015261 Bacteria 12532
120 Ga0206356_10390864 3300020070 Bacteria 777
121 Ga0209436_110267 3300025208 Bacteria 1722
122 Ga0209674_100024 3300025226 Bacteria 535481
123 Ga0209147_100657 3300025229 Bacteria 17942
124 Ga0209563_100069 3300025230 Bacteria 253154
125 Ga0209258_100015 3300025242 Bacteria 706310
126 Ga0209258_100071 3300025242 Bacteria 278319
127 Ga0207425_1000229 3300025245 Bacteria 43700
128 Ga0209646_1000012 3300025246 Bacteria 573300
129 Ga0209026_1000004 3300025250 Bacteria 949012
130 Ga0209677_100092 3300025253 Bacteria 102482
131 Ga0209677_100983 3300025253 Bacteria 13758
132 Ga0209677_102787 3300025253 Bacteria 6198
133 Ga0209148_1000028 3300025254 Bacteria 582773
134 Ga0209759_1000003 3300025256 Bacteria 792130
135 Ga0209759_1000936 3300025256 Bacteria 21031
136 Ga0209759_1005202 3300025256 Bacteria 4626
137 Ga0209129_1000049 3300025258 Bacteria 268086
138 Ga0209565_1002407 3300025263 Bacteria 6774
139 Ga0209565_1003093 3300025263 Bacteria 5583
140 Ga0209455_1000030 3300025272 Bacteria 533479
141 Ga0209130_1000966 3300025284 Bacteria 22644
142 Ga0209130_1001110 3300025284 Bacteria 19819
143 Ga0209130_1001905 3300025284 Bacteria 11776
144 Ga0209675_1002160 3300025291 Bacteria 10362
145 Ga0209675_1011140 3300025291 Bacteria 3002
146 Ga0209676_1000074 3300025292 Bacteria 305770
147 Ga0209676_1000209 3300025292 Bacteria 130388
148 Ga0209676_1003151 3300025292 Bacteria 10532
149 Ga0209676_1049158 3300025292 Bacteria 1121
150 Ga0209025_1001092 3300025294 Bacteria 39204
151 Ga0209025_1099258 3300025294 Bacteria 927
152 Ga0209758_1000496 3300025297 Bacteria 64085
153 Ga0209758_1030017 3300025297 Bacteria 2259
154 Ga0209050_1000015 3300025298 Bacteria 759102
155 Ga0209050_1044436 3300025298 Bacteria 1188
156 Ga0209256_1000264 3300025299 Bacteria 92750
157 Ga0209256_1000304 3300025299 Bacteria 85971
158 Ga0207426_1000108 3300025302 Bacteria 242257
159 Ga0207426_1000130 3300025302 Bacteria 210271
160 Ga0209051_1000010 3300025303 Bacteria 641298
161 Ga0209051_1000156 3300025303 Bacteria 128246
162 Ga0209051_1012147 3300025303 Bacteria 4182
163 Ga0209257_1000026 3300025304 Bacteria 723225
164 Ga0209257_1031533 3300025304 Bacteria 1694
165 Ga0209257_1032143 3300025304 Bacteria 1668
166 Ga0207656_10006260 3300025321 Bacteria 4263
167 Ga0207655_1109155 3300025728 Bacteria 938
168 Ga0207645_10191824 3300025907 Bacteria 1343
169 Ga0207705_10076203 3300025909 Bacteria 2438
170 Ga0207705_10305002 3300025909 Bacteria 1222
171 Ga0207654_10275042 3300025911 Bacteria 1137
172 Ga0207695_10043744 3300025913 Bacteria 4770
173 Ga0207695_10137288 3300025913 Bacteria 2397
174 Ga0207671_10083155 3300025914 Bacteria 2403
175 Ga0207657_10021972 3300025919 Bacteria 5991
176 Ga0207657_10253633 3300025919 Bacteria 1402
177 Ga0207649_10171517 3300025920 Bacteria 1512
178 Ga0207681_10221598 3300025923 Bacteria 1464
179 Ga0207687_10067986 3300025927 Bacteria 2536
180 Ga0207687_10148237 3300025927 Bacteria 1787
181 Ga0207690_10066367 3300025932 Bacteria 2471
182 Ga0207690_10085872 3300025932 Bacteria 2210
183 Ga0207709_10000433 3300025935 Bacteria 39614
184 Ga0207709_10001930 3300025935 Bacteria 13624
185 Ga0207709_10003041 3300025935 Bacteria 10171
186 Ga0207679_10173670 3300025945 Bacteria 1776
187 Ga0207667_10025674 3300025949 Bacteria 6446
188 Ga0207667_10034440 3300025949 Bacteria 5437
189 Ga0207651_10002599 3300025960 Bacteria 8636
190 Ga0207640_10010498 3300025981 Bacteria 5218
191 Ga0207640_10160220 3300025981 Bacteria 1664
192 Ga0207678_10138712 3300026067 Bacteria 2075
193 Ga0207702_10000189 3300026078 Bacteria 74204
194 Ga0207702_10110979 3300026078 Bacteria 2438
195 Ga0207648_10196040 3300026089 Bacteria 1791
196 Ga0207648_11083452 3300026089 Bacteria 751
197 Ga0207674_10006937 3300026116 Bacteria 13267
198 Ga0207674_10043968 3300026116 Bacteria 4604
199 Ga0207674_10050303 3300026116 Bacteria 4258
200 Ga0207675_100474516 3300026118 Bacteria 1242
201 Ga0207683_10089896 3300026121 Bacteria 2734
202 Ga0207698_10160047 3300026142 Bacteria 1968
203 Ga0207698_10184781 3300026142 Bacteria 1851
204 Ga0209281_1000017 3300027111 Bacteria 583251
205 Ga0268266_10103680 3300028379 Bacteria 2510
206 Ga0268265_11007996 3300028380 Bacteria 823
207 Ga0307511_10206251 3300030521 Bacteria 1011
208 Ga0265332_10000006 3300031238 Bacteria 327963
209 Ga0307516_10002796 3300031730 Bacteria 23020
210 Ga0307405_10017518 3300031731 Bacteria 3932
211 Ga0307412_10046374 3300031911 Bacteria 2847
212 Ga0307416_100130916 3300032002 Bacteria 2258
213 Ga0307416_100351119 3300032002 Bacteria 1492
214 Ga0373934_0040084 3300035086 Bacteria 1847
215 Ga0373923_0057157 3300035111 Bacteria 1649
216 Ga0373931_0109468 3300035691 Bacteria 1565
217 Ga0373931_0168176 3300035691 Bacteria 1290
218 Ga0395899_0005550 3300037312 Bacteria 9773
219 Ga0395899_0036014 3300037312 Bacteria 3714
220 Ga0395899_0124725 3300037312 Bacteria 1842
221 Ga0395900_0001993 3300037418 Bacteria 23054
222 Ga0395900_0169503 3300037418 Bacteria 2223
223 Ga0395898_0037709 3300037466 Bacteria 4793
224 Ga0395898_0047599 3300037466 Bacteria 4207
225 Ga0395898_0125356 3300037466 Bacteria 2460
226 Ga0395905_0443731 3300037471 Bacteria 1195
227 Ga0395901_0024450 3300038443 Bacteria 6200
228 Ga0395901_0052984 3300038443 Bacteria 4216
229 Ga0395901_0196634 3300038443 Bacteria 2114
230 Ga0439447_024103 3300041407 Bacteria 1579
231 Ga0451789_0898372 3300041443 Bacteria 984
232 Ga0451793_1301558 3300041452 Bacteria 959
233 Ga0451802_1176912 3300041460 Bacteria 1007
234 Ga0450911_000642 3300042115 Bacteria 10478
235 Ga0466969_0018469 3300044656 Bacteria 3631
236 Ga0453683_0007877 3300044673 Bacteria 7187
237 Ga0466965_0001063 3300044683 Bacteria 10654
238 Ga0466966_0001186 3300044684 Bacteria 16728
239 Ga0466961_0062784 3300044693 Bacteria 2360
240 Ga0466963_0297710 3300044694 Bacteria 1134
241 Ga0466964_0020780 3300044706 Bacteria 2531
242 Ga0453684_0028691 3300044712 Bacteria 7928
243 Ga0466971_0011337 3300044719 Bacteria 3903
244 Ga0466959_0009705 3300045049 Bacteria 6853
245 Ga0451576_0052842 3300045051 Bacteria 4257
246 Ga0451576_0073135 3300045051 Bacteria 3567
247 Ga0451576_0124166 3300045051 Bacteria 2689
248 Ga0451576_0299062 3300045051 Bacteria 1683
249 Ga0466967_0035459 3300045976 Bacteria 4247
250 Ga0466967_0197986 3300045976 Bacteria 1901
251 Ga0466967_0304326 3300045976 Bacteria 1534
252 Ga0495627_040792 3300046453 Bacteria 1428
253 Ga0495651_0215261 3300046462 Bacteria 1334
254 Ga0495650_0009608 3300046471 Bacteria 5484
255 Ga0495639_0050100 3300046475 Bacteria 1896
256 Ga0495583_0000018 3300046506 Bacteria 306541
257 Ga0495606_0000863 3300046507 Bacteria 45411
258 Ga0495608_0237388 3300046511 Bacteria 1140
259 Ga0495616_0001315 3300046513 Bacteria 17340
260 Ga0495620_0075496 3300046515 Bacteria 1371
261 Ga0495631_0000382 3300046518 Bacteria 30522
262 Ga0495637_0153283 3300046520 Bacteria 868
263 Ga0495652_0231996 3300046529 Bacteria 1380
264 Ga0495654_0002882 3300046530 Bacteria 10795
265 Ga0495621_0058364 3300046539 Bacteria 1396
266 Ga0495597_0001209 3300046542 Bacteria 19263
267 Ga0495656_0002017 3300046615 Bacteria 6684
268 Ga0495625_0007320 3300046660 Bacteria 9641
269 Ga0495625_0054013 3300046660 Bacteria 2870
270 Ga0495669_0071686 3300046684 Bacteria 1580
271 Ga0495649_0000051 3300046694 Bacteria 109180
272 Ga0495589_0041835 3300046794 Bacteria 2285
273 Ga0495676_0131225 3300047321 Bacteria 1808
274 Ga0495677_0115228 3300047445 Bacteria 1023
275 Ga0495686_0029102 3300047472 Bacteria 3595
276 Ga0495686_0043800 3300047472 Bacteria 2835
277 Ga0495593_0023928 3300047673 Bacteria 3389
278 Ga0496101_0008123 3300048904 Bacteria 6847
279 Ga0496101_0623037 3300048904 Bacteria 853
280 Ga0496103_0083494 3300048906 Bacteria 2011
281 Ga0496114_0280969 3300048917 Bacteria 1468
282 Ga0496115_0004913 3300048918 Bacteria 9706
283 Ga0496116_0092763 3300048919 Bacteria 1830
284 Ga0496117_0084053 3300048920 Bacteria 2078
285 Ga0496118_0006742 3300048921 Bacteria 12503
286 Ga0496121_0009318 3300048924 Bacteria 11323
287 Ga0496122_0052835 3300048925 Bacteria 3070
288 Ga0496122_0184973 3300048925 Bacteria 1237
289 Ga0496122_0209629 3300048925 Bacteria 1130
290 Ga0496123_0060348 3300048926 Bacteria 2446
291 Ga0496123_0079355 3300048926 Bacteria 2006
292 Ga0496123_0140462 3300048926 Bacteria 1321
293 Ga0496124_0041291 3300048927 Bacteria 3982
294 Ga0496124_0101485 3300048927 Bacteria 2331
295 Ga0496124_0286396 3300048927 Bacteria 1198
296 Ga0496125_0008173 3300048928 Bacteria 11015
297 Ga0496125_0023700 3300048928 Bacteria 5659
298 Ga0496125_0033468 3300048928 Bacteria 4548
299 Ga0496125_0099203 3300048928 Bacteria 2152
300 Ga0496125_0171267 3300048928 Bacteria 1459
301 Ga0496125_0373031 3300048928 Bacteria 844
302 Ga0496126_0000033 3300048929 Bacteria 368851
303 Ga0496126_0252325 3300048929 Bacteria 1470
304 Ga0501033_0008383 3300049570 Bacteria 8005
305 Ga0501034_0057592 3300049571 Bacteria 3907
306 Ga0501034_0289201 3300049571 Bacteria 1577
307 Ga0501037_0355139 3300049573 Bacteria 1010
308 Ga0501047_0799579 3300049581 Bacteria 758
309 Ga0501070_0603550 3300049586 Bacteria 875
310 Ga0501266_000204 3300049763 Bacteria 7689
311 Ga0501035_0466745 3300049822 Bacteria 1043
312 Ga0501044_0967111 3300049823 Bacteria 724
313 nmdc:mga03683_15081_c1 3300050489 Bacteria 2876
314 nmdc:mga03683_373439_c1 3300050489 Bacteria 678
315 nmdc:mga03n38_401082_c1 3300050490 Bacteria 755
316 nmdc:mga00v17_145636_c1 3300050491 Bacteria 1520
317 nmdc:mga0k408_31758_c1 3300050493 Bacteria 3017
318 nmdc:mga07m45_184197_c1 3300050496 Bacteria 1214
319 nmdc:mga05p37_96942_c2 3300050507 Bacteria 2020
320 Ga0500635_0000217 3300053080 Bacteria 26831
321 Ga0500643_103068 3300053087 Bacteria 773
322 Ga0500651_0000093 3300053093 Bacteria 55843
323 Ga0500571_000456 3300053110 Bacteria 16458
324 Ga0500572_038476 3300053111 Bacteria 1376
325 Ga0500572_127179 3300053111 Bacteria 827
326 Ga0500594_0003157 3300053118 Bacteria 3605
327 Ga0500595_107665 3300053119 Bacteria 795
328 Ga0500607_073089 3300053121 Bacteria 1766
329 Ga0500618_033095 3300053125 Bacteria 1207
330 Ga0500626_140930 3300053128 Bacteria 1012
331 Ga0500655_034734 3300053133 Bacteria 978
332 Ga0500564_092573 3300053138 Bacteria 1344
333 Ga0500568_0009844 3300053139 Bacteria 4516
334 Ga0500604_0081107 3300053151 Bacteria 1048
335 Ga0500619_000184 3300053154 Bacteria 14772
336 Ga0500624_008237 3300053157 Bacteria 1456
337 Ga0500634_0172497 3300053161 Bacteria 984
338 Ga0500638_006114 3300053162 Bacteria 4889
339 Ga0500636_0008269 3300053177 Bacteria 6036
340 Ga0500636_0219947 3300053177 Bacteria 990
341 Ga0500552_000318 3300053733 Bacteria 4407
342 Ga0500565_012555 3300053734 Bacteria 903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100046726 Ga0070708_1000467262 180
2 3300005471 Ga0070698_100003981 Ga0070698_1000039817 180
3 3300050489 nmdc:mga03683_15081_c1 nmdc:mga03683_15081_c1_52_600 181
4 3300053154 Ga0500619_000184 Ga0500619_000184_12395_13063 204
5 3300005937 Ga0081455_10021483 Ga0081455_100214836 205
6 iso_pu_bacteria 2857472729 2857476355 205
7 3300048917 Ga0496114_0280969 Ga0496114_0280969_827_1453 207
8 3300049763 Ga0501266_000204 Ga0501266_000204_5000_5701 207
9 3300003203 JGI25406J46586_10030045 JGI25406J46586_100300451 208
10 3300005329 Ga0070683_100015508 Ga0070683_1000155087 208
11 3300005340 Ga0070689_100287642 Ga0070689_1002876422 208
12 3300005344 Ga0070661_100221435 Ga0070661_1002214352 208
13 3300005364 Ga0070673_100745345 Ga0070673_1007453451 208
14 3300005437 Ga0070710_10135195 Ga0070710_101351952 208
15 3300005456 Ga0070678_100163895 Ga0070678_1001638952 208
16 3300005535 Ga0070684_100042463 Ga0070684_1000424633 208
17 3300005548 Ga0070665_100039521 Ga0070665_1000395214 208
18 3300005564 Ga0070664_100150493 Ga0070664_1001504932 208
19 3300005577 Ga0068857_100629517 Ga0068857_1006295172 208
20 3300005578 Ga0068854_100106673 Ga0068854_1001066732 208
21 3300005614 Ga0068856_100104206 Ga0068856_1001042062 208
22 3300005841 Ga0068863_100470121 Ga0068863_1004701211 208
23 3300005937 Ga0081455_10014633 Ga0081455_100146335 208
24 3300006038 Ga0075365_10039511 Ga0075365_100395113 208
25 3300006038 Ga0075365_10223906 Ga0075365_102239062 208
26 3300006177 Ga0075362_10106410 Ga0075362_101064102 208
27 3300006358 Ga0068871_101047880 Ga0068871_1010478801 208
28 3300009093 Ga0105240_10164701 Ga0105240_101647013 208
29 3300009148 Ga0105243_11045638 Ga0105243_110456382 208
30 3300009177 Ga0105248_10866269 Ga0105248_108662692 208
31 3300009545 Ga0105237_10535650 Ga0105237_105356502 208
32 3300009551 Ga0105238_10063704 Ga0105238_100637043 208
33 3300009553 Ga0105249_10201597 Ga0105249_102015972 208
34 3300010375 Ga0105239_10427887 Ga0105239_104278872 208
35 3300013104 Ga0157370_10200945 Ga0157370_102009451 208
36 3300013105 Ga0157369_10562854 Ga0157369_105628541 208
37 3300013307 Ga0157372_10189287 Ga0157372_101892873 208
38 3300014497 Ga0182008_10238445 Ga0182008_102384451 208
39 3300020070 Ga0206356_10390864 Ga0206356_103908641 208
40 3300025913 Ga0207695_10137288 Ga0207695_101372882 208
41 3300025920 Ga0207649_10171517 Ga0207649_101715172 208
42 3300025923 Ga0207681_10221598 Ga0207681_102215982 208
43 3300025949 Ga0207667_10034440 Ga0207667_100344404 208
44 3300026078 Ga0207702_10110979 Ga0207702_101109792 208
45 3300026089 Ga0207648_11083452 Ga0207648_110834521 208
46 3300026121 Ga0207683_10089896 Ga0207683_100898963 208
47 3300028380 Ga0268265_11007996 Ga0268265_110079961 208
48 3300035691 Ga0373931_0168176 Ga0373931_0168176_184_825 208
49 3300037312 Ga0395899_0005550 Ga0395899_0005550_7285_7926 208
50 3300037312 Ga0395899_0124725 Ga0395899_0124725_771_1412 208
51 3300037418 Ga0395900_0001993 Ga0395900_0001993_1033_1674 208
52 3300037418 Ga0395900_0169503 Ga0395900_0169503_716_1357 208
53 3300037466 Ga0395898_0047599 Ga0395898_0047599_2479_3120 208
54 3300037466 Ga0395898_0125356 Ga0395898_0125356_1539_2180 208
55 3300038443 Ga0395901_0024450 Ga0395901_0024450_3685_4326 208
56 3300038443 Ga0395901_0196634 Ga0395901_0196634_571_1212 208
57 3300041443 Ga0451789_0898372 Ga0451789_0898372_222_863 208
58 3300045976 Ga0466967_0197986 Ga0466967_0197986_411_1052 208
59 3300049570 Ga0501033_0008383 Ga0501033_0008383_1829_2470 208
60 3300049571 Ga0501034_0057592 Ga0501034_0057592_369_1010 208
61 3300049571 Ga0501034_0289201 Ga0501034_0289201_523_1164 208
62 3300049573 Ga0501037_0355139 Ga0501037_0355139_116_757 208
63 3300049581 Ga0501047_0799579 Ga0501047_0799579_105_746 208
64 3300049586 Ga0501070_0603550 Ga0501070_0603550_223_864 208
65 3300049822 Ga0501035_0466745 Ga0501035_0466745_338_979 208
66 3300049823 Ga0501044_0967111 Ga0501044_0967111_13_654 208
67 3300050489 nmdc:mga03683_373439_c1 nmdc:mga03683_373439_c1_23_664 208
68 3300050493 nmdc:mga0k408_31758_c1 nmdc:mga0k408_31758_c1_1867_2508 208
69 3300053119 Ga0500595_107665 Ga0500595_107665_20_661 208
70 3300053151 Ga0500604_0081107 Ga0500604_0081107_102_743 208
71 3300053161 Ga0500634_0172497 Ga0500634_0172497_82_723 208
72 3300053733 Ga0500552_000318 Ga0500552_000318_1990_2631 208
73 iso_pu_bacteria 2857465823 2857467165 210
74 iso_pu_bacteria 2857591370 2857591948 210
75 iso_pu_bacteria 2915606848 2915607552 210
76 iso_pu_bacteria 3001267043 3001270981 210
77 iso_pu_bacteria 3001272096 3001276590 210
78 3300009147 Ga0114129_10008026 Ga0114129_100080266 211
79 3300050507 nmdc:mga05p37_96942_c2 nmdc:mga05p37_96942_c2_1147_1785 211
80 3300005328 Ga0070676_10166633 Ga0070676_101666332 212
81 3300025907 Ga0207645_10191824 Ga0207645_101918242 212
82 iso_pu_bacteria 2894023352 2894023852 213
83 3300025253 Ga0209677_102787 Ga0209677_1027873 214
84 3300025909 Ga0207705_10305002 Ga0207705_103050022 214
85 3300045051 Ga0451576_0052842 Ga0451576_0052842_225_872 214
86 3300045051 Ga0451576_0124166 Ga0451576_0124166_396_1043 214
87 3300046615 Ga0495656_0002017 Ga0495656_0002017_5980_6627 214
88 3300046794 Ga0495589_0041835 Ga0495589_0041835_465_1112 214
89 3300048929 Ga0496126_0252325 Ga0496126_0252325_256_915 214
90 iso_pu_bacteria 2738543013 2739251967 214
91 3300002705 JGI25156J39149_1014513 JGI25156J39149_10145131 215
92 3300003761 Ga0055535_1000056 Ga0055535_100005638 215
93 3300003763 Ga0055529_1000165 Ga0055529_100016569 215
94 3300010375 Ga0105239_10006672 Ga0105239_100066728 215
95 3300025242 Ga0209258_100071 Ga0209258_10007185 215
96 3300025256 Ga0209759_1000936 Ga0209759_10009369 215
97 3300025272 Ga0209455_1000030 Ga0209455_1000030186 215
98 3300041407 Ga0439447_024103 Ga0439447_024103_548_1198 215
99 3300045051 Ga0451576_0299062 Ga0451576_0299062_495_1148 215
100 3300047472 Ga0495686_0043800 Ga0495686_0043800_1668_2318 215
101 3300048906 Ga0496103_0083494 Ga0496103_0083494_705_1355 215
102 3300048918 Ga0496115_0004913 Ga0496115_0004913_522_1172 215
103 3300048929 Ga0496126_0000033 Ga0496126_0000033_233542_234192 215
104 3300050490 nmdc:mga03n38_401082_c1 nmdc:mga03n38_401082_c1_43_693 215
105 iso_pu_bacteria 2842718218 2842718926 216
106 iso_pu_bacteria 2974320154 2974320218 216
107 3300003320 rootH2_10123470 rootH2_101234701 217
108 3300005327 Ga0070658_10063217 Ga0070658_100632173 217
109 3300005339 Ga0070660_100030644 Ga0070660_1000306443 217
110 3300005364 Ga0070673_100002753 Ga0070673_1000027538 217
111 3300005366 Ga0070659_100275252 Ga0070659_1002752522 217
112 3300005548 Ga0070665_100002531 Ga0070665_10000253113 217
113 3300009093 Ga0105240_10495513 Ga0105240_104955132 217
114 3300025909 Ga0207705_10076203 Ga0207705_100762032 217
115 3300025911 Ga0207654_10275042 Ga0207654_102750422 217
116 3300025919 Ga0207657_10021972 Ga0207657_100219724 217
117 3300025932 Ga0207690_10066367 Ga0207690_100663673 217
118 3300025960 Ga0207651_10002599 Ga0207651_100025995 217
119 3300028379 Ga0268266_10103680 Ga0268266_101036802 217
120 3300031730 Ga0307516_10002796 Ga0307516_1000279620 217
121 3300046462 Ga0495651_0215261 Ga0495651_0215261_590_1246 217
122 3300046471 Ga0495650_0009608 Ga0495650_0009608_3195_3851 217
123 3300046475 Ga0495639_0050100 Ga0495639_0050100_456_1112 217
124 3300046529 Ga0495652_0231996 Ga0495652_0231996_369_1025 217
125 3300046542 Ga0495597_0001209 Ga0495597_0001209_5000_5668 217
126 3300048904 Ga0496101_0623037 Ga0496101_0623037_73_729 217
127 3300048927 Ga0496124_0101485 Ga0496124_0101485_1133_1789 217
128 3300048928 Ga0496125_0008173 Ga0496125_0008173_5035_5691 217
129 3300048928 Ga0496125_0023700 Ga0496125_0023700_4473_5135 217
130 3300053080 Ga0500635_0000217 Ga0500635_0000217_19119_19775 217
131 iso_pu_bacteria 2721755523 2722881723 217
132 iso_pu_bacteria 2839138175 2839143431 217
133 iso_pu_bacteria 2909042592 2909042966 217
134 iso_pu_bacteria 2928115317 2928115430 217
135 3300002738 JGI25154J39366_1000653 JGI25154J39366_10006538 218
136 3300002741 JGI25157J39369_1000045 JGI25157J39369_100004577 218
137 3300003320 rootH2_10003406 rootH2_100034064 218
138 3300003784 Ga0055534_1003358 Ga0055534_10033587 218
139 3300005289 Ga0065704_10074797 Ga0065704_100747972 218
140 3300005459 Ga0068867_100228517 Ga0068867_1002285172 218
141 3300005563 Ga0068855_100043418 Ga0068855_1000434183 218
142 3300005563 Ga0068855_100135535 Ga0068855_1001355354 218
143 3300005577 Ga0068857_100003768 Ga0068857_10000376812 218
144 3300005577 Ga0068857_100172372 Ga0068857_1001723722 218
145 3300005578 Ga0068854_100144633 Ga0068854_1001446332 218
146 3300005614 Ga0068856_100000820 Ga0068856_10000082023 218
147 3300005616 Ga0068852_100160065 Ga0068852_1001600653 218
148 3300006237 Ga0097621_100545214 Ga0097621_1005452141 218
149 3300009093 Ga0105240_10013955 Ga0105240_1001395512 218
150 3300009093 Ga0105240_10059662 Ga0105240_100596623 218
151 3300009148 Ga0105243_10716764 Ga0105243_107167642 218
152 3300009551 Ga0105238_10182838 Ga0105238_101828382 218
153 3300010375 Ga0105239_10036950 Ga0105239_100369502 218
154 3300011119 Ga0105246_10143076 Ga0105246_101430762 218
155 3300013105 Ga0157369_10026307 Ga0157369_100263076 218
156 3300013297 Ga0157378_10251415 Ga0157378_102514153 218
157 3300013308 Ga0157375_10635829 Ga0157375_106358292 218
158 3300014969 Ga0157376_10992181 Ga0157376_109921811 218
159 3300025246 Ga0209646_1000012 Ga0209646_1000012462 218
160 3300025250 Ga0209026_1000004 Ga0209026_1000004158 218
161 3300025253 Ga0209677_100983 Ga0209677_1009835 218
162 3300025256 Ga0209759_1000003 Ga0209759_1000003570 218
163 3300025256 Ga0209759_1005202 Ga0209759_10052025 218
164 3300025284 Ga0209130_1001905 Ga0209130_10019052 218
165 3300025291 Ga0209675_1011140 Ga0209675_10111402 218
166 3300025292 Ga0209676_1003151 Ga0209676_10031517 218
167 3300025294 Ga0209025_1099258 Ga0209025_10992581 218
168 3300025298 Ga0209050_1044436 Ga0209050_10444362 218
169 3300025303 Ga0209051_1012147 Ga0209051_10121474 218
170 3300025913 Ga0207695_10043744 Ga0207695_100437444 218
171 3300025919 Ga0207657_10253633 Ga0207657_102536333 218
172 3300025949 Ga0207667_10025674 Ga0207667_100256745 218
173 3300025981 Ga0207640_10010498 Ga0207640_100104983 218
174 3300026078 Ga0207702_10000189 Ga0207702_1000018916 218
175 3300026089 Ga0207648_10196040 Ga0207648_101960402 218
176 3300026116 Ga0207674_10006937 Ga0207674_100069379 218
177 3300026116 Ga0207674_10050303 Ga0207674_100503033 218
178 3300026118 Ga0207675_100474516 Ga0207675_1004745162 218
179 3300026142 Ga0207698_10184781 Ga0207698_101847812 218
180 3300030521 Ga0307511_10206251 Ga0307511_102062512 218
181 3300031238 Ga0265332_10000006 Ga0265332_10000006261 218
182 3300035086 Ga0373934_0040084 Ga0373934_0040084_709_1371 218
183 3300035111 Ga0373923_0057157 Ga0373923_0057157_50_709 218
184 3300037312 Ga0395899_0036014 Ga0395899_0036014_996_1658 218
185 3300037466 Ga0395898_0037709 Ga0395898_0037709_3571_4233 218
186 3300037471 Ga0395905_0443731 Ga0395905_0443731_41_703 218
187 3300038443 Ga0395901_0052984 Ga0395901_0052984_1883_2545 218
188 3300044656 Ga0466969_0018469 Ga0466969_0018469_2087_2746 218
189 3300044673 Ga0453683_0007877 Ga0453683_0007877_6011_6670 218
190 3300044683 Ga0466965_0001063 Ga0466965_0001063_7785_8444 218
191 3300044684 Ga0466966_0001186 Ga0466966_0001186_13976_14635 218
192 3300044693 Ga0466961_0062784 Ga0466961_0062784_1289_1948 218
193 3300044706 Ga0466964_0020780 Ga0466964_0020780_1170_1829 218
194 3300044712 Ga0453684_0028691 Ga0453684_0028691_6233_6892 218
195 3300044719 Ga0466971_0011337 Ga0466971_0011337_826_1485 218
196 3300045049 Ga0466959_0009705 Ga0466959_0009705_1756_2415 218
197 3300045051 Ga0451576_0073135 Ga0451576_0073135_1872_2531 218
198 3300045976 Ga0466967_0035459 Ga0466967_0035459_940_1599 218
199 3300045976 Ga0466967_0304326 Ga0466967_0304326_783_1442 218
200 3300046506 Ga0495583_0000018 Ga0495583_0000018_140357_141016 218
201 3300046507 Ga0495606_0000863 Ga0495606_0000863_41815_42474 218
202 3300046660 Ga0495625_0007320 Ga0495625_0007320_5404_6063 218
203 3300046684 Ga0495669_0071686 Ga0495669_0071686_441_1100 218
204 3300046694 Ga0495649_0000051 Ga0495649_0000051_62746_63405 218
205 3300047472 Ga0495686_0029102 Ga0495686_0029102_1776_2435 218
206 3300048925 Ga0496122_0052835 Ga0496122_0052835_2060_2722 218
207 3300053177 Ga0500636_0008269 Ga0500636_0008269_2970_3629 218
208 3300003316 rootH1_10010099 rootH1_100100992 219
209 3300003323 rootH1_10050453 rootH1_100504535 219
210 3300003752 Ga0055539_1000277 Ga0055539_100027713 219
211 3300003756 Ga0055533_1000026 Ga0055533_1000026257 219
212 3300003759 Ga0055525_1001182 Ga0055525_10011824 219
213 3300009098 Ga0105245_10383940 Ga0105245_103839402 219
214 3300009545 Ga0105237_10293515 Ga0105237_102935153 219
215 3300014326 Ga0157380_10515985 Ga0157380_105159852 219
216 3300025226 Ga0209674_100024 Ga0209674_10002445 219
217 3300025230 Ga0209563_100069 Ga0209563_10006945 219
218 3300025253 Ga0209677_100092 Ga0209677_10009257 219
219 3300025927 Ga0207687_10148237 Ga0207687_101482372 219
220 3300035691 Ga0373931_0109468 Ga0373931_0109468_272_943 219
221 3300046511 Ga0495608_0237388 Ga0495608_0237388_74_739 219
222 3300048904 Ga0496101_0008123 Ga0496101_0008123_2192_2908 219
223 iso_pu_bacteria 2945984333 2945990113 219
224 3300006051 Ga0075364_10024636 Ga0075364_100246362 220
225 3300044694 Ga0466963_0297710 Ga0466963_0297710_177_845 220
226 3300048928 Ga0496125_0033468 Ga0496125_0033468_3106_3771 220
227 3300050491 nmdc:mga00v17_145636_c1 nmdc:mga00v17_145636_c1_376_1041 220
228 iso_pu_bacteria 2928084124 2928085688 220
229 3300005289 Ga0065704_10228391 Ga0065704_102283912 221
230 3300006353 Ga0075370_10078613 Ga0075370_100786133 221
231 3300006946 Ga0079104_1000016 Ga0079104_1000016228 221
232 3300009148 Ga0105243_10004882 Ga0105243_100048827 221
233 3300014497 Ga0182008_10000566 Ga0182008_1000056612 221
234 3300025935 Ga0207709_10001930 Ga0207709_100019304 221
235 3300027111 Ga0209281_1000017 Ga0209281_1000017238 221
236 3300042115 Ga0450911_000642 Ga0450911_000642_6821_7501 221
237 3300048924 Ga0496121_0009318 Ga0496121_0009318_6185_6865 221
238 3300050496 nmdc:mga07m45_184197_c1 nmdc:mga07m45_184197_c1_395_1063 221
239 iso_pu_bacteria 2643221683 2644466499 221
240 3300005366 Ga0070659_100135718 Ga0070659_1001357183 222
241 3300005564 Ga0070664_100078272 Ga0070664_1000782722 222
242 3300005577 Ga0068857_100033686 Ga0068857_1000336863 222
243 3300009148 Ga0105243_10012585 Ga0105243_100125853 222
244 3300011119 Ga0105246_10432096 Ga0105246_104320961 222
245 3300025728 Ga0207655_1109155 Ga0207655_11091552 222
246 3300025927 Ga0207687_10067986 Ga0207687_100679863 222
247 3300025932 Ga0207690_10085872 Ga0207690_100858723 222
248 3300025935 Ga0207709_10003041 Ga0207709_100030412 222
249 3300025945 Ga0207679_10173670 Ga0207679_101736702 222
250 3300026116 Ga0207674_10043968 Ga0207674_100439684 222
251 3300005344 Ga0070661_100042701 Ga0070661_1000427012 223
252 3300005457 Ga0070662_100016695 Ga0070662_1000166953 223
253 3300015261 Ga0182006_1001767 Ga0182006_10017675 223
254 3300031911 Ga0307412_10046374 Ga0307412_100463743 223
255 3300013104 Ga0157370_10003589 Ga0157370_1000358920 224
256 3300013104 Ga0157370_10011155 Ga0157370_100111555 224
257 3300014497 Ga0182008_10009747 Ga0182008_100097472 224
258 3300014497 Ga0182008_10018023 Ga0182008_100180234 224
259 3300032002 Ga0307416_100351119 Ga0307416_1003511192 224
260 3300046513 Ga0495616_0001315 Ga0495616_0001315_16392_17069 224
261 3300046515 Ga0495620_0075496 Ga0495620_0075496_153_830 224
262 3300046518 Ga0495631_0000382 Ga0495631_0000382_22538_23215 224
263 3300046520 Ga0495637_0153283 Ga0495637_0153283_120_797 224
264 3300046530 Ga0495654_0002882 Ga0495654_0002882_3128_3805 224
265 3300046539 Ga0495621_0058364 Ga0495621_0058364_137_814 224
266 3300046660 Ga0495625_0054013 Ga0495625_0054013_33_710 224
267 3300047445 Ga0495677_0115228 Ga0495677_0115228_38_715 224
268 3300048925 Ga0496122_0209629 Ga0496122_0209629_32_709 224
269 3300048926 Ga0496123_0060348 Ga0496123_0060348_324_1001 224
270 3300053093 Ga0500651_0000093 Ga0500651_0000093_39146_39823 224
271 3300053118 Ga0500594_0003157 Ga0500594_0003157_906_1583 224
272 3300053139 Ga0500568_0009844 Ga0500568_0009844_3091_3768 224
273 iso_pu_bacteria 2599185214 2599621823 224
274 iso_pu_bacteria 2599185226 2599670493 224
275 iso_pu_bacteria 2599185227 2599678983 224
276 iso_pu_bacteria 2599185229 2599691334 224
277 iso_pu_bacteria 2738541307 2738882061 224
278 iso_pu_bacteria 2818991446 2819597990 224
279 iso_pu_bacteria 2831265667 2831268982 224
280 iso_pu_bacteria 2838054893 2838058408 224
281 iso_pu_bacteria 2885198086 2885203851 224
282 iso_pu_bacteria 2885211737 2885217814 224
283 iso_pu_bacteria 2899924645 2899929409 224
284 iso_pu_bacteria 2904479285 2904481885 224
285 iso_pu_bacteria 2928037797 2928040147 224
286 iso_pu_bacteria 2928044640 2928047104 224
287 iso_pu_bacteria 2928051484 2928057692 224
288 iso_pu_bacteria 2928064002 2928067925 224
289 iso_pu_bacteria 2928070936 2928072491 224
290 3300003781 Ga0055536_1001522 Ga0055536_10015227 225
291 3300003792 Ga0055540_1001603 Ga0055540_10016036 225
292 3300005563 Ga0068855_100276618 Ga0068855_1002766183 225
293 3300009148 Ga0105243_10002952 Ga0105243_100029526 225
294 3300009545 Ga0105237_10105794 Ga0105237_101057942 225
295 3300013100 Ga0157373_10351397 Ga0157373_103513971 225
296 3300013105 Ga0157369_10105203 Ga0157369_101052033 225
297 3300025292 Ga0209676_1000209 Ga0209676_100020941 225
298 3300025303 Ga0209051_1000156 Ga0209051_100015672 225
299 3300025304 Ga0209257_1031533 Ga0209257_10315332 225
300 3300025914 Ga0207671_10083155 Ga0207671_100831552 225
301 3300025935 Ga0207709_10000433 Ga0207709_1000043311 225
302 3300026142 Ga0207698_10160047 Ga0207698_101600473 225
303 3300031731 Ga0307405_10017518 Ga0307405_100175182 225
304 3300032002 Ga0307416_100130916 Ga0307416_1001309163 225
305 3300047321 Ga0495676_0131225 Ga0495676_0131225_202_885 225
306 3300047673 Ga0495593_0023928 Ga0495593_0023928_1048_1731 225
307 3300048927 Ga0496124_0041291 Ga0496124_0041291_2877_3557 225
308 3300053087 Ga0500643_103068 Ga0500643_103068_24_707 225
309 3300053110 Ga0500571_000456 Ga0500571_000456_396_1079 225
310 3300053111 Ga0500572_038476 Ga0500572_038476_470_1168 225
311 3300053111 Ga0500572_127179 Ga0500572_127179_33_713 225
312 3300053121 Ga0500607_073089 Ga0500607_073089_216_914 225
313 3300053125 Ga0500618_033095 Ga0500618_033095_179_862 225
314 3300053128 Ga0500626_140930 Ga0500626_140930_255_935 225
315 3300053133 Ga0500655_034734 Ga0500655_034734_74_757 225
316 3300053138 Ga0500564_092573 Ga0500564_092573_346_1029 225
317 3300053157 Ga0500624_008237 Ga0500624_008237_373_1056 225
318 3300053162 Ga0500638_006114 Ga0500638_006114_2705_3388 225
319 3300053177 Ga0500636_0219947 Ga0500636_0219947_133_816 225
320 3300053734 Ga0500565_012555 Ga0500565_012555_102_785 225
321 iso_pu_bacteria 2738541277 2738721885 226
322 iso_pu_bacteria 2738543019 2739282249 226
323 3300048919 Ga0496116_0092763 Ga0496116_0092763_128_814 227
324 3300048926 Ga0496123_0079355 Ga0496123_0079355_375_1061 227
325 3300048928 Ga0496125_0373031 Ga0496125_0373031_114_800 227
326 3300002774 JGI25150J39212_1001446 JGI25150J39212_10014466 228
327 3300003354 JGI25160J50197_1032513 JGI25160J50197_10325132 228
328 3300003578 Ga0006562J51391_1094764 Ga0006562J51391_10947643 228
329 3300003761 Ga0055535_1000522 Ga0055535_100052223 228
330 3300003762 Ga0055542_1000003 Ga0055542_100000384 228
331 3300003781 Ga0055536_1002089 Ga0055536_10020896 228
332 3300003784 Ga0055534_1026891 Ga0055534_10268911 228
333 3300003791 Ga0055530_10000773 Ga0055530_1000077310 228
334 3300003792 Ga0055540_1020962 Ga0055540_10209622 228
335 3300005834 Ga0068851_10006934 Ga0068851_100069344 228
336 3300006353 Ga0075370_10158289 Ga0075370_101582892 228
337 3300013102 Ga0157371_10084415 Ga0157371_100844152 228
338 3300013307 Ga0157372_10363692 Ga0157372_103636922 228
339 3300025208 Ga0209436_110267 Ga0209436_1102672 228
340 3300025229 Ga0209147_100657 Ga0209147_1006576 228
341 3300025242 Ga0209258_100015 Ga0209258_100015203 228
342 3300025245 Ga0207425_1000229 Ga0207425_100022916 228
343 3300025254 Ga0209148_1000028 Ga0209148_1000028465 228
344 3300025258 Ga0209129_1000049 Ga0209129_1000049207 228
345 3300025263 Ga0209565_1003093 Ga0209565_10030935 228
346 3300025284 Ga0209130_1000966 Ga0209130_100096622 228
347 3300025284 Ga0209130_1001110 Ga0209130_100111019 228
348 3300025291 Ga0209675_1002160 Ga0209675_10021606 228
349 3300025292 Ga0209676_1000074 Ga0209676_1000074266 228
350 3300025292 Ga0209676_1049158 Ga0209676_10491582 228
351 3300025294 Ga0209025_1001092 Ga0209025_10010926 228
352 3300025297 Ga0209758_1000496 Ga0209758_100049643 228
353 3300025297 Ga0209758_1030017 Ga0209758_10300172 228
354 3300025298 Ga0209050_1000015 Ga0209050_1000015204 228
355 3300025299 Ga0209256_1000264 Ga0209256_100026423 228
356 3300025299 Ga0209256_1000304 Ga0209256_100030423 228
357 3300025302 Ga0207426_1000108 Ga0207426_1000108207 228
358 3300025302 Ga0207426_1000130 Ga0207426_1000130189 228
359 3300025303 Ga0209051_1000010 Ga0209051_1000010204 228
360 3300025304 Ga0209257_1000026 Ga0209257_1000026473 228
361 3300025304 Ga0209257_1032143 Ga0209257_10321431 228
362 3300025321 Ga0207656_10006260 Ga0207656_100062604 228
363 3300026067 Ga0207678_10138712 Ga0207678_101387123 228
364 3300041452 Ga0451793_1301558 Ga0451793_1301558_188_883 228
365 3300041460 Ga0451802_1176912 Ga0451802_1176912_274_969 228
366 3300046453 Ga0495627_040792 Ga0495627_040792_392_1078 228
367 3300048926 Ga0496123_0140462 Ga0496123_0140462_150_836 228
368 3300048927 Ga0496124_0286396 Ga0496124_0286396_408_1094 228
369 3300048928 Ga0496125_0171267 Ga0496125_0171267_399_1085 228
370 3300001979 JGI24740J21852_10005403 JGI24740J21852_100054033 231
371 3300005539 Ga0068853_100034356 Ga0068853_1000343564 231
372 3300009093 Ga0105240_10049305 Ga0105240_100493052 231
373 3300025263 Ga0209565_1002407 Ga0209565_10024073 231
374 3300025981 Ga0207640_10160220 Ga0207640_101602202 231
375 3300048920 Ga0496117_0084053 Ga0496117_0084053_1284_1979 231
376 3300048921 Ga0496118_0006742 Ga0496118_0006742_11574_12269 231
377 3300048925 Ga0496122_0184973 Ga0496122_0184973_216_911 231
378 3300048928 Ga0496125_0099203 Ga0496125_0099203_398_1093 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01470

Peptidase_C15

Pyroglutamyl peptidase

53

239

0.94

PF01470

Peptidase_C15

Pyroglutamyl peptidase

11

50

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gxh-assembly1.cif.gz_C crystal structure of a pyrrolidone-carboxylate peptidase 1 (target id nysgrc-012831) from xenorhabdus bovienii ss-2004 0.9856 12 216
1aug-assembly1.cif.gz_D crystal structure of the pyroglutamyl peptidase i from bacillus amyloliquefaciens 0.9714 9 225
3lac-assembly1.cif.gz_A crystal structure of bacillus anthracis pyrrolidone-carboxylate peptidase, pcp 0.9668 11 220
3ro0-assembly1.cif.gz_D crystal structure of bacillus amyloliquefaciens pyroglutamyl peptidase i and terpyridine platinum(ii) 0.9665 11 223
1aug-assembly1.cif.gz_D crystal structure of the pyroglutamyl peptidase i from bacillus amyloliquefaciens 0.9624 9 225
ID Description Score Start End Superfamily
3lacB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9709 12 220 3.40.630.20
3lacB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9613 12 220 3.40.630.20
af_P9WIJ5_2_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9513 12 227 3.40.630.20
af_P9WIJ5_2_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9342 12 227 3.40.630.20
1iu8B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9257 12 216 3.40.630.20
ID Description Score Start End GO Terms
AF-A0A6L5EHE6-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9883 78 180 GO:0005829
GO:0006508
GO:0016920
AF-A0A826SCW1-F1-model_v4 deleted 0.982 81 152
AF-A0A3A1XEE5-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9812 78 216 GO:0005829
GO:0006508
GO:0016920
AF-J4WC63-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9809 12 217 GO:0005829
GO:0006508
GO:0016920
AF-C0QXM0-F1-model_v4 Pyrrolidone-carboxylate peptidase (EC 3.4.19.3) (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) 0.9807 12 217 GO:0005829
GO:0006508
GO:0016920

Feature Viewer

pLDDT pTM Quality
93.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map