F428049

General Info

Members Datasets Scaffolds Average Seq Length
378 210 756 168

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_11126760|Ga0207708_111267601
Length 174
Sequence MPRSTGATLESRERAPSSRRSGRGRAAVDIRTLSYTDLPHVIAIERRSFPAPWSLAMFVLELSKPASVCIGAFEEGRLVGYLICSRYHTVWHLMNVAVDPDHRRAGVASSLIDYLFRVTGERERYTLEVRVSNAEAIRMYESYGFHSAGIRRRYYHDNNEDALIMWRTDGRGID

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
148 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
206 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
207 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.46
Rhizosphere 81.48
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_11126760 3300026075 Unclassified 685
2 Ga0070676_10564048 3300005328 Bacteria 817
3 Ga0070690_100079999 3300005330 Bacteria 2137
4 Ga0070670_100678104 3300005331 Bacteria 926
5 Ga0068869_100507121 3300005334 Bacteria 1008
6 Ga0070666_10424407 3300005335 Bacteria 958
7 Ga0070682_100527847 3300005337 Bacteria 919
8 Ga0070682_101339475 3300005337 Bacteria 610
9 Ga0068868_100056763 3300005338 Bacteria 3092
10 Ga0068868_100068266 3300005338 Bacteria 2831
11 Ga0068868_100083080 3300005338 Bacteria 2570
12 Ga0068868_100390877 3300005338 Bacteria 1198
13 Ga0070660_100063713 3300005339 Bacteria 2866
14 Ga0070660_100210929 3300005339 Bacteria 1577
15 Ga0070689_100068002 3300005340 Bacteria 2778
16 Ga0070687_100025940 3300005343 Bacteria 2817
17 Ga0070661_100189363 3300005344 Bacteria 1569
18 Ga0070692_10182340 3300005345 Bacteria 1218
19 Ga0070674_100039492 3300005356 Bacteria 3187
20 Ga0070688_100164225 3300005365 Bacteria 1528
21 Ga0070659_100015660 3300005366 Bacteria 5680
22 Ga0070659_101299838 3300005366 Bacteria 645
23 Ga0070667_100951090 3300005367 Bacteria 801
24 Ga0070713_100466572 3300005436 Bacteria 1188
25 Ga0070710_10018955 3300005437 Bacteria 3549
26 Ga0070701_10098682 3300005438 Bacteria 1613
27 Ga0070701_10169289 3300005438 Bacteria 1271
28 Ga0070705_100070732 3300005440 Bacteria 2108
29 Ga0070700_100545354 3300005441 Bacteria 900
30 Ga0070700_100637785 3300005441 Bacteria 840
31 Ga0070700_100905631 3300005441 Bacteria 718
32 Ga0070663_100360910 3300005455 Bacteria 1179
33 Ga0068867_100536077 3300005459 Bacteria 1012
34 Ga0070685_10292010 3300005466 Bacteria 1095
35 Ga0070707_100390768 3300005468 Bacteria 1351
36 Ga0070679_101293957 3300005530 Bacteria 675
37 Ga0068853_100245813 3300005539 Bacteria 1641
38 Ga0070686_100088458 3300005544 Bacteria 2067
39 Ga0070686_100676971 3300005544 Bacteria 820
40 Ga0070696_100921256 3300005546 Bacteria 726
41 Ga0070696_100955514 3300005546 Bacteria 714
42 Ga0070665_100432744 3300005548 Bacteria 1325
43 Ga0070664_100328667 3300005564 Bacteria 1387
44 Ga0070664_100806626 3300005564 Bacteria 878
45 Ga0068854_100302370 3300005578 Bacteria 1295
46 Ga0068854_100471266 3300005578 Bacteria 1053
47 Ga0068854_100566105 3300005578 Bacteria 966
48 Ga0068854_100956522 3300005578 Bacteria 756
49 Ga0068856_100038262 3300005614 Bacteria 4709
50 Ga0068856_100371782 3300005614 Bacteria 1448
51 Ga0068856_100548807 3300005614 Bacteria 1177
52 Ga0068856_101396753 3300005614 Bacteria 715
53 Ga0070702_100022386 3300005615 Bacteria 3339
54 Ga0070702_100098123 3300005615 Bacteria 1792
55 Ga0070702_100207434 3300005615 Bacteria 1302
56 Ga0070702_100896152 3300005615 Bacteria 694
57 Ga0068852_100075853 3300005616 Bacteria 2967
58 Ga0068859_100136648 3300005617 Bacteria 2524
59 Ga0068859_100598416 3300005617 Bacteria 1196
60 Ga0068859_101664944 3300005617 Bacteria 705
61 Ga0068864_100331853 3300005618 Bacteria 1431
62 Ga0068864_100617840 3300005618 Bacteria 1053
63 Ga0068866_10139105 3300005718 Bacteria 1391
64 Ga0068866_10190329 3300005718 Bacteria 1219
65 Ga0068861_100022979 3300005719 Bacteria 4496
66 Ga0068861_100192240 3300005719 Bacteria 1707
67 Ga0068861_100659347 3300005719 Bacteria 968
68 Ga0068870_10360841 3300005840 Bacteria 935
69 Ga0068858_100059442 3300005842 Bacteria 3533
70 Ga0068858_100179756 3300005842 Bacteria 1997
71 Ga0068860_100103127 3300005843 Bacteria 2723
72 Ga0068862_100394997 3300005844 Bacteria 1293
73 Ga0068862_100693225 3300005844 Bacteria 986
74 Ga0068862_100723886 3300005844 Bacteria 966
75 Ga0081455_10448684 3300005937 Bacteria 882
76 Ga0081538_10009932 3300005981 Bacteria 7865
77 Ga0081540_1007609 3300005983 Bacteria 7692
78 Ga0081540_1158049 3300005983 Bacteria 884
79 Ga0081539_10012224 3300005985 Bacteria 6660
80 Ga0081539_10014196 3300005985 Bacteria 5914
81 Ga0075432_10141653 3300006058 Bacteria 918
82 Ga0070712_100065988 3300006175 Bacteria 2571
83 Ga0075428_101303808 3300006844 Bacteria 764
84 Ga0075431_100301089 3300006847 Bacteria 1620
85 Ga0068865_100144684 3300006881 Bacteria 1796
86 Ga0097620_100136650 3300006931 Bacteria 2524
87 Ga0097620_100598414 3300006931 Bacteria 1196
88 Ga0097620_101664752 3300006931 Bacteria 705
89 Ga0111539_10200967 3300009094 Bacteria 2324
90 Ga0105245_10106794 3300009098 Bacteria 2598
91 Ga0105245_10246304 3300009098 Bacteria 1735
92 Ga0105245_11602369 3300009098 Bacteria 703
93 Ga0105247_10246471 3300009101 Bacteria 1219
94 Ga0105247_10289762 3300009101 Bacteria 1132
95 Ga0114129_11381184 3300009147 Bacteria 870
96 Ga0105243_10042732 3300009148 Bacteria 3549
97 Ga0105243_10267508 3300009148 Bacteria 1533
98 Ga0105243_11327847 3300009148 Bacteria 737
99 Ga0105241_10271874 3300009174 Bacteria 1444
100 Ga0105242_10750388 3300009176 Bacteria 961
101 Ga0105242_10959162 3300009176 Bacteria 860
102 Ga0105237_11771492 3300009545 Bacteria 625
103 Ga0105238_10565663 3300009551 Bacteria 1142
104 Ga0105249_10060881 3300009553 Bacteria 3464
105 Ga0105249_10098524 3300009553 Bacteria 2746
106 Ga0105249_10520384 3300009553 Bacteria 1237
107 Ga0105249_10706930 3300009553 Bacteria 1068
108 Ga0105239_11667397 3300010375 Bacteria 738
109 Ga0105246_10107000 3300011119 Bacteria 2047
110 Ga0105246_10491276 3300011119 Bacteria 1040
111 Ga0105246_11120473 3300011119 Bacteria 720
112 Ga0157371_10340439 3300013102 Bacteria 1091
113 Ga0157374_11725737 3300013296 Bacteria 651
114 Ga0163162_10171776 3300013306 Bacteria 2292
115 Ga0163162_10860256 3300013306 Bacteria 1021
116 Ga0157372_10431441 3300013307 Bacteria 1536
117 Ga0157372_10510846 3300013307 Bacteria 1401
118 Ga0157372_10976537 3300013307 Bacteria 981
119 Ga0157375_10106214 3300013308 Bacteria 2899
120 Ga0157375_12252512 3300013308 Bacteria 649
121 Ga0163163_10349417 3300014325 Bacteria 1535
122 Ga0163163_10754733 3300014325 Bacteria 1036
123 Ga0163163_11399337 3300014325 Bacteria 761
124 Ga0157380_10079045 3300014326 Bacteria 2685
125 Ga0157380_10255103 3300014326 Bacteria 1590
126 Ga0157380_11392525 3300014326 Bacteria 751
127 Ga0157377_10110115 3300014745 Bacteria 1654
128 Ga0157377_10218968 3300014745 Bacteria 1218
129 Ga0157379_10063591 3300014968 Bacteria 3299
130 Ga0157376_10831723 3300014969 Bacteria 938
131 Ga0163161_10127248 3300017792 Bacteria 1919
132 Ga0206356_10263872 3300020070 Bacteria 2508
133 Ga0213873_10004104 3300021358 Bacteria 2689
134 Ga0207656_10092967 3300025321 Bacteria 1372
135 Ga0207692_10040018 3300025898 Bacteria 2311
136 Ga0207642_10004400 3300025899 Bacteria 4541
137 Ga0207710_10162294 3300025900 Bacteria 1089
138 Ga0207688_10123434 3300025901 Bacteria 1513
139 Ga0207688_10479096 3300025901 Bacteria 778
140 Ga0207643_10036130 3300025908 Bacteria 2770
141 Ga0207643_10579001 3300025908 Bacteria 722
142 Ga0207684_10980135 3300025910 Bacteria 708
143 Ga0207693_10079134 3300025915 Bacteria 2572
144 Ga0207662_10034283 3300025918 Bacteria 2962
145 Ga0207657_10084898 3300025919 Bacteria 2653
146 Ga0207646_10353598 3300025922 Bacteria 1328
147 Ga0207646_11600514 3300025922 Bacteria 562
148 Ga0207681_10116798 3300025923 Bacteria 1950
149 Ga0207681_10774803 3300025923 Bacteria 800
150 Ga0207659_10634102 3300025926 Bacteria 912
151 Ga0207687_10014161 3300025927 Bacteria 5217
152 Ga0207687_10075309 3300025927 Bacteria 2422
153 Ga0207687_10180598 3300025927 Bacteria 1635
154 Ga0207644_10225227 3300025931 Bacteria 1488
155 Ga0207690_10574188 3300025932 Bacteria 918
156 Ga0207706_10044773 3300025933 Bacteria 3921
157 Ga0207706_10125373 3300025933 Bacteria 2259
158 Ga0207706_10314523 3300025933 Bacteria 1363
159 Ga0207709_10012910 3300025935 Bacteria 4606
160 Ga0207709_10051829 3300025935 Bacteria 2517
161 Ga0207709_10129660 3300025935 Bacteria 1717
162 Ga0207669_10107866 3300025937 Bacteria 1858
163 Ga0207669_10547923 3300025937 Bacteria 933
164 Ga0207704_10045448 3300025938 Bacteria 2609
165 Ga0207691_10738956 3300025940 Bacteria 829
166 Ga0207689_10422853 3300025942 Bacteria 1112
167 Ga0207689_11002991 3300025942 Bacteria 704
168 Ga0207661_10276125 3300025944 Bacteria 1501
169 Ga0207661_11174914 3300025944 Bacteria 706
170 Ga0207679_10372522 3300025945 Bacteria 1250
171 Ga0207679_10565338 3300025945 Bacteria 1022
172 Ga0207679_10903139 3300025945 Bacteria 808
173 Ga0207679_11592569 3300025945 Bacteria 599
174 Ga0207667_10150233 3300025949 Bacteria 2398
175 Ga0207651_10916285 3300025960 Bacteria 781
176 Ga0207712_10072565 3300025961 Bacteria 2479
177 Ga0207712_10266033 3300025961 Bacteria 1393
178 Ga0207712_10556443 3300025961 Bacteria 987
179 Ga0207668_10588902 3300025972 Bacteria 968
180 Ga0207668_11134519 3300025972 Bacteria 701
181 Ga0207640_10411358 3300025981 Bacteria 1104
182 Ga0207640_10480351 3300025981 Bacteria 1031
183 Ga0207658_10414353 3300025986 Bacteria 1187
184 Ga0207677_10049749 3300026023 Bacteria 2830
185 Ga0207677_10050984 3300026023 Bacteria 2803
186 Ga0207677_10144962 3300026023 Bacteria 1824
187 Ga0207677_10175293 3300026023 Bacteria 1681
188 Ga0207703_10115472 3300026035 Bacteria 2297
189 Ga0207639_10244708 3300026041 Bacteria 1561
190 Ga0207639_11054504 3300026041 Bacteria 762
191 Ga0207678_10063343 3300026067 Bacteria 3177
192 Ga0207678_10210228 3300026067 Bacteria 1664
193 Ga0207678_10321285 3300026067 Bacteria 1332
194 Ga0207708_10073307 3300026075 Bacteria 2624
195 Ga0207708_10188799 3300026075 Bacteria 1639
196 Ga0207702_10866103 3300026078 Bacteria 894
197 Ga0207641_11086896 3300026088 Bacteria 798
198 Ga0207648_10030726 3300026089 Bacteria 4754
199 Ga0207676_10530459 3300026095 Bacteria 1122
200 Ga0207674_10090070 3300026116 Bacteria 3059
201 Ga0207675_100003103 3300026118 Bacteria 16289
202 Ga0207675_100054968 3300026118 Bacteria 3714
203 Ga0207675_100250966 3300026118 Bacteria 1712
204 Ga0207683_10048053 3300026121 Bacteria 3737
205 Ga0207698_10105858 3300026142 Bacteria 2345
206 Ga0207428_10117535 3300027907 Bacteria 2041
207 Ga0268266_10016075 3300028379 Bacteria 6396
208 Ga0268266_10299557 3300028379 Bacteria 1500
209 Ga0268265_10141898 3300028380 Bacteria 2012
210 Ga0268264_10039346 3300028381 Bacteria 3907
211 Ga0265337_1003442 3300028556 Bacteria 6856
212 Ga0265326_10000703 3300028558 Bacteria 12367
213 Ga0265319_1000722 3300028563 Bacteria 21656
214 Ga0265318_10002794 3300028577 Bacteria 9136
215 Ga0265336_10000004 3300028666 Bacteria 418303
216 Ga0265338_10000012 3300028800 Bacteria 418599
217 Ga0265324_10007010 3300029957 Bacteria 4631
218 Ga0265340_10000001 3300031247 Bacteria 1647668
219 Ga0265316_10015022 3300031344 Bacteria 6788
220 Ga0307408_100200969 3300031548 Bacteria 1613
221 Ga0307408_100228635 3300031548 Bacteria 1522
222 Ga0307408_100590118 3300031548 Bacteria 986
223 Ga0265342_10188092 3300031712 Bacteria 1128
224 Ga0307405_10057261 3300031731 Bacteria 2448
225 Ga0307413_10074252 3300031824 Bacteria 2153
226 Ga0307413_10584811 3300031824 Bacteria 911
227 Ga0307410_10204041 3300031852 Bacteria 1511
228 Ga0307410_10801728 3300031852 Bacteria 801
229 Ga0307406_10009954 3300031901 Bacteria 5350
230 Ga0307406_10260503 3300031901 Bacteria 1312
231 Ga0307407_10019771 3300031903 Bacteria 3436
232 Ga0307407_10365485 3300031903 Bacteria 1026
233 Ga0307407_10420323 3300031903 Bacteria 963
234 Ga0307407_10517304 3300031903 Bacteria 877
235 Ga0307412_10134766 3300031911 Bacteria 1800
236 Ga0307409_100071344 3300031995 Bacteria 2761
237 Ga0307409_100473513 3300031995 Bacteria 1213
238 Ga0307409_100575252 3300031995 Bacteria 1110
239 Ga0307409_100916535 3300031995 Bacteria 891
240 Ga0307409_100934648 3300031995 Bacteria 882
241 Ga0307416_100217159 3300032002 Bacteria 1830
242 Ga0307416_100368876 3300032002 Bacteria 1461
243 Ga0307416_100831101 3300032002 Bacteria 1021
244 Ga0307416_102053801 3300032002 Bacteria 674
245 Ga0307411_10268652 3300032005 Bacteria 1351
246 Ga0307415_100250373 3300032126 Bacteria 1439
247 Ga0307415_100488786 3300032126 Bacteria 1073
248 Ga0307415_100972991 3300032126 Bacteria 787
249 Ga0373958_0030733 3300034819 Bacteria 1052
250 Ga0373959_0034631 3300034820 Bacteria 1035
251 Ga0373949_0181529 3300035090 Bacteria 624
252 Ga0373951_0115652 3300035091 Bacteria 726
253 Ga0373952_0067551 3300035092 Bacteria 888
254 Ga0373939_0213399 3300035114 Bacteria 736
255 Ga0373945_0275542 3300035116 Bacteria 716
256 Ga0373947_0537381 3300035725 Bacteria 795
257 Ga0395899_0012935 3300037312 Bacteria 6388
258 Ga0395899_0167915 3300037312 Bacteria 1547
259 Ga0395900_0343314 3300037418 Bacteria 1468
260 Ga0395900_0780346 3300037418 Bacteria 884
261 Ga0395898_0004317 3300037466 Bacteria 15579
262 Ga0395898_0087219 3300037466 Bacteria 3007
263 Ga0395905_0657270 3300037471 Bacteria 950
264 Ga0395905_1045994 3300037471 Bacteria 719
265 Ga0395901_0195427 3300038443 Bacteria 2121
266 Ga0395901_1082379 3300038443 Bacteria 773
267 Ga0395901_1108353 3300038443 Bacteria 762
268 Ga0436365_1393636 3300039437 Bacteria 571
269 Ga0436362_0845051 3300039453 Bacteria 3366
270 Ga0451833_0535038 3300041491 Bacteria 824
271 Ga0439448_0132560 3300042005 Bacteria 860
272 Ga0466972_0125428 3300044658 Bacteria 1210
273 Ga0466972_0480693 3300044658 Bacteria 584
274 Ga0466966_0294274 3300044684 Bacteria 976
275 Ga0466963_0112242 3300044694 Bacteria 1872
276 Ga0466963_0265865 3300044694 Bacteria 1205
277 Ga0466963_0799995 3300044694 Bacteria 665
278 Ga0466970_0721188 3300044765 Bacteria 582
279 Ga0466960_0044587 3300044901 Bacteria 2115
280 Ga0466960_0087382 3300044901 Bacteria 1583
281 Ga0466960_0194665 3300044901 Bacteria 1105
282 Ga0466967_0176048 3300045976 Bacteria 2015
283 Ga0466967_0287819 3300045976 Bacteria 1578
284 Ga0466967_0481023 3300045976 Bacteria 1217
285 Ga0466967_0588528 3300045976 Bacteria 1097
286 Ga0466967_0638470 3300045976 Bacteria 1052
287 Ga0466967_0793674 3300045976 Bacteria 940
288 Ga0495605_0204177 3300046474 Bacteria 860
289 Ga0495664_0000011 3300046477 Bacteria 253351
290 Ga0495596_0136273 3300046500 Bacteria 953
291 Ga0495620_0234369 3300046515 Bacteria 701
292 Ga0495631_0284310 3300046518 Bacteria 704
293 Ga0495644_0163182 3300046523 Bacteria 855
294 Ga0495663_0210917 3300046525 Bacteria 680
295 Ga0495652_0248764 3300046529 Bacteria 1318
296 Ga0495665_0226157 3300046531 Bacteria 967
297 Ga0495647_0090644 3300046681 Bacteria 1253
298 Ga0495670_0206742 3300046691 Bacteria 1041
299 Ga0495672_0132973 3300047320 Bacteria 1306
300 Ga0495676_0042169 3300047321 Bacteria 3749
301 Ga0495683_0147939 3300047323 Bacteria 1096
302 Ga0495677_0117753 3300047445 Bacteria 1012
303 Ga0495679_128478 3300047446 Bacteria 689
304 Ga0496100_0046502 3300048903 Bacteria 2791
305 Ga0496101_0076438 3300048904 Bacteria 2467
306 Ga0496101_0241636 3300048904 Bacteria 1405
307 Ga0496101_0495894 3300048904 Bacteria 965
308 Ga0496101_0564626 3300048904 Bacteria 900
309 Ga0496101_0931747 3300048904 Bacteria 684
310 Ga0496102_0000148 3300048905 Bacteria 95925
311 Ga0496102_0003770 3300048905 Bacteria 12817
312 Ga0496102_0057372 3300048905 Bacteria 3555
313 Ga0496102_0070969 3300048905 Bacteria 3199
314 Ga0496102_0189225 3300048905 Bacteria 1939
315 Ga0496102_1017879 3300048905 Bacteria 749
316 Ga0496103_0000950 3300048906 Bacteria 20702
317 Ga0496103_0022635 3300048906 Bacteria 3784
318 Ga0496104_0000093 3300048907 Bacteria 87156
319 Ga0496104_0022968 3300048907 Bacteria 5732
320 Ga0496104_0081696 3300048907 Bacteria 3082
321 Ga0496104_0522211 3300048907 Bacteria 1098
322 Ga0496105_0067616 3300048908 Bacteria 2950
323 Ga0496105_0253754 3300048908 Bacteria 1424
324 Ga0496105_0337340 3300048908 Bacteria 1206
325 Ga0496105_0377742 3300048908 Bacteria 1128
326 Ga0496106_0003250 3300048909 Bacteria 12159
327 Ga0496106_0019551 3300048909 Bacteria 5025
328 Ga0496106_0126670 3300048909 Bacteria 2000
329 Ga0496106_0161089 3300048909 Bacteria 1774
330 Ga0496106_0886645 3300048909 Bacteria 705
331 Ga0496107_0012688 3300048910 Bacteria 5885
332 Ga0496107_0019673 3300048910 Bacteria 4763
333 Ga0496107_0040478 3300048910 Bacteria 3345
334 Ga0496107_0121370 3300048910 Bacteria 1926
335 Ga0496108_0000926 3300048911 Bacteria 22877
336 Ga0496108_0039959 3300048911 Bacteria 3909
337 Ga0496108_0188451 3300048911 Bacteria 1787
338 Ga0496108_0251150 3300048911 Bacteria 1539
339 Ga0496109_0001485 3300048912 Bacteria 19475
340 Ga0496109_0084014 3300048912 Bacteria 2936
341 Ga0496109_0112213 3300048912 Bacteria 2535
342 Ga0496109_0114306 3300048912 Bacteria 2511
343 Ga0496109_0381478 3300048912 Bacteria 1331
344 Ga0496109_0444136 3300048912 Bacteria 1225
345 Ga0496109_0711791 3300048912 Bacteria 942
346 Ga0496109_0914338 3300048912 Bacteria 815
347 Ga0496110_0003706 3300048913 Bacteria 11765
348 Ga0496110_0012600 3300048913 Bacteria 6955
349 Ga0496110_0020880 3300048913 Bacteria 5533
350 Ga0496110_0217021 3300048913 Bacteria 1739
351 Ga0496110_0449283 3300048913 Bacteria 1175
352 Ga0496110_0721046 3300048913 Bacteria 899
353 Ga0496111_0000057 3300048914 Bacteria 45020
354 Ga0496111_0007804 3300048914 Bacteria 7046
355 Ga0496111_0105237 3300048914 Bacteria 2076
356 Ga0496111_0170268 3300048914 Bacteria 1618
357 Ga0496111_0569643 3300048914 Bacteria 830
358 Ga0496112_0033929 3300048915 Bacteria 4965
359 Ga0496112_0092646 3300048915 Bacteria 2991
360 Ga0496112_0671228 3300048915 Archaea 965
361 Ga0496113_0046199 3300048916 Bacteria 3232
362 Ga0496113_0131809 3300048916 Bacteria 1962
363 Ga0496113_0311333 3300048916 Bacteria 1261
364 Ga0496113_0314194 3300048916 Bacteria 1255
365 Ga0496114_0059088 3300048917 Bacteria 3203
366 Ga0496114_0059338 3300048917 Bacteria 3196
367 Ga0496114_0768336 3300048917 Bacteria 841
368 Ga0496114_0861285 3300048917 Bacteria 786
369 Ga0496115_0276550 3300048918 Bacteria 1379
370 Ga0496119_0351393 3300048922 Bacteria 714
371 Ga0496121_0159897 3300048924 Bacteria 1648
372 Ga0501067_0252670 3300049583 Bacteria 981
373 Ga0501209_076855 3300049656 Bacteria 958
374 Ga0501216_066966 3300049660 Bacteria 735
375 Ga0501249_094934 3300049679 Bacteria 710
376 nmdc:mga06r32_447515_c1 3300050510 Bacteria 1271
377 nmdc:mga08y16_44728_c1 3300050511 Bacteria 4640
378 Ga0495619_0362427 3300053085 Bacteria 1002
379 Ga0207708_11126760
380 Ga0070676_10564048
381 Ga0070690_100079999
382 Ga0070670_100678104
383 Ga0068869_100507121
384 Ga0070666_10424407
385 Ga0070682_100527847
386 Ga0070682_101339475
387 Ga0068868_100056763
388 Ga0068868_100068266
389 Ga0068868_100083080
390 Ga0068868_100390877
391 Ga0070660_100063713
392 Ga0070660_100210929
393 Ga0070689_100068002
394 Ga0070687_100025940
395 Ga0070661_100189363
396 Ga0070692_10182340
397 Ga0070674_100039492
398 Ga0070688_100164225
399 Ga0070659_100015660
400 Ga0070659_101299838
401 Ga0070667_100951090
402 Ga0070713_100466572
403 Ga0070710_10018955
404 Ga0070701_10098682
405 Ga0070701_10169289
406 Ga0070705_100070732
407 Ga0070700_100545354
408 Ga0070700_100637785
409 Ga0070700_100905631
410 Ga0070663_100360910
411 Ga0068867_100536077
412 Ga0070685_10292010
413 Ga0070707_100390768
414 Ga0070679_101293957
415 Ga0068853_100245813
416 Ga0070686_100088458
417 Ga0070686_100676971
418 Ga0070696_100921256
419 Ga0070696_100955514
420 Ga0070665_100432744
421 Ga0070664_100328667
422 Ga0070664_100806626
423 Ga0068854_100302370
424 Ga0068854_100471266
425 Ga0068854_100566105
426 Ga0068854_100956522
427 Ga0068856_100038262
428 Ga0068856_100371782
429 Ga0068856_100548807
430 Ga0068856_101396753
431 Ga0070702_100022386
432 Ga0070702_100098123
433 Ga0070702_100207434
434 Ga0070702_100896152
435 Ga0068852_100075853
436 Ga0068859_100136648
437 Ga0068859_100598416
438 Ga0068859_101664944
439 Ga0068864_100331853
440 Ga0068864_100617840
441 Ga0068866_10139105
442 Ga0068866_10190329
443 Ga0068861_100022979
444 Ga0068861_100192240
445 Ga0068861_100659347
446 Ga0068870_10360841
447 Ga0068858_100059442
448 Ga0068858_100179756
449 Ga0068860_100103127
450 Ga0068862_100394997
451 Ga0068862_100693225
452 Ga0068862_100723886
453 Ga0081455_10448684
454 Ga0081538_10009932
455 Ga0081540_1007609
456 Ga0081540_1158049
457 Ga0081539_10012224
458 Ga0081539_10014196
459 Ga0075432_10141653
460 Ga0070712_100065988
461 Ga0075428_101303808
462 Ga0075431_100301089
463 Ga0068865_100144684
464 Ga0097620_100136650
465 Ga0097620_100598414
466 Ga0097620_101664752
467 Ga0111539_10200967
468 Ga0105245_10106794
469 Ga0105245_10246304
470 Ga0105245_11602369
471 Ga0105247_10246471
472 Ga0105247_10289762
473 Ga0114129_11381184
474 Ga0105243_10042732
475 Ga0105243_10267508
476 Ga0105243_11327847
477 Ga0105241_10271874
478 Ga0105242_10750388
479 Ga0105242_10959162
480 Ga0105237_11771492
481 Ga0105238_10565663
482 Ga0105249_10060881
483 Ga0105249_10098524
484 Ga0105249_10520384
485 Ga0105249_10706930
486 Ga0105239_11667397
487 Ga0105246_10107000
488 Ga0105246_10491276
489 Ga0105246_11120473
490 Ga0157371_10340439
491 Ga0157374_11725737
492 Ga0163162_10171776
493 Ga0163162_10860256
494 Ga0157372_10431441
495 Ga0157372_10510846
496 Ga0157372_10976537
497 Ga0157375_10106214
498 Ga0157375_12252512
499 Ga0163163_10349417
500 Ga0163163_10754733
501 Ga0163163_11399337
502 Ga0157380_10079045
503 Ga0157380_10255103
504 Ga0157380_11392525
505 Ga0157377_10110115
506 Ga0157377_10218968
507 Ga0157379_10063591
508 Ga0157376_10831723
509 Ga0163161_10127248
510 Ga0206356_10263872
511 Ga0213873_10004104
512 Ga0207656_10092967
513 Ga0207692_10040018
514 Ga0207642_10004400
515 Ga0207710_10162294
516 Ga0207688_10123434
517 Ga0207688_10479096
518 Ga0207643_10036130
519 Ga0207643_10579001
520 Ga0207684_10980135
521 Ga0207693_10079134
522 Ga0207662_10034283
523 Ga0207657_10084898
524 Ga0207646_10353598
525 Ga0207646_11600514
526 Ga0207681_10116798
527 Ga0207681_10774803
528 Ga0207659_10634102
529 Ga0207687_10014161
530 Ga0207687_10075309
531 Ga0207687_10180598
532 Ga0207644_10225227
533 Ga0207690_10574188
534 Ga0207706_10044773
535 Ga0207706_10125373
536 Ga0207706_10314523
537 Ga0207709_10012910
538 Ga0207709_10051829
539 Ga0207709_10129660
540 Ga0207669_10107866
541 Ga0207669_10547923
542 Ga0207704_10045448
543 Ga0207691_10738956
544 Ga0207689_10422853
545 Ga0207689_11002991
546 Ga0207661_10276125
547 Ga0207661_11174914
548 Ga0207679_10372522
549 Ga0207679_10565338
550 Ga0207679_10903139
551 Ga0207679_11592569
552 Ga0207667_10150233
553 Ga0207651_10916285
554 Ga0207712_10072565
555 Ga0207712_10266033
556 Ga0207712_10556443
557 Ga0207668_10588902
558 Ga0207668_11134519
559 Ga0207640_10411358
560 Ga0207640_10480351
561 Ga0207658_10414353
562 Ga0207677_10049749
563 Ga0207677_10050984
564 Ga0207677_10144962
565 Ga0207677_10175293
566 Ga0207703_10115472
567 Ga0207639_10244708
568 Ga0207639_11054504
569 Ga0207678_10063343
570 Ga0207678_10210228
571 Ga0207678_10321285
572 Ga0207708_10073307
573 Ga0207708_10188799
574 Ga0207702_10866103
575 Ga0207641_11086896
576 Ga0207648_10030726
577 Ga0207676_10530459
578 Ga0207674_10090070
579 Ga0207675_100003103
580 Ga0207675_100054968
581 Ga0207675_100250966
582 Ga0207683_10048053
583 Ga0207698_10105858
584 Ga0207428_10117535
585 Ga0268266_10016075
586 Ga0268266_10299557
587 Ga0268265_10141898
588 Ga0268264_10039346
589 Ga0265337_1003442
590 Ga0265326_10000703
591 Ga0265319_1000722
592 Ga0265318_10002794
593 Ga0265336_10000004
594 Ga0265338_10000012
595 Ga0265324_10007010
596 Ga0265340_10000001
597 Ga0265316_10015022
598 Ga0307408_100200969
599 Ga0307408_100228635
600 Ga0307408_100590118
601 Ga0265342_10188092
602 Ga0307405_10057261
603 Ga0307413_10074252
604 Ga0307413_10584811
605 Ga0307410_10204041
606 Ga0307410_10801728
607 Ga0307406_10009954
608 Ga0307406_10260503
609 Ga0307407_10019771
610 Ga0307407_10365485
611 Ga0307407_10420323
612 Ga0307407_10517304
613 Ga0307412_10134766
614 Ga0307409_100071344
615 Ga0307409_100473513
616 Ga0307409_100575252
617 Ga0307409_100916535
618 Ga0307409_100934648
619 Ga0307416_100217159
620 Ga0307416_100368876
621 Ga0307416_100831101
622 Ga0307416_102053801
623 Ga0307411_10268652
624 Ga0307415_100250373
625 Ga0307415_100488786
626 Ga0307415_100972991
627 Ga0373958_0030733
628 Ga0373959_0034631
629 Ga0373949_0181529
630 Ga0373951_0115652
631 Ga0373952_0067551
632 Ga0373939_0213399
633 Ga0373945_0275542
634 Ga0373947_0537381
635 Ga0395899_0012935
636 Ga0395899_0167915
637 Ga0395900_0343314
638 Ga0395900_0780346
639 Ga0395898_0004317
640 Ga0395898_0087219
641 Ga0395905_0657270
642 Ga0395905_1045994
643 Ga0395901_0195427
644 Ga0395901_1082379
645 Ga0395901_1108353
646 Ga0436365_1393636
647 Ga0436362_0845051
648 Ga0451833_0535038
649 Ga0439448_0132560
650 Ga0466972_0125428
651 Ga0466972_0480693
652 Ga0466966_0294274
653 Ga0466963_0112242
654 Ga0466963_0265865
655 Ga0466963_0799995
656 Ga0466970_0721188
657 Ga0466960_0044587
658 Ga0466960_0087382
659 Ga0466960_0194665
660 Ga0466967_0176048
661 Ga0466967_0287819
662 Ga0466967_0481023
663 Ga0466967_0588528
664 Ga0466967_0638470
665 Ga0466967_0793674
666 Ga0495605_0204177
667 Ga0495664_0000011
668 Ga0495596_0136273
669 Ga0495620_0234369
670 Ga0495631_0284310
671 Ga0495644_0163182
672 Ga0495663_0210917
673 Ga0495652_0248764
674 Ga0495665_0226157
675 Ga0495647_0090644
676 Ga0495670_0206742
677 Ga0495672_0132973
678 Ga0495676_0042169
679 Ga0495683_0147939
680 Ga0495677_0117753
681 Ga0495679_128478
682 Ga0496100_0046502
683 Ga0496101_0076438
684 Ga0496101_0241636
685 Ga0496101_0495894
686 Ga0496101_0564626
687 Ga0496101_0931747
688 Ga0496102_0000148
689 Ga0496102_0003770
690 Ga0496102_0057372
691 Ga0496102_0070969
692 Ga0496102_0189225
693 Ga0496102_1017879
694 Ga0496103_0000950
695 Ga0496103_0022635
696 Ga0496104_0000093
697 Ga0496104_0022968
698 Ga0496104_0081696
699 Ga0496104_0522211
700 Ga0496105_0067616
701 Ga0496105_0253754
702 Ga0496105_0337340
703 Ga0496105_0377742
704 Ga0496106_0003250
705 Ga0496106_0019551
706 Ga0496106_0126670
707 Ga0496106_0161089
708 Ga0496106_0886645
709 Ga0496107_0012688
710 Ga0496107_0019673
711 Ga0496107_0040478
712 Ga0496107_0121370
713 Ga0496108_0000926
714 Ga0496108_0039959
715 Ga0496108_0188451
716 Ga0496108_0251150
717 Ga0496109_0001485
718 Ga0496109_0084014
719 Ga0496109_0112213
720 Ga0496109_0114306
721 Ga0496109_0381478
722 Ga0496109_0444136
723 Ga0496109_0711791
724 Ga0496109_0914338
725 Ga0496110_0003706
726 Ga0496110_0012600
727 Ga0496110_0020880
728 Ga0496110_0217021
729 Ga0496110_0449283
730 Ga0496110_0721046
731 Ga0496111_0000057
732 Ga0496111_0007804
733 Ga0496111_0105237
734 Ga0496111_0170268
735 Ga0496111_0569643
736 Ga0496112_0033929
737 Ga0496112_0092646
738 Ga0496112_0671228
739 Ga0496113_0046199
740 Ga0496113_0131809
741 Ga0496113_0311333
742 Ga0496113_0314194
743 Ga0496114_0059088
744 Ga0496114_0059338
745 Ga0496114_0768336
746 Ga0496114_0861285
747 Ga0496115_0276550
748 Ga0496119_0351393
749 Ga0496121_0159897
750 Ga0501067_0252670
751 Ga0501209_076855
752 Ga0501216_066966
753 Ga0501249_094934
754 nmdc:mga06r32_447515_c1
755 nmdc:mga08y16_44728_c1
756 Ga0495619_0362427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

38

145

0.95

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

29

148

0.89

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

49

156

0.87

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

50

166

0.85

PF08445

FR47

FR47-like protein

69

155

0.79

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

65

147

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9195 6 146
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.9064 6 146
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.8939 3 146
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8927 6 126
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8911 6 126
ID Description Score Start End Superfamily
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9365 6 146 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9242 102 146 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9156 6 146 3.40.630.30
af_O16486_94_277_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9095 6 146 3.40.630.30
4pv6F00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9089 4 146 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538LRL0-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9861 6 163 GO:0008080
AF-A0A7V9LFD8-F1-model_v4 Ribosomal protein S18-alanine N-acetyltransferase 0.9847 7 146 GO:0005840
GO:0008080
AF-A0A0F9AKR1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9822 2 148 GO:0008080
AF-A0A640YC85-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9753 6 144 GO:0008080
AF-A0A538LRL0-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9739 6 163 GO:0008080

Map