F428139

General Info

Members Datasets Scaffolds Average Seq Length
378 226 756 273

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0021558|Ga0495674_0021558_428_1348
Length 306
Sequence MVSWLTPQSTYRGDLQRDGNYFLPDAAERDIQMTQDKNRTVKQYLLASDFDQTLSFNDSGIVLSELLGSSGFEEKVAGLSRIHLAQQGAELAYLLLHDPEYRCVRKEHLVEAGKQIRLKQNIRLLSRLLDGLDGYHFSFYVISAAPEEVIQAALEGIVPPDHIYGTRFQYHPATGEIQSIIRVPAGYGKVAVLEELRTKLQVGHDRVVYVGDGSSDIHVMLHVNRLDGLTIAVSENKYITPIAKRTILSDDALSVLVPMMEEIAGWDSTKIRALFETHGFVLQDWAKVRTDSLTIRETVALPHTAN

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
183 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
199 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
200 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
203 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
204 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
205 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
206 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
207 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
208 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
209 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 0.79
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 21.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0021558 3300047319 Bacteria 5957
2 Ga0065715_10133103 3300005293 Bacteria 1971
3 Ga0065715_10230258 3300005293 Bacteria 1236
4 Ga0070658_10009861 3300005327 Bacteria 7674
5 Ga0070658_10324070 3300005327 Bacteria 1316
6 Ga0070680_100361332 3300005336 Unclassified 1235
7 Ga0070680_100467204 3300005336 Bacteria 1078
8 Ga0068868_100035143 3300005338 Unclassified 3873
9 Ga0070660_100307730 3300005339 Bacteria 1300
10 Ga0070661_100215404 3300005344 Unclassified 1471
11 Ga0070675_100315463 3300005354 Bacteria 1380
12 Ga0070671_100391618 3300005355 Bacteria 1188
13 Ga0070674_100404443 3300005356 Bacteria 1116
14 Ga0070673_100115577 3300005364 Bacteria 2231
15 Ga0070688_100051033 3300005365 Bacteria 2579
16 Ga0070659_100115434 3300005366 Unclassified 2170
17 Ga0070667_100289289 3300005367 Unclassified 1473
18 Ga0070703_10003772 3300005406 Bacteria 4289
19 Ga0070703_10066462 3300005406 Bacteria 1193
20 Ga0070711_100108574 3300005439 Bacteria 2033
21 Ga0070705_100092573 3300005440 Bacteria 1887
22 Ga0070705_100141266 3300005440 Unclassified 1585
23 Ga0070694_100012586 3300005444 Bacteria 5265
24 Ga0070708_100162089 3300005445 Bacteria 2084
25 Ga0070708_100168531 3300005445 Bacteria 2043
26 Ga0070708_100449124 3300005445 Unclassified 1216
27 Ga0070663_100123814 3300005455 Bacteria 1956
28 Ga0070681_10002286 3300005458 Bacteria 17517
29 Ga0070681_10113700 3300005458 Bacteria 2646
30 Ga0070681_10359088 3300005458 Bacteria 1367
31 Ga0070706_100104426 3300005467 Bacteria 2635
32 Ga0070706_100151461 3300005467 Bacteria 2165
33 Ga0070706_100255797 3300005467 Unclassified 1635
34 Ga0070706_100481008 3300005467 Bacteria 1155
35 Ga0070707_100007762 3300005468 Bacteria 9968
36 Ga0070698_100030681 3300005471 Bacteria 5573
37 Ga0070698_100251829 3300005471 Bacteria 1699
38 Ga0070698_100421303 3300005471 Bacteria 1270
39 Ga0070698_100479830 3300005471 Bacteria 1180
40 Ga0070699_100007754 3300005518 Bacteria 9329
41 Ga0070699_100064302 3300005518 Bacteria 3182
42 Ga0070699_100115021 3300005518 Bacteria 2364
43 Ga0070699_100583064 3300005518 Unclassified 1019
44 Ga0070679_100032522 3300005530 Bacteria 5161
45 Ga0070679_100816726 3300005530 Unclassified 875
46 Ga0070697_100001571 3300005536 Bacteria 17406
47 Ga0070697_100080016 3300005536 Unclassified 2691
48 Ga0070697_100347447 3300005536 Unclassified 1281
49 Ga0068853_100513463 3300005539 Unclassified 1132
50 Ga0070696_100000477 3300005546 Bacteria 25172
51 Ga0070696_100278591 3300005546 Unclassified 1274
52 Ga0070665_100021507 3300005548 Bacteria 6485
53 Ga0070665_100278987 3300005548 Bacteria 1673
54 Ga0070665_100311137 3300005548 Bacteria 1579
55 Ga0070704_100013856 3300005549 Bacteria 5020
56 Ga0070704_100057860 3300005549 Bacteria 2759
57 Ga0070704_100179672 3300005549 Bacteria 1691
58 Ga0068855_100014177 3300005563 Bacteria 9604
59 Ga0068855_100017587 3300005563 Bacteria 8598
60 Ga0068855_100403696 3300005563 Unclassified 1497
61 Ga0070664_100015123 3300005564 Bacteria 6302
62 Ga0068857_100593823 3300005577 Unclassified 1046
63 Ga0068856_100146233 3300005614 Bacteria 2371
64 Ga0068852_100135505 3300005616 Unclassified 2273
65 Ga0068859_100237588 3300005617 Bacteria 1911
66 Ga0068859_100331379 3300005617 Bacteria 1616
67 Ga0068859_100433239 3300005617 Bacteria 1411
68 Ga0068864_100064095 3300005618 Bacteria 3186
69 Ga0068866_10067831 3300005718 Bacteria 1874
70 Ga0068863_100097061 3300005841 Bacteria 2798
71 Ga0068863_100163621 3300005841 Unclassified 2133
72 Ga0081455_10003410 3300005937 Bacteria 18278
73 Ga0070717_10013265 3300006028 Bacteria 6308
74 Ga0070717_10066908 3300006028 Bacteria 2988
75 Ga0070717_10159159 3300006028 Bacteria 1958
76 Ga0070717_10200017 3300006028 Unclassified 1750
77 Ga0070717_10484172 3300006028 Bacteria 1117
78 Ga0075367_10095419 3300006178 Bacteria 1814
79 Ga0075366_10205307 3300006195 Unclassified 1199
80 Ga0068871_100039458 3300006358 Unclassified 3778
81 Ga0068871_100125013 3300006358 Bacteria 2176
82 Ga0068871_100388357 3300006358 Bacteria 1241
83 Ga0075428_100006683 3300006844 Bacteria 12830
84 Ga0075428_100065977 3300006844 Bacteria 3964
85 Ga0075428_100183621 3300006844 Bacteria 2263
86 Ga0075431_100032142 3300006847 Bacteria 5408
87 Ga0075431_100083700 3300006847 Bacteria 3294
88 Ga0075431_100393253 3300006847 Bacteria 1388
89 Ga0075433_10077236 3300006852 Bacteria 2933
90 Ga0075433_10108790 3300006852 Bacteria 2459
91 Ga0075434_100035736 3300006871 Bacteria 4912
92 Ga0075434_100114655 3300006871 Bacteria 2708
93 Ga0075429_100125704 3300006880 Bacteria 2242
94 Ga0075429_100179947 3300006880 Bacteria 1853
95 Ga0075436_100000762 3300006914 Bacteria 21308
96 Ga0075436_100070949 3300006914 Bacteria 2408
97 Ga0097620_100237589 3300006931 Bacteria 1911
98 Ga0097620_100331361 3300006931 Bacteria 1616
99 Ga0097620_100433283 3300006931 Bacteria 1411
100 Ga0075435_100418461 3300007076 Bacteria 1154
101 Ga0099794_10002964 3300007265 Bacteria 6401
102 Ga0105240_10001075 3300009093 Bacteria 48253
103 Ga0105240_10038556 3300009093 Bacteria 6128
104 Ga0105240_10098254 3300009093 Bacteria 3566
105 Ga0111539_10001256 3300009094 Bacteria 33804
106 Ga0111539_10737498 3300009094 Bacteria 1147
107 Ga0105245_10017164 3300009098 Bacteria 6314
108 Ga0105245_10384256 3300009098 Bacteria 1399
109 Ga0114129_10003717 3300009147 Bacteria 21506
110 Ga0114129_10103947 3300009147 Bacteria 3926
111 Ga0114129_10347087 3300009147 Bacteria 1967
112 Ga0114129_10395475 3300009147 Bacteria 1822
113 Ga0114129_10500860 3300009147 Bacteria 1586
114 Ga0114129_10503630 3300009147 Unclassified 1581
115 Ga0105241_10030987 3300009174 Bacteria 4000
116 Ga0105241_10158547 3300009174 Unclassified 1858
117 Ga0105241_10201663 3300009174 Bacteria 1662
118 Ga0105241_10234135 3300009174 Bacteria 1549
119 Ga0105241_10308663 3300009174 Bacteria 1360
120 Ga0105242_10080406 3300009176 Unclassified 2724
121 Ga0105242_10093356 3300009176 Unclassified 2537
122 Ga0105248_10205833 3300009177 Bacteria 2217
123 Ga0105248_10407565 3300009177 Unclassified 1531
124 Ga0105237_10050224 3300009545 Bacteria 4191
125 Ga0105237_10099811 3300009545 Bacteria 2894
126 Ga0105237_10281912 3300009545 Bacteria 1664
127 Ga0105237_10289169 3300009545 Bacteria 1642
128 Ga0105238_10026286 3300009551 Bacteria 5933
129 Ga0105238_10060714 3300009551 Bacteria 3784
130 Ga0105238_10097249 3300009551 Unclassified 2930
131 Ga0105249_10091836 3300009553 Unclassified 2841
132 Ga0105239_10113922 3300010375 Bacteria 2999
133 Ga0157370_10307672 3300013104 Bacteria 1463
134 Ga0157369_10001357 3300013105 Bacteria 30238
135 Ga0157369_10021828 3300013105 Bacteria 7158
136 Ga0157369_10055262 3300013105 Unclassified 4286
137 Ga0157374_10115998 3300013296 Bacteria 2580
138 Ga0157374_10181885 3300013296 Bacteria 2054
139 Ga0157378_10291667 3300013297 Bacteria 1576
140 Ga0163162_10007738 3300013306 Bacteria 10470
141 Ga0157372_10023620 3300013307 Bacteria 6670
142 Ga0157375_10013230 3300013308 Bacteria 7336
143 Ga0157375_10401509 3300013308 Bacteria 1537
144 Ga0157375_10867815 3300013308 Unclassified 1048
145 Ga0163163_10103370 3300014325 Bacteria 2874
146 Ga0157379_10315086 3300014968 Bacteria 1428
147 Ga0157376_10189094 3300014969 Unclassified 1887
148 Ga0157376_10393178 3300014969 Bacteria 1339
149 Ga0157376_10820901 3300014969 Unclassified 944
150 Ga0213873_10070862 3300021358 Unclassified 960
151 Ga0213872_10001075 3300021361 Bacteria 18826
152 Ga0213874_10015712 3300021377 Bacteria 2002
153 Ga0213876_10019432 3300021384 Unclassified 3589
154 Ga0213875_10000601 3300021388 Bacteria 29135
155 Ga0213875_10160580 3300021388 Bacteria 1054
156 Ga0213875_10180239 3300021388 Unclassified 992
157 Ga0213871_10000884 3300021441 Bacteria 4572
158 Ga0207642_10053478 3300025899 Bacteria 1837
159 Ga0207685_10128409 3300025905 Bacteria 1122
160 Ga0207705_10064333 3300025909 Unclassified 2650
161 Ga0207684_10076914 3300025910 Unclassified 2837
162 Ga0207684_10201696 3300025910 Bacteria 1716
163 Ga0207654_10248467 3300025911 Unclassified 1191
164 Ga0207707_10079689 3300025912 Unclassified 2859
165 Ga0207707_10265437 3300025912 Bacteria 1489
166 Ga0207695_10010472 3300025913 Bacteria 11341
167 Ga0207695_10138444 3300025913 Unclassified 2386
168 Ga0207695_10145959 3300025913 Bacteria 2310
169 Ga0207671_10019789 3300025914 Bacteria 5139
170 Ga0207671_10422212 3300025914 Bacteria 1061
171 Ga0207693_10474130 3300025915 Bacteria 977
172 Ga0207660_10116871 3300025917 Bacteria 2015
173 Ga0207660_10417702 3300025917 Bacteria 1082
174 Ga0207657_10007163 3300025919 Bacteria 11456
175 Ga0207646_10038154 3300025922 Bacteria 4328
176 Ga0207646_10046989 3300025922 Bacteria 3873
177 Ga0207694_10168274 3300025924 Archaea 1773
178 Ga0207687_10017133 3300025927 Unclassified 4763
179 Ga0207644_10322384 3300025931 Bacteria 1249
180 Ga0207690_10145065 3300025932 Unclassified 1754
181 Ga0207686_10050947 3300025934 Unclassified 2577
182 Ga0207665_10231840 3300025939 Bacteria 1357
183 Ga0207711_10365549 3300025941 Bacteria 1337
184 Ga0207667_10049558 3300025949 Unclassified 4435
185 Ga0207667_10359818 3300025949 Unclassified 1484
186 Ga0207651_10197145 3300025960 Bacteria 1610
187 Ga0207712_10070607 3300025961 Unclassified 2509
188 Ga0207677_10037183 3300026023 Unclassified 3180
189 Ga0207703_10033585 3300026035 Unclassified 4069
190 Ga0207703_10483611 3300026035 Bacteria 1160
191 Ga0207639_10210882 3300026041 Unclassified 1672
192 Ga0207639_10464309 3300026041 Unclassified 1151
193 Ga0207708_10030172 3300026075 Bacteria 4112
194 Ga0207702_10025753 3300026078 Bacteria 4884
195 Ga0207641_10090407 3300026088 Bacteria 2677
196 Ga0207641_10143357 3300026088 Unclassified 2158
197 Ga0207683_10111228 3300026121 Unclassified 2453
198 Ga0209966_1031749 3300027695 Bacteria 1072
199 Ga0207428_10155724 3300027907 Bacteria 1738
200 Ga0268266_10022521 3300028379 Bacteria 5368
201 Ga0268266_10088649 3300028379 Unclassified 2708
202 Ga0268266_10139733 3300028379 Bacteria 2173
203 Ga0268265_10107469 3300028380 Bacteria 2269
204 Ga0265338_10307383 3300028800 Bacteria 1151
205 Ga0265332_10128135 3300031238 Bacteria 1065
206 Ga0265325_10091262 3300031241 Unclassified 1502
207 Ga0265316_10004747 3300031344 Bacteria 13439
208 Ga0307408_100004678 3300031548 Bacteria 9244
209 Ga0307408_100055114 3300031548 Bacteria 2877
210 Ga0307408_100075999 3300031548 Bacteria 2497
211 Ga0307405_10016163 3300031731 Bacteria 4063
212 Ga0307413_10002366 3300031824 Bacteria 7655
213 Ga0307413_10010895 3300031824 Bacteria 4438
214 Ga0307413_10047994 3300031824 Bacteria 2549
215 Ga0307410_10001899 3300031852 Bacteria 9778
216 Ga0307410_10005120 3300031852 Bacteria 6894
217 Ga0307410_10020102 3300031852 Bacteria 4077
218 Ga0307410_10023961 3300031852 Bacteria 3806
219 Ga0307406_10026270 3300031901 Bacteria 3494
220 Ga0307406_10089850 3300031901 Bacteria 2065
221 Ga0307407_10004196 3300031903 Bacteria 6079
222 Ga0307407_10004924 3300031903 Bacteria 5737
223 Ga0307407_10029035 3300031903 Bacteria 2965
224 Ga0307409_100001044 3300031995 Bacteria 13004
225 Ga0307409_100006252 3300031995 Bacteria 6977
226 Ga0307409_100057970 3300031995 Bacteria 3005
227 Ga0307409_100109552 3300031995 Bacteria 2312
228 Ga0307416_100000472 3300032002 Bacteria 20532
229 Ga0307416_100000888 3300032002 Bacteria 15774
230 Ga0307416_100010534 3300032002 Bacteria 6112
231 Ga0307416_100023939 3300032002 Bacteria 4444
232 Ga0307416_100351452 3300032002 Unclassified 1492
233 Ga0307414_10003598 3300032004 Bacteria 8294
234 Ga0307414_10017343 3300032004 Bacteria 4402
235 Ga0307414_10023552 3300032004 Bacteria 3908
236 Ga0307414_10371154 3300032004 Unclassified 1234
237 Ga0307411_10059927 3300032005 Bacteria 2525
238 Ga0307411_10134332 3300032005 Bacteria 1813
239 Ga0307411_10283639 3300032005 Unclassified 1319
240 Ga0307415_100005196 3300032126 Bacteria 6877
241 Ga0307415_100031101 3300032126 Bacteria 3434
242 Ga0307415_100034815 3300032126 Bacteria 3283
243 Ga0373926_0025881 3300035083 Unclassified 2050
244 Ga0373926_0071745 3300035083 Unclassified 1273
245 Ga0373934_0134083 3300035086 Bacteria 1011
246 Ga0373940_0010539 3300035088 Bacteria 2176
247 Ga0373956_0027418 3300035119 Bacteria 2473
248 Ga0373943_0212726 3300035170 Unclassified 1074
249 Ga0373955_0146951 3300035172 Bacteria 1385
250 Ga0373927_0000313 3300035695 Bacteria 37857
251 Ga0373927_0003663 3300035695 Bacteria 10949
252 Ga0373947_0008008 3300035725 Bacteria 6095
253 Ga0373937_0028753 3300036401 Bacteria 5032
254 Ga0395900_0059687 3300037418 Bacteria 3927
255 Ga0395900_0129511 3300037418 Bacteria 2587
256 Ga0395898_0600475 3300037466 Unclassified 1043
257 Ga0395905_0077704 3300037471 Bacteria 3110
258 Ga0395905_0263848 3300037471 Bacteria 1608
259 Ga0436364_0278774 3300037853 Bacteria 400541
260 Ga0436364_0493530 3300037853 Unclassified 3650
261 Ga0436364_0635341 3300037853 Bacteria 2310
262 Ga0436364_0693045 3300037853 Unclassified 911
263 Ga0436364_1397644 3300037853 Bacteria 40748
264 Ga0395901_0073580 3300038443 Unclassified 3564
265 Ga0436365_0165446 3300039437 Bacteria 12662
266 Ga0436360_1372434 3300039438 Bacteria 7395
267 Ga0436361_1113744 3300039447 Bacteria 49986
268 Ga0436363_0570522 3300039450 Unclassified 2700
269 Ga0436363_1072502 3300039450 Bacteria 6613
270 Ga0436362_0894037 3300039453 Bacteria 2860
271 Ga0453683_0140056 3300044673 Unclassified 1526
272 Ga0453683_0167618 3300044673 Bacteria 1391
273 Ga0453683_0359089 3300044673 Bacteria 936
274 Ga0466963_0208405 3300044694 Unclassified 1368
275 Ga0451576_0515767 3300045051 Bacteria 1256
276 Ga0451576_0863753 3300045051 Bacteria 950
277 Ga0495592_0100634 3300046454 Bacteria 2060
278 Ga0495638_0067205 3300046460 Bacteria 2201
279 Ga0495651_0047669 3300046462 Bacteria 3311
280 Ga0495653_0025861 3300046463 Bacteria 4710
281 Ga0495580_0018340 3300046472 Bacteria 5211
282 Ga0495580_0051041 3300046472 Bacteria 2924
283 Ga0495582_0095452 3300046473 Bacteria 1661
284 Ga0495662_0024423 3300046476 Bacteria 2916
285 Ga0495664_0042204 3300046477 Bacteria 2700
286 Ga0495608_0066979 3300046511 Bacteria 2350
287 Ga0495628_0044279 3300046516 Bacteria 3541
288 Ga0495630_0043503 3300046517 Bacteria 3355
289 Ga0495665_0024174 3300046531 Bacteria 3264
290 Ga0495640_0105343 3300046533 Bacteria 1847
291 Ga0495587_0066397 3300046536 Unclassified 2104
292 Ga0495645_0009568 3300046543 Bacteria 6778
293 Ga0495645_0012174 3300046543 Bacteria 6058
294 Ga0495645_0329910 3300046543 Unclassified 988
295 Ga0495667_0069649 3300046559 Bacteria 2296
296 Ga0495667_0077647 3300046559 Unclassified 2160
297 Ga0495634_0053789 3300046642 Bacteria 2695
298 Ga0495635_0053656 3300046663 Bacteria 2777
299 Ga0495599_0070508 3300046678 Unclassified 2181
300 Ga0495599_0174955 3300046678 Unclassified 1324
301 Ga0495623_0105947 3300046679 Unclassified 1708
302 Ga0495646_0042026 3300046680 Bacteria 2807
303 Ga0495613_0063864 3300046689 Bacteria 2693
304 Ga0495604_0105347 3300047317 Bacteria 2064
305 Ga0495604_0215145 3300047317 Unclassified 1326
306 Ga0495674_0071462 3300047319 Bacteria 2995
307 Ga0495674_0116028 3300047319 Bacteria 2265
308 Ga0495680_0068097 3300047322 Bacteria 2720
309 Ga0495675_0049917 3300047444 Bacteria 2659
310 Ga0495684_0009180 3300047471 Bacteria 7637
311 Ga0495684_0069602 3300047471 Bacteria 2675
312 Ga0495602_0096654 3300048088 Bacteria 2436
313 Ga0496102_0080644 3300048905 Bacteria 2998
314 Ga0496106_0077879 3300048909 Bacteria 2543
315 Ga0496109_0000050 3300048912 Bacteria 126918
316 Ga0501296_008624 3300049519 Unclassified 1185
317 Ga0501297_007303 3300049520 Unclassified 1197
318 Ga0501031_0038084 3300049568 Bacteria 3139
319 Ga0501032_0231716 3300049569 Bacteria 1201
320 Ga0501036_0014386 3300049572 Bacteria 6589
321 Ga0501039_0039665 3300049575 Bacteria 3637
322 Ga0501041_0315264 3300049577 Bacteria 986
323 Ga0501042_0017521 3300049578 Bacteria 4941
324 Ga0501046_0415609 3300049580 Bacteria 970
325 Ga0501048_0141652 3300049582 Bacteria 1700
326 Ga0501072_0154972 3300049588 Bacteria 1827
327 Ga0501075_0007339 3300049591 Bacteria 7646
328 Ga0501075_0137466 3300049591 Bacteria 1862
329 Ga0501076_0006621 3300049592 Bacteria 8402
330 Ga0501209_000704 3300049656 Bacteria 4220
331 Ga0501216_002112 3300049660 Bacteria 2788
332 Ga0501217_009856 3300049661 Bacteria 2084
333 Ga0501243_000466 3300049675 Bacteria 5387
334 Ga0501247_000188 3300049677 Bacteria 3986
335 Ga0501245_003290 3300049708 Unclassified 2191
336 Ga0501081_0136232 3300049743 Bacteria 1758
337 Ga0501262_001672 3300049759 Bacteria 2488
338 Ga0501263_001068 3300049760 Bacteria 2444
339 Ga0501266_001218 3300049763 Bacteria 3284
340 Ga0501268_000315 3300049765 Bacteria 5020
341 Ga0501270_000318 3300049767 Bacteria 4179
342 Ga0501272_000268 3300049769 Bacteria 4393
343 Ga0501273_002854 3300049770 Unclassified 1793
344 Ga0501283_004104 3300049779 Bacteria 1955
345 Ga0501035_0540011 3300049822 Bacteria 956
346 Ga0501045_0112447 3300049824 Bacteria 2019
347 nmdc:mga03683_64403_c1 3300050489 Bacteria 1555
348 nmdc:mga0k408_245973_c1 3300050493 Unclassified 1068
349 nmdc:mga06z11_73595_c1 3300050494 Bacteria 1814
350 nmdc:mga05p37_12126_c1 3300050507 Bacteria 10293
351 nmdc:mga05p37_14048_c1 3300050507 Bacteria 9606
352 nmdc:mga05p37_239897_c1 3300050507 Bacteria 2180
353 nmdc:mga05p37_2548_c1 3300050507 Bacteria 21189
354 nmdc:mga05p37_408580_c1 3300050507 Bacteria 1583
355 nmdc:mga05p37_505190_c1 3300050507 Bacteria 1386
356 nmdc:mga06r32_178000_c1 3300050510 Bacteria 2112
357 nmdc:mga06r32_51491_c1 3300050510 Bacteria 3941
358 nmdc:mga06r32_63893_c1 3300050510 Bacteria 3549
359 nmdc:mga08y16_193223_c1 3300050511 Bacteria 2110
360 nmdc:mga08y16_2063_c1 3300050511 Bacteria 20587
361 nmdc:mga08y16_2364_c1 3300050511 Bacteria 19364
362 nmdc:mga0n895_124369_c1 3300050512 Bacteria 2602
363 nmdc:mga0n895_30250_c1 3300050512 Bacteria 5173
364 nmdc:mga08x19_176801_c1 3300050514 Bacteria 1456
365 nmdc:mga08x19_574_c1 3300050514 Bacteria 23958
366 nmdc:mga0a205_110894_c1 3300050515 Bacteria 995
367 nmdc:mga0a205_130100_c1 3300050515 Bacteria 2418
368 nmdc:mga0a205_57362_c1 3300050515 Bacteria 3760
369 nmdc:mga0a205_86759_c1 3300050515 Bacteria 3023
370 Ga0495601_0228818 3300053077 Unclassified 1214
371 Ga0500592_005716 3300053116 Bacteria 1978
372 Ga0501084_0254490 3300054114 Bacteria 1482
373 Ga0590071_013447 3300059421 Bacteria 1915
374 Ga0590077_011911 3300059426 Bacteria 1798
375 Ga0501082_0000309 3300060353 Bacteria 43386
376 Ga0501082_0164056 3300060353 Bacteria 1931
377 Ga0501082_0213166 3300060353 Bacteria 1680
378 Ga0501082_0750866 3300060353 Unclassified 854
379 Ga0495674_0021558
380 Ga0065715_10133103
381 Ga0065715_10230258
382 Ga0070658_10009861
383 Ga0070658_10324070
384 Ga0070680_100361332
385 Ga0070680_100467204
386 Ga0068868_100035143
387 Ga0070660_100307730
388 Ga0070661_100215404
389 Ga0070675_100315463
390 Ga0070671_100391618
391 Ga0070674_100404443
392 Ga0070673_100115577
393 Ga0070688_100051033
394 Ga0070659_100115434
395 Ga0070667_100289289
396 Ga0070703_10003772
397 Ga0070703_10066462
398 Ga0070711_100108574
399 Ga0070705_100092573
400 Ga0070705_100141266
401 Ga0070694_100012586
402 Ga0070708_100162089
403 Ga0070708_100168531
404 Ga0070708_100449124
405 Ga0070663_100123814
406 Ga0070681_10002286
407 Ga0070681_10113700
408 Ga0070681_10359088
409 Ga0070706_100104426
410 Ga0070706_100151461
411 Ga0070706_100255797
412 Ga0070706_100481008
413 Ga0070707_100007762
414 Ga0070698_100030681
415 Ga0070698_100251829
416 Ga0070698_100421303
417 Ga0070698_100479830
418 Ga0070699_100007754
419 Ga0070699_100064302
420 Ga0070699_100115021
421 Ga0070699_100583064
422 Ga0070679_100032522
423 Ga0070679_100816726
424 Ga0070697_100001571
425 Ga0070697_100080016
426 Ga0070697_100347447
427 Ga0068853_100513463
428 Ga0070696_100000477
429 Ga0070696_100278591
430 Ga0070665_100021507
431 Ga0070665_100278987
432 Ga0070665_100311137
433 Ga0070704_100013856
434 Ga0070704_100057860
435 Ga0070704_100179672
436 Ga0068855_100014177
437 Ga0068855_100017587
438 Ga0068855_100403696
439 Ga0070664_100015123
440 Ga0068857_100593823
441 Ga0068856_100146233
442 Ga0068852_100135505
443 Ga0068859_100237588
444 Ga0068859_100331379
445 Ga0068859_100433239
446 Ga0068864_100064095
447 Ga0068866_10067831
448 Ga0068863_100097061
449 Ga0068863_100163621
450 Ga0081455_10003410
451 Ga0070717_10013265
452 Ga0070717_10066908
453 Ga0070717_10159159
454 Ga0070717_10200017
455 Ga0070717_10484172
456 Ga0075367_10095419
457 Ga0075366_10205307
458 Ga0068871_100039458
459 Ga0068871_100125013
460 Ga0068871_100388357
461 Ga0075428_100006683
462 Ga0075428_100065977
463 Ga0075428_100183621
464 Ga0075431_100032142
465 Ga0075431_100083700
466 Ga0075431_100393253
467 Ga0075433_10077236
468 Ga0075433_10108790
469 Ga0075434_100035736
470 Ga0075434_100114655
471 Ga0075429_100125704
472 Ga0075429_100179947
473 Ga0075436_100000762
474 Ga0075436_100070949
475 Ga0097620_100237589
476 Ga0097620_100331361
477 Ga0097620_100433283
478 Ga0075435_100418461
479 Ga0099794_10002964
480 Ga0105240_10001075
481 Ga0105240_10038556
482 Ga0105240_10098254
483 Ga0111539_10001256
484 Ga0111539_10737498
485 Ga0105245_10017164
486 Ga0105245_10384256
487 Ga0114129_10003717
488 Ga0114129_10103947
489 Ga0114129_10347087
490 Ga0114129_10395475
491 Ga0114129_10500860
492 Ga0114129_10503630
493 Ga0105241_10030987
494 Ga0105241_10158547
495 Ga0105241_10201663
496 Ga0105241_10234135
497 Ga0105241_10308663
498 Ga0105242_10080406
499 Ga0105242_10093356
500 Ga0105248_10205833
501 Ga0105248_10407565
502 Ga0105237_10050224
503 Ga0105237_10099811
504 Ga0105237_10281912
505 Ga0105237_10289169
506 Ga0105238_10026286
507 Ga0105238_10060714
508 Ga0105238_10097249
509 Ga0105249_10091836
510 Ga0105239_10113922
511 Ga0157370_10307672
512 Ga0157369_10001357
513 Ga0157369_10021828
514 Ga0157369_10055262
515 Ga0157374_10115998
516 Ga0157374_10181885
517 Ga0157378_10291667
518 Ga0163162_10007738
519 Ga0157372_10023620
520 Ga0157375_10013230
521 Ga0157375_10401509
522 Ga0157375_10867815
523 Ga0163163_10103370
524 Ga0157379_10315086
525 Ga0157376_10189094
526 Ga0157376_10393178
527 Ga0157376_10820901
528 Ga0213873_10070862
529 Ga0213872_10001075
530 Ga0213874_10015712
531 Ga0213876_10019432
532 Ga0213875_10000601
533 Ga0213875_10160580
534 Ga0213875_10180239
535 Ga0213871_10000884
536 Ga0207642_10053478
537 Ga0207685_10128409
538 Ga0207705_10064333
539 Ga0207684_10076914
540 Ga0207684_10201696
541 Ga0207654_10248467
542 Ga0207707_10079689
543 Ga0207707_10265437
544 Ga0207695_10010472
545 Ga0207695_10138444
546 Ga0207695_10145959
547 Ga0207671_10019789
548 Ga0207671_10422212
549 Ga0207693_10474130
550 Ga0207660_10116871
551 Ga0207660_10417702
552 Ga0207657_10007163
553 Ga0207646_10038154
554 Ga0207646_10046989
555 Ga0207694_10168274
556 Ga0207687_10017133
557 Ga0207644_10322384
558 Ga0207690_10145065
559 Ga0207686_10050947
560 Ga0207665_10231840
561 Ga0207711_10365549
562 Ga0207667_10049558
563 Ga0207667_10359818
564 Ga0207651_10197145
565 Ga0207712_10070607
566 Ga0207677_10037183
567 Ga0207703_10033585
568 Ga0207703_10483611
569 Ga0207639_10210882
570 Ga0207639_10464309
571 Ga0207708_10030172
572 Ga0207702_10025753
573 Ga0207641_10090407
574 Ga0207641_10143357
575 Ga0207683_10111228
576 Ga0209966_1031749
577 Ga0207428_10155724
578 Ga0268266_10022521
579 Ga0268266_10088649
580 Ga0268266_10139733
581 Ga0268265_10107469
582 Ga0265338_10307383
583 Ga0265332_10128135
584 Ga0265325_10091262
585 Ga0265316_10004747
586 Ga0307408_100004678
587 Ga0307408_100055114
588 Ga0307408_100075999
589 Ga0307405_10016163
590 Ga0307413_10002366
591 Ga0307413_10010895
592 Ga0307413_10047994
593 Ga0307410_10001899
594 Ga0307410_10005120
595 Ga0307410_10020102
596 Ga0307410_10023961
597 Ga0307406_10026270
598 Ga0307406_10089850
599 Ga0307407_10004196
600 Ga0307407_10004924
601 Ga0307407_10029035
602 Ga0307409_100001044
603 Ga0307409_100006252
604 Ga0307409_100057970
605 Ga0307409_100109552
606 Ga0307416_100000472
607 Ga0307416_100000888
608 Ga0307416_100010534
609 Ga0307416_100023939
610 Ga0307416_100351452
611 Ga0307414_10003598
612 Ga0307414_10017343
613 Ga0307414_10023552
614 Ga0307414_10371154
615 Ga0307411_10059927
616 Ga0307411_10134332
617 Ga0307411_10283639
618 Ga0307415_100005196
619 Ga0307415_100031101
620 Ga0307415_100034815
621 Ga0373926_0025881
622 Ga0373926_0071745
623 Ga0373934_0134083
624 Ga0373940_0010539
625 Ga0373956_0027418
626 Ga0373943_0212726
627 Ga0373955_0146951
628 Ga0373927_0000313
629 Ga0373927_0003663
630 Ga0373947_0008008
631 Ga0373937_0028753
632 Ga0395900_0059687
633 Ga0395900_0129511
634 Ga0395898_0600475
635 Ga0395905_0077704
636 Ga0395905_0263848
637 Ga0436364_0278774
638 Ga0436364_0493530
639 Ga0436364_0635341
640 Ga0436364_0693045
641 Ga0436364_1397644
642 Ga0395901_0073580
643 Ga0436365_0165446
644 Ga0436360_1372434
645 Ga0436361_1113744
646 Ga0436363_0570522
647 Ga0436363_1072502
648 Ga0436362_0894037
649 Ga0453683_0140056
650 Ga0453683_0167618
651 Ga0453683_0359089
652 Ga0466963_0208405
653 Ga0451576_0515767
654 Ga0451576_0863753
655 Ga0495592_0100634
656 Ga0495638_0067205
657 Ga0495651_0047669
658 Ga0495653_0025861
659 Ga0495580_0018340
660 Ga0495580_0051041
661 Ga0495582_0095452
662 Ga0495662_0024423
663 Ga0495664_0042204
664 Ga0495608_0066979
665 Ga0495628_0044279
666 Ga0495630_0043503
667 Ga0495665_0024174
668 Ga0495640_0105343
669 Ga0495587_0066397
670 Ga0495645_0009568
671 Ga0495645_0012174
672 Ga0495645_0329910
673 Ga0495667_0069649
674 Ga0495667_0077647
675 Ga0495634_0053789
676 Ga0495635_0053656
677 Ga0495599_0070508
678 Ga0495599_0174955
679 Ga0495623_0105947
680 Ga0495646_0042026
681 Ga0495613_0063864
682 Ga0495604_0105347
683 Ga0495604_0215145
684 Ga0495674_0071462
685 Ga0495674_0116028
686 Ga0495680_0068097
687 Ga0495675_0049917
688 Ga0495684_0009180
689 Ga0495684_0069602
690 Ga0495602_0096654
691 Ga0496102_0080644
692 Ga0496106_0077879
693 Ga0496109_0000050
694 Ga0501296_008624
695 Ga0501297_007303
696 Ga0501031_0038084
697 Ga0501032_0231716
698 Ga0501036_0014386
699 Ga0501039_0039665
700 Ga0501041_0315264
701 Ga0501042_0017521
702 Ga0501046_0415609
703 Ga0501048_0141652
704 Ga0501072_0154972
705 Ga0501075_0007339
706 Ga0501075_0137466
707 Ga0501076_0006621
708 Ga0501209_000704
709 Ga0501216_002112
710 Ga0501217_009856
711 Ga0501243_000466
712 Ga0501247_000188
713 Ga0501245_003290
714 Ga0501081_0136232
715 Ga0501262_001672
716 Ga0501263_001068
717 Ga0501266_001218
718 Ga0501268_000315
719 Ga0501270_000318
720 Ga0501272_000268
721 Ga0501273_002854
722 Ga0501283_004104
723 Ga0501035_0540011
724 Ga0501045_0112447
725 nmdc:mga03683_64403_c1
726 nmdc:mga0k408_245973_c1
727 nmdc:mga06z11_73595_c1
728 nmdc:mga05p37_12126_c1
729 nmdc:mga05p37_14048_c1
730 nmdc:mga05p37_239897_c1
731 nmdc:mga05p37_2548_c1
732 nmdc:mga05p37_408580_c1
733 nmdc:mga05p37_505190_c1
734 nmdc:mga06r32_178000_c1
735 nmdc:mga06r32_51491_c1
736 nmdc:mga06r32_63893_c1
737 nmdc:mga08y16_193223_c1
738 nmdc:mga08y16_2063_c1
739 nmdc:mga08y16_2364_c1
740 nmdc:mga0n895_124369_c1
741 nmdc:mga0n895_30250_c1
742 nmdc:mga08x19_176801_c1
743 nmdc:mga08x19_574_c1
744 nmdc:mga0a205_110894_c1
745 nmdc:mga0a205_130100_c1
746 nmdc:mga0a205_57362_c1
747 nmdc:mga0a205_86759_c1
748 Ga0495601_0228818
749 Ga0500592_005716
750 Ga0501084_0254490
751 Ga0590071_013447
752 Ga0590077_011911
753 Ga0501082_0000309
754 Ga0501082_0164056
755 Ga0501082_0213166
756 Ga0501082_0750866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12710

HAD

haloacid dehalogenase-like hydrolase

46

221

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1y-assembly2.cif.gz_D crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori 0.8016 1 215
4eze-assembly1.cif.gz_A crystal structure of had family hydrolase t0658 from salmonella enterica subsp. enterica serovar typhi (target efi-501419) 0.7958 5 223
3m1y-assembly2.cif.gz_C crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori 0.7949 1 221
1l7o-assembly3.cif.gz_A crystal structure of phosphoserine phosphatase in apo form 0.7939 2 216
3m1y-assembly1.cif.gz_B crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori 0.7924 4 219
ID Description Score Start End Superfamily
af_Q58989_1_211_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.795 2 216 3.40.50.1000
3n28A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7825 97 216 3.40.50.1000
4ezeB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7799 5 223 3.40.50.1000
af_P42941_7_299_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7711 3 216 3.40.50.1000
af_Q58989_1_211_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7681 2 216 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A317I6M0-F1-model_v4 deleted 0.9553 2 245
AF-A0A2V9VK83-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9423 2 211 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A2V9R885-F1-model_v4 Haloacid dehalogenase 0.9343 1 159
AF-A0A2V8HHX1-F1-model_v4 Haloacid dehalogenase 0.9314 2 124
AF-A0A317I6M0-F1-model_v4 deleted 0.9222 2 245

Map