F428004

General Info

Members Datasets Scaffolds Average Seq Length
378 259 756 70

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10977805|Ga0105245_109778052
Length 81
Sequence MSAERGGSSMPEHVYRITEIVGSSTDSVDDAIRNGARRAAKTLHHLDWFEVTEIRGHFTDETIGHFQVTMKVGFRLDDDGE

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
99 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
177 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
181 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 2.38
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 9.79
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10977805 3300009098 Bacteria 890
2 JGI24750J21931_1063085 3300002070 Bacteria 595
3 JGI24035J26624_1008910 3300002126 Bacteria 985
4 JGI24751J29686_10032958 3300002459 Bacteria 1074
5 Ga0065707_10285227 3300005295 Bacteria 1038
6 Ga0070658_11123224 3300005327 Bacteria 683
7 Ga0070683_100505947 3300005329 Bacteria 1154
8 Ga0070690_101213805 3300005330 Bacteria 602
9 Ga0070670_100003142 3300005331 Bacteria 13658
10 Ga0068869_100448083 3300005334 Bacteria 1069
11 Ga0070666_10000090 3300005335 Bacteria 64025
12 Ga0070666_10577783 3300005335 Bacteria 819
13 Ga0070682_101758306 3300005337 Bacteria 540
14 Ga0068868_100101508 3300005338 Bacteria 2328
15 Ga0070660_101067723 3300005339 Bacteria 683
16 Ga0070689_100589268 3300005340 Bacteria 962
17 Ga0070687_101232777 3300005343 Bacteria 553
18 Ga0070668_100050782 3300005347 Bacteria 3194
19 Ga0070668_100132677 3300005347 Bacteria 2000
20 Ga0070668_100313421 3300005347 Bacteria 1319
21 Ga0070668_100638915 3300005347 Bacteria 934
22 Ga0070669_100000024 3300005353 Bacteria 173107
23 Ga0070669_100984223 3300005353 Bacteria 723
24 Ga0070671_100000006 3300005355 Bacteria 250635
25 Ga0070671_100021422 3300005355 Bacteria 5277
26 Ga0070671_100949603 3300005355 Unclassified 752
27 Ga0070674_100588011 3300005356 Bacteria 939
28 Ga0070674_101270546 3300005356 Bacteria 656
29 Ga0070674_101395765 3300005356 Bacteria 627
30 Ga0070673_100088357 3300005364 Bacteria 2527
31 Ga0070673_101052394 3300005364 Bacteria 759
32 Ga0070659_101294919 3300005366 Bacteria 646
33 Ga0070659_101321280 3300005366 Bacteria 640
34 Ga0070667_100150008 3300005367 Bacteria 2047
35 Ga0070667_100355409 3300005367 Bacteria 1327
36 Ga0070667_102359668 3300005367 Bacteria 501
37 Ga0070709_10271748 3300005434 Bacteria 1228
38 Ga0070713_100113848 3300005436 Bacteria 2362
39 Ga0070710_10103738 3300005437 Bacteria 1698
40 Ga0070710_11026670 3300005437 Unclassified 602
41 Ga0070705_100014815 3300005440 Bacteria 4021
42 Ga0070705_101752298 3300005440 Bacteria 526
43 Ga0070700_101070693 3300005441 Bacteria 667
44 Ga0070700_101447577 3300005441 Bacteria 582
45 Ga0070708_100132541 3300005445 Bacteria 2307
46 Ga0070678_100575061 3300005456 Bacteria 1003
47 Ga0070678_101143220 3300005456 Bacteria 720
48 Ga0070678_102088552 3300005456 Bacteria 537
49 Ga0070662_100681207 3300005457 Bacteria 869
50 Ga0070685_10599785 3300005466 Bacteria 792
51 Ga0070706_100266109 3300005467 Bacteria 1600
52 Ga0070706_100310696 3300005467 Bacteria 1470
53 Ga0070707_102330196 3300005468 Bacteria 503
54 Ga0070698_100246161 3300005471 Bacteria 1720
55 Ga0070699_100979860 3300005518 Bacteria 775
56 Ga0070684_100515036 3300005535 Bacteria 1109
57 Ga0070697_100075884 3300005536 Bacteria 2764
58 Ga0068853_100095767 3300005539 Bacteria 2618
59 Ga0068853_100684726 3300005539 Bacteria 977
60 Ga0070695_101741924 3300005545 Bacteria 522
61 Ga0070696_101521947 3300005546 Bacteria 573
62 Ga0070693_100884542 3300005547 Bacteria 668
63 Ga0068855_101200106 3300005563 Bacteria 789
64 Ga0070664_102059853 3300005564 Bacteria 542
65 Ga0068857_100069635 3300005577 Bacteria 3133
66 Ga0068854_100174306 3300005578 Bacteria 1676
67 Ga0070702_100300378 3300005615 Bacteria 1110
68 Ga0070702_100547237 3300005615 Bacteria 858
69 Ga0068859_100000858 3300005617 Bacteria 30940
70 Ga0068859_101268866 3300005617 Bacteria 812
71 Ga0068859_101331701 3300005617 Bacteria 791
72 Ga0068864_100002460 3300005618 Bacteria 15288
73 Ga0068866_10569926 3300005718 Bacteria 760
74 Ga0068861_100023356 3300005719 Bacteria 4459
75 Ga0068861_100046485 3300005719 Bacteria 3272
76 Ga0068861_100491305 3300005719 Bacteria 1108
77 Ga0068863_100018437 3300005841 Bacteria 6679
78 Ga0068863_101094099 3300005841 Bacteria 801
79 Ga0068858_100000967 3300005842 Bacteria 29708
80 Ga0068858_101928783 3300005842 Bacteria 584
81 Ga0068860_100006466 3300005843 Bacteria 11767
82 Ga0068860_100009901 3300005843 Bacteria 9452
83 Ga0068860_100521556 3300005843 Bacteria 1188
84 Ga0068862_100000307 3300005844 Bacteria 53788
85 Ga0068862_102275527 3300005844 Bacteria 554
86 Ga0081455_10419885 3300005937 Bacteria 923
87 Ga0070717_10127991 3300006028 Bacteria 2182
88 Ga0075365_10072085 3300006038 Bacteria 2327
89 Ga0075365_10258885 3300006038 Bacteria 1223
90 Ga0075363_100001748 3300006048 Bacteria 8467
91 Ga0075364_10010365 3300006051 Bacteria 5627
92 Ga0075364_10066987 3300006051 Bacteria 2359
93 Ga0070712_100268539 3300006175 Bacteria 1369
94 Ga0075362_10056867 3300006177 Bacteria 1762
95 Ga0075369_10002155 3300006186 Bacteria 6952
96 Ga0075370_10017396 3300006353 Bacteria 3885
97 Ga0068871_101243989 3300006358 Bacteria 699
98 Ga0068871_101552981 3300006358 Bacteria 626
99 Ga0075428_100073890 3300006844 Bacteria 3724
100 Ga0075430_100040014 3300006846 Bacteria 3968
101 Ga0075430_101512911 3300006846 Unclassified 551
102 Ga0075431_100320424 3300006847 Bacteria 1563
103 Ga0075431_100849421 3300006847 Bacteria 884
104 Ga0075433_10293361 3300006852 Bacteria 1440
105 Ga0068865_101283596 3300006881 Bacteria 650
106 Ga0097620_100000858 3300006931 Bacteria 30940
107 Ga0097620_101269032 3300006931 Bacteria 812
108 Ga0097620_101331754 3300006931 Bacteria 791
109 Ga0105250_10449116 3300009092 Bacteria 578
110 Ga0105240_12211576 3300009093 Bacteria 570
111 Ga0111539_10016139 3300009094 Bacteria 9267
112 Ga0111539_10791799 3300009094 Bacteria 1103
113 Ga0111539_11065458 3300009094 Bacteria 939
114 Ga0105245_11048771 3300009098 Bacteria 860
115 Ga0105245_11320208 3300009098 Bacteria 771
116 Ga0105245_11426260 3300009098 Unclassified 743
117 Ga0105247_10003380 3300009101 Bacteria 10433
118 Ga0114129_11305135 3300009147 Bacteria 899
119 Ga0105243_10258677 3300009148 Bacteria 1558
120 Ga0105243_12928615 3300009148 Unclassified 518
121 Ga0105241_10184189 3300009174 Bacteria 1734
122 Ga0105242_11078455 3300009176 Bacteria 816
123 Ga0105242_12438887 3300009176 Bacteria 571
124 Ga0105248_10035315 3300009177 Bacteria 5592
125 Ga0105248_10626036 3300009177 Bacteria 1214
126 Ga0105237_11675674 3300009545 Unclassified 643
127 Ga0105238_12073127 3300009551 Bacteria 603
128 Ga0105249_10007803 3300009553 Bacteria 9325
129 Ga0105249_10082103 3300009553 Bacteria 2998
130 Ga0105249_10846096 3300009553 Bacteria 980
131 Ga0105249_11052552 3300009553 Bacteria 883
132 Ga0105249_11770299 3300009553 Bacteria 690
133 Ga0105239_12186655 3300010375 Bacteria 643
134 Ga0105246_10063067 3300011119 Bacteria 2583
135 Ga0105246_10994453 3300011119 Bacteria 759
136 Ga0157318_1026270 3300012482 Bacteria 549
137 Ga0157370_10165652 3300013104 Bacteria 2055
138 Ga0157369_10089831 3300013105 Bacteria 3280
139 Ga0157374_12372169 3300013296 Bacteria 558
140 Ga0163162_10014296 3300013306 Bacteria 7754
141 Ga0163162_11909576 3300013306 Bacteria 680
142 Ga0157372_11249500 3300013307 Bacteria 858
143 Ga0157375_10586407 3300013308 Bacteria 1275
144 Ga0163163_10058871 3300014325 Bacteria 3798
145 Ga0163163_10850648 3300014325 Unclassified 976
146 Ga0163163_11365305 3300014325 Bacteria 770
147 Ga0157380_10088346 3300014326 Bacteria 2550
148 Ga0157380_11145772 3300014326 Bacteria 819
149 Ga0157379_10036997 3300014968 Bacteria 4351
150 Ga0157379_10444619 3300014968 Bacteria 1196
151 Ga0163161_10035352 3300017792 Bacteria 3576
152 Ga0163161_11551992 3300017792 Bacteria 583
153 Ga0163161_11933127 3300017792 Bacteria 525
154 Ga0206349_1473836 3300020075 Bacteria 1314
155 Ga0206355_1085572 3300020076 Bacteria 661
156 Ga0206351_10995353 3300020077 Bacteria 676
157 Ga0206350_10710933 3300020080 Bacteria 1553
158 Ga0206350_11579905 3300020080 Unclassified 662
159 Ga0206354_10293515 3300020081 Bacteria 1481
160 Ga0206353_11639926 3300020082 Bacteria 692
161 Ga0154015_1708573 3300020610 Bacteria 639
162 Ga0213875_10001072 3300021388 Bacteria 19159
163 Ga0213875_10097864 3300021388 Bacteria 1369
164 Ga0224712_10352065 3300022467 Bacteria 696
165 Ga0207697_10000273 3300025315 Bacteria 28435
166 Ga0207653_10102099 3300025885 Bacteria 1015
167 Ga0207692_10163780 3300025898 Bacteria 1283
168 Ga0207642_10797147 3300025899 Bacteria 601
169 Ga0207710_10005682 3300025900 Bacteria 5365
170 Ga0207688_10199488 3300025901 Bacteria 1199
171 Ga0207688_10453435 3300025901 Bacteria 800
172 Ga0207680_10001558 3300025903 Bacteria 10806
173 Ga0207647_10070501 3300025904 Bacteria 2111
174 Ga0207684_10009244 3300025910 Bacteria 8710
175 Ga0207684_10219963 3300025910 Bacteria 1639
176 Ga0207695_10503332 3300025913 Bacteria 1093
177 Ga0207693_11173643 3300025915 Bacteria 580
178 Ga0207663_10916211 3300025916 Bacteria 701
179 Ga0207662_11341796 3300025918 Bacteria 508
180 Ga0207657_10025519 3300025919 Bacteria 5448
181 Ga0207681_10000004 3300025923 Bacteria 559005
182 Ga0207681_10073592 3300025923 Bacteria 2391
183 Ga0207650_10006794 3300025925 Bacteria 7802
184 Ga0207659_10808010 3300025926 Bacteria 806
185 Ga0207687_10243010 3300025927 Bacteria 1428
186 Ga0207687_11711485 3300025927 Bacteria 539
187 Ga0207700_10178677 3300025928 Bacteria 1776
188 Ga0207644_10000009 3300025931 Bacteria 251643
189 Ga0207644_10864907 3300025931 Bacteria 757
190 Ga0207690_10559323 3300025932 Bacteria 930
191 Ga0207690_10900314 3300025932 Bacteria 734
192 Ga0207706_10263330 3300025933 Bacteria 1505
193 Ga0207706_11627706 3300025933 Bacteria 522
194 Ga0207686_11114220 3300025934 Bacteria 644
195 Ga0207709_10068326 3300025935 Bacteria 2246
196 Ga0207709_11562416 3300025935 Bacteria 548
197 Ga0207670_10396550 3300025936 Bacteria 1102
198 Ga0207704_11447331 3300025938 Bacteria 589
199 Ga0207665_11554462 3300025939 Bacteria 525
200 Ga0207711_10081395 3300025941 Bacteria 2830
201 Ga0207711_10997528 3300025941 Bacteria 777
202 Ga0207689_10049311 3300025942 Bacteria 3473
203 Ga0207689_10149954 3300025942 Bacteria 1922
204 Ga0207661_10693269 3300025944 Bacteria 937
205 Ga0207712_10022191 3300025961 Bacteria 4177
206 Ga0207712_10093482 3300025961 Bacteria 2219
207 Ga0207668_10001335 3300025972 Bacteria 14656
208 Ga0207668_12050835 3300025972 Bacteria 515
209 Ga0207640_12167959 3300025981 Bacteria 504
210 Ga0207658_10006920 3300025986 Bacteria 7721
211 Ga0207658_10382506 3300025986 Bacteria 1233
212 Ga0207677_10561662 3300026023 Bacteria 996
213 Ga0207703_10013885 3300026035 Bacteria 6278
214 Ga0207703_11735355 3300026035 Bacteria 600
215 Ga0207703_12428298 3300026035 Bacteria 500
216 Ga0207639_11747142 3300026041 Bacteria 582
217 Ga0207678_11304330 3300026067 Bacteria 642
218 Ga0207708_10706083 3300026075 Bacteria 862
219 Ga0207708_11253147 3300026075 Bacteria 649
220 Ga0207702_10114032 3300026078 Bacteria 2408
221 Ga0207641_10010254 3300026088 Bacteria 7705
222 Ga0207648_10156011 3300026089 Bacteria 2015
223 Ga0207648_11277813 3300026089 Bacteria 690
224 Ga0207676_10015971 3300026095 Bacteria 5431
225 Ga0207674_11692420 3300026116 Bacteria 601
226 Ga0207675_100000199 3300026118 Bacteria 55487
227 Ga0207675_100052132 3300026118 Bacteria 3818
228 Ga0207675_100516159 3300026118 Bacteria 1191
229 Ga0207683_10250046 3300026121 Bacteria 1618
230 Ga0207698_10529494 3300026142 Bacteria 1151
231 Ga0207698_12649369 3300026142 Bacteria 510
232 Ga0207428_10049062 3300027907 Unclassified 3384
233 Ga0207428_10309596 3300027907 Bacteria 1168
234 Ga0268266_10139553 3300028379 Bacteria 2174
235 Ga0268266_11392168 3300028379 Bacteria 677
236 Ga0268265_10000109 3300028380 Bacteria 104063
237 Ga0268265_11222657 3300028380 Bacteria 749
238 Ga0268264_10000069 3300028381 Bacteria 270492
239 Ga0268264_10017759 3300028381 Bacteria 5824
240 Ga0268264_10456596 3300028381 Bacteria 1239
241 Ga0268264_10692781 3300028381 Bacteria 1011
242 Ga0268264_11051710 3300028381 Bacteria 822
243 Ga0268264_11751157 3300028381 Bacteria 632
244 Ga0316181_1224027 3300030744 Bacteria 505
245 Ga0307409_102094832 3300031995 Bacteria 595
246 Ga0373926_0010380 3300035083 Bacteria 3121
247 Ga0373944_0001397 3300035089 Bacteria 6085
248 Ga0373923_0145470 3300035111 Bacteria 1073
249 Ga0373936_0000136 3300035113 Bacteria 25252
250 Ga0373945_0001442 3300035116 Bacteria 7246
251 Ga0373960_0241786 3300035121 Bacteria 653
252 Ga0373943_0001010 3300035170 Bacteria 12507
253 Ga0373946_0000042 3300035171 Bacteria 32829
254 Ga0373955_0124574 3300035172 Bacteria 1500
255 Ga0373955_0185114 3300035172 Bacteria 1237
256 Ga0373931_0669882 3300035691 Unclassified 683
257 Ga0373935_0006528 3300035692 Bacteria 6967
258 Ga0373927_0002474 3300035695 Bacteria 13480
259 Ga0373947_0000944 3300035725 Bacteria 17672
260 Ga0373937_0274345 3300036401 Bacteria 1592
261 Ga0373925_0003140 3300037068 Bacteria 12968
262 Ga0436364_0310624 3300037853 Bacteria 1807
263 Ga0436364_1456431 3300037853 Bacteria 47323
264 Ga0242420_024699 3300038996 Bacteria 1090
265 Ga0451789_0364958 3300041443 Bacteria 510
266 Ga0451791_1367456 3300041451 Bacteria 578
267 Ga0451793_1151690 3300041452 Bacteria 752
268 Ga0451807_2734040 3300041486 Bacteria 504
269 Ga0451851_0317262 3300041507 Bacteria 537
270 Ga0451843_1584272 3300041509 Bacteria 519
271 Ga0451853_3382671 3300041512 Bacteria 1194
272 Ga0466972_0032458 3300044658 Bacteria 2563
273 Ga0466964_0741039 3300044706 Bacteria 551
274 Ga0466967_0765403 3300045976 Bacteria 958
275 Ga0495629_0309104 3300046459 Bacteria 1082
276 Ga0495641_0009329 3300046461 Bacteria 5839
277 Ga0495651_0130001 3300046462 Bacteria 1839
278 Ga0495653_0008158 3300046463 Bacteria 8576
279 Ga0495653_0480860 3300046463 Bacteria 777
280 Ga0495650_0010290 3300046471 Bacteria 5230
281 Ga0495582_0061509 3300046473 Bacteria 2073
282 Ga0495662_0025885 3300046476 Bacteria 2834
283 Ga0495664_0000213 3300046477 Bacteria 27782
284 Ga0495608_0644686 3300046511 Bacteria 633
285 Ga0495618_0051055 3300046514 Bacteria 2613
286 Ga0495628_0894556 3300046516 Bacteria 616
287 Ga0495630_0015019 3300046517 Bacteria 5651
288 Ga0495630_1248376 3300046517 Bacteria 561
289 Ga0495666_0449395 3300046526 Bacteria 577
290 Ga0495652_0060479 3300046529 Bacteria 3201
291 Ga0495640_0376770 3300046533 Bacteria 873
292 Ga0495587_0135124 3300046536 Bacteria 1409
293 Ga0495645_0297853 3300046543 Bacteria 1055
294 Ga0495667_0011582 3300046559 Bacteria 5971
295 Ga0495634_0053029 3300046642 Bacteria 2717
296 Ga0495635_0001642 3300046663 Bacteria 15081
297 Ga0495657_0013744 3300046675 Bacteria 5960
298 Ga0495657_0298194 3300046675 Bacteria 962
299 Ga0495599_0132732 3300046678 Bacteria 1546
300 Ga0495647_0139404 3300046681 Bacteria 1033
301 Ga0495624_0082661 3300046690 Bacteria 1987
302 Ga0495674_0004016 3300047319 Bacteria 14248
303 Ga0495676_0024775 3300047321 Bacteria 5186
304 Ga0495680_0002773 3300047322 Bacteria 17675
305 Ga0495680_0213079 3300047322 Bacteria 1382
306 Ga0495684_0004012 3300047471 Bacteria 11481
307 Ga0495593_0151181 3300047673 Bacteria 1174
308 Ga0495602_0520318 3300048088 Bacteria 829
309 Ga0495602_0878236 3300048088 Bacteria 598
310 Ga0496100_0065142 3300048903 Bacteria 2413
311 Ga0496100_0286095 3300048903 Bacteria 1230
312 Ga0496101_0201916 3300048904 Bacteria 1537
313 Ga0496101_1074890 3300048904 Unclassified 632
314 Ga0496102_0048716 3300048905 Bacteria 3853
315 Ga0496102_0864669 3300048905 Bacteria 826
316 Ga0496104_0084432 3300048907 Bacteria 3030
317 Ga0496104_0722381 3300048907 Bacteria 904
318 Ga0496104_0820315 3300048907 Unclassified 836
319 Ga0496104_1815669 3300048907 Bacteria 512
320 Ga0496105_0646506 3300048908 Bacteria 816
321 Ga0496105_0701624 3300048908 Bacteria 777
322 Ga0496106_0646812 3300048909 Bacteria 845
323 Ga0496106_1039885 3300048909 Bacteria 643
324 Ga0496106_1178973 3300048909 Unclassified 598
325 Ga0496107_0577534 3300048910 Bacteria 832
326 Ga0496107_0931689 3300048910 Bacteria 632
327 Ga0496108_0663163 3300048911 Bacteria 906
328 Ga0496108_0741925 3300048911 Bacteria 850
329 Ga0496109_0411167 3300048912 Bacteria 1278
330 Ga0496109_0806521 3300048912 Bacteria 877
331 Ga0496110_1488410 3300048913 Bacteria 587
332 Ga0496111_0194480 3300048914 Bacteria 1508
333 Ga0496111_0555815 3300048914 Unclassified 842
334 Ga0496111_0903816 3300048914 Bacteria 636
335 Ga0496112_1537298 3300048915 Bacteria 579
336 Ga0496112_1937492 3300048915 Bacteria 501
337 Ga0496113_0428041 3300048916 Bacteria 1063
338 Ga0496113_0525291 3300048916 Unclassified 950
339 Ga0496113_0556565 3300048916 Bacteria 920
340 Ga0496114_0465872 3300048917 Bacteria 1118
341 Ga0496115_0016439 3300048918 Bacteria 5636
342 Ga0496115_0169518 3300048918 Bacteria 1805
343 Ga0501036_0376599 3300049572 Bacteria 1185
344 Ga0501038_0276836 3300049574 Bacteria 1322
345 Ga0501040_0084048 3300049576 Unclassified 2208
346 Ga0501042_0121001 3300049578 Bacteria 1885
347 Ga0501046_0670818 3300049580 Bacteria 732
348 Ga0501070_1530367 3300049586 Bacteria 504
349 Ga0501071_0014584 3300049587 Bacteria 5377
350 Ga0501072_0064399 3300049588 Bacteria 2891
351 Ga0501075_0115470 3300049591 Bacteria 2041
352 Ga0501076_0359988 3300049592 Bacteria 1195
353 Ga0501079_0078098 3300049741 Bacteria 2561
354 Ga0501083_0213544 3300049744 Bacteria 1258
355 nmdc:mga03683_171350_c1 3300050489 Bacteria 986
356 nmdc:mga03n38_10028_c1 3300050490 Bacteria 3469
357 nmdc:mga00v17_4748_c1 3300050491 Bacteria 7109
358 nmdc:mga00v17_56597_c1 3300050491 Bacteria 2398
359 nmdc:mga0yw44_49182_c1 3300050492 Bacteria 2544
360 nmdc:mga0yw44_527114_c1 3300050492 Bacteria 802
361 nmdc:mga07m45_14033_c1 3300050496 Bacteria 4261
362 nmdc:mga05p37_2255294_c1 3300050507 Unclassified 503
363 nmdc:mga05p37_866856_c1 3300050507 Bacteria 978
364 nmdc:mga0qj67_1236328_c1 3300050509 Unclassified 580
365 nmdc:mga06r32_804820_c1 3300050510 Bacteria 900
366 nmdc:mga08y16_13782_c1 3300050511 Bacteria 8510
367 nmdc:mga08y16_853353_c1 3300050511 Bacteria 900
368 nmdc:mga0a205_43624_c2 3300050515 Bacteria 3941
369 nmdc:mga0sz30_9851_c1 3300050516 Bacteria 3645
370 Ga0495601_0049023 3300053077 Bacteria 2662
371 Ga0495601_0077493 3300053077 Bacteria 2129
372 Ga0495601_0837862 3300053077 Bacteria 583
373 Ga0495612_0116346 3300053078 Bacteria 1148
374 Ga0495619_0345605 3300053085 Bacteria 1029
375 Ga0495619_0836006 3300053085 Bacteria 622
376 Ga0501084_0116239 3300054114 Bacteria 2249
377 Ga0530510_0037680 3300061734 Bacteria 3489
378 2833712289 2833709550 Bacteria 4008291
379 Ga0105245_10977805
380 JGI24750J21931_1063085
381 JGI24035J26624_1008910
382 JGI24751J29686_10032958
383 Ga0065707_10285227
384 Ga0070658_11123224
385 Ga0070683_100505947
386 Ga0070690_101213805
387 Ga0070670_100003142
388 Ga0068869_100448083
389 Ga0070666_10000090
390 Ga0070666_10577783
391 Ga0070682_101758306
392 Ga0068868_100101508
393 Ga0070660_101067723
394 Ga0070689_100589268
395 Ga0070687_101232777
396 Ga0070668_100050782
397 Ga0070668_100132677
398 Ga0070668_100313421
399 Ga0070668_100638915
400 Ga0070669_100000024
401 Ga0070669_100984223
402 Ga0070671_100000006
403 Ga0070671_100021422
404 Ga0070671_100949603
405 Ga0070674_100588011
406 Ga0070674_101270546
407 Ga0070674_101395765
408 Ga0070673_100088357
409 Ga0070673_101052394
410 Ga0070659_101294919
411 Ga0070659_101321280
412 Ga0070667_100150008
413 Ga0070667_100355409
414 Ga0070667_102359668
415 Ga0070709_10271748
416 Ga0070713_100113848
417 Ga0070710_10103738
418 Ga0070710_11026670
419 Ga0070705_100014815
420 Ga0070705_101752298
421 Ga0070700_101070693
422 Ga0070700_101447577
423 Ga0070708_100132541
424 Ga0070678_100575061
425 Ga0070678_101143220
426 Ga0070678_102088552
427 Ga0070662_100681207
428 Ga0070685_10599785
429 Ga0070706_100266109
430 Ga0070706_100310696
431 Ga0070707_102330196
432 Ga0070698_100246161
433 Ga0070699_100979860
434 Ga0070684_100515036
435 Ga0070697_100075884
436 Ga0068853_100095767
437 Ga0068853_100684726
438 Ga0070695_101741924
439 Ga0070696_101521947
440 Ga0070693_100884542
441 Ga0068855_101200106
442 Ga0070664_102059853
443 Ga0068857_100069635
444 Ga0068854_100174306
445 Ga0070702_100300378
446 Ga0070702_100547237
447 Ga0068859_100000858
448 Ga0068859_101268866
449 Ga0068859_101331701
450 Ga0068864_100002460
451 Ga0068866_10569926
452 Ga0068861_100023356
453 Ga0068861_100046485
454 Ga0068861_100491305
455 Ga0068863_100018437
456 Ga0068863_101094099
457 Ga0068858_100000967
458 Ga0068858_101928783
459 Ga0068860_100006466
460 Ga0068860_100009901
461 Ga0068860_100521556
462 Ga0068862_100000307
463 Ga0068862_102275527
464 Ga0081455_10419885
465 Ga0070717_10127991
466 Ga0075365_10072085
467 Ga0075365_10258885
468 Ga0075363_100001748
469 Ga0075364_10010365
470 Ga0075364_10066987
471 Ga0070712_100268539
472 Ga0075362_10056867
473 Ga0075369_10002155
474 Ga0075370_10017396
475 Ga0068871_101243989
476 Ga0068871_101552981
477 Ga0075428_100073890
478 Ga0075430_100040014
479 Ga0075430_101512911
480 Ga0075431_100320424
481 Ga0075431_100849421
482 Ga0075433_10293361
483 Ga0068865_101283596
484 Ga0097620_100000858
485 Ga0097620_101269032
486 Ga0097620_101331754
487 Ga0105250_10449116
488 Ga0105240_12211576
489 Ga0111539_10016139
490 Ga0111539_10791799
491 Ga0111539_11065458
492 Ga0105245_11048771
493 Ga0105245_11320208
494 Ga0105245_11426260
495 Ga0105247_10003380
496 Ga0114129_11305135
497 Ga0105243_10258677
498 Ga0105243_12928615
499 Ga0105241_10184189
500 Ga0105242_11078455
501 Ga0105242_12438887
502 Ga0105248_10035315
503 Ga0105248_10626036
504 Ga0105237_11675674
505 Ga0105238_12073127
506 Ga0105249_10007803
507 Ga0105249_10082103
508 Ga0105249_10846096
509 Ga0105249_11052552
510 Ga0105249_11770299
511 Ga0105239_12186655
512 Ga0105246_10063067
513 Ga0105246_10994453
514 Ga0157318_1026270
515 Ga0157370_10165652
516 Ga0157369_10089831
517 Ga0157374_12372169
518 Ga0163162_10014296
519 Ga0163162_11909576
520 Ga0157372_11249500
521 Ga0157375_10586407
522 Ga0163163_10058871
523 Ga0163163_10850648
524 Ga0163163_11365305
525 Ga0157380_10088346
526 Ga0157380_11145772
527 Ga0157379_10036997
528 Ga0157379_10444619
529 Ga0163161_10035352
530 Ga0163161_11551992
531 Ga0163161_11933127
532 Ga0206349_1473836
533 Ga0206355_1085572
534 Ga0206351_10995353
535 Ga0206350_10710933
536 Ga0206350_11579905
537 Ga0206354_10293515
538 Ga0206353_11639926
539 Ga0154015_1708573
540 Ga0213875_10001072
541 Ga0213875_10097864
542 Ga0224712_10352065
543 Ga0207697_10000273
544 Ga0207653_10102099
545 Ga0207692_10163780
546 Ga0207642_10797147
547 Ga0207710_10005682
548 Ga0207688_10199488
549 Ga0207688_10453435
550 Ga0207680_10001558
551 Ga0207647_10070501
552 Ga0207684_10009244
553 Ga0207684_10219963
554 Ga0207695_10503332
555 Ga0207693_11173643
556 Ga0207663_10916211
557 Ga0207662_11341796
558 Ga0207657_10025519
559 Ga0207681_10000004
560 Ga0207681_10073592
561 Ga0207650_10006794
562 Ga0207659_10808010
563 Ga0207687_10243010
564 Ga0207687_11711485
565 Ga0207700_10178677
566 Ga0207644_10000009
567 Ga0207644_10864907
568 Ga0207690_10559323
569 Ga0207690_10900314
570 Ga0207706_10263330
571 Ga0207706_11627706
572 Ga0207686_11114220
573 Ga0207709_10068326
574 Ga0207709_11562416
575 Ga0207670_10396550
576 Ga0207704_11447331
577 Ga0207665_11554462
578 Ga0207711_10081395
579 Ga0207711_10997528
580 Ga0207689_10049311
581 Ga0207689_10149954
582 Ga0207661_10693269
583 Ga0207712_10022191
584 Ga0207712_10093482
585 Ga0207668_10001335
586 Ga0207668_12050835
587 Ga0207640_12167959
588 Ga0207658_10006920
589 Ga0207658_10382506
590 Ga0207677_10561662
591 Ga0207703_10013885
592 Ga0207703_11735355
593 Ga0207703_12428298
594 Ga0207639_11747142
595 Ga0207678_11304330
596 Ga0207708_10706083
597 Ga0207708_11253147
598 Ga0207702_10114032
599 Ga0207641_10010254
600 Ga0207648_10156011
601 Ga0207648_11277813
602 Ga0207676_10015971
603 Ga0207674_11692420
604 Ga0207675_100000199
605 Ga0207675_100052132
606 Ga0207675_100516159
607 Ga0207683_10250046
608 Ga0207698_10529494
609 Ga0207698_12649369
610 Ga0207428_10049062
611 Ga0207428_10309596
612 Ga0268266_10139553
613 Ga0268266_11392168
614 Ga0268265_10000109
615 Ga0268265_11222657
616 Ga0268264_10000069
617 Ga0268264_10017759
618 Ga0268264_10456596
619 Ga0268264_10692781
620 Ga0268264_11051710
621 Ga0268264_11751157
622 Ga0316181_1224027
623 Ga0307409_102094832
624 Ga0373926_0010380
625 Ga0373944_0001397
626 Ga0373923_0145470
627 Ga0373936_0000136
628 Ga0373945_0001442
629 Ga0373960_0241786
630 Ga0373943_0001010
631 Ga0373946_0000042
632 Ga0373955_0124574
633 Ga0373955_0185114
634 Ga0373931_0669882
635 Ga0373935_0006528
636 Ga0373927_0002474
637 Ga0373947_0000944
638 Ga0373937_0274345
639 Ga0373925_0003140
640 Ga0436364_0310624
641 Ga0436364_1456431
642 Ga0242420_024699
643 Ga0451789_0364958
644 Ga0451791_1367456
645 Ga0451793_1151690
646 Ga0451807_2734040
647 Ga0451851_0317262
648 Ga0451843_1584272
649 Ga0451853_3382671
650 Ga0466972_0032458
651 Ga0466964_0741039
652 Ga0466967_0765403
653 Ga0495629_0309104
654 Ga0495641_0009329
655 Ga0495651_0130001
656 Ga0495653_0008158
657 Ga0495653_0480860
658 Ga0495650_0010290
659 Ga0495582_0061509
660 Ga0495662_0025885
661 Ga0495664_0000213
662 Ga0495608_0644686
663 Ga0495618_0051055
664 Ga0495628_0894556
665 Ga0495630_0015019
666 Ga0495630_1248376
667 Ga0495666_0449395
668 Ga0495652_0060479
669 Ga0495640_0376770
670 Ga0495587_0135124
671 Ga0495645_0297853
672 Ga0495667_0011582
673 Ga0495634_0053029
674 Ga0495635_0001642
675 Ga0495657_0013744
676 Ga0495657_0298194
677 Ga0495599_0132732
678 Ga0495647_0139404
679 Ga0495624_0082661
680 Ga0495674_0004016
681 Ga0495676_0024775
682 Ga0495680_0002773
683 Ga0495680_0213079
684 Ga0495684_0004012
685 Ga0495593_0151181
686 Ga0495602_0520318
687 Ga0495602_0878236
688 Ga0496100_0065142
689 Ga0496100_0286095
690 Ga0496101_0201916
691 Ga0496101_1074890
692 Ga0496102_0048716
693 Ga0496102_0864669
694 Ga0496104_0084432
695 Ga0496104_0722381
696 Ga0496104_0820315
697 Ga0496104_1815669
698 Ga0496105_0646506
699 Ga0496105_0701624
700 Ga0496106_0646812
701 Ga0496106_1039885
702 Ga0496106_1178973
703 Ga0496107_0577534
704 Ga0496107_0931689
705 Ga0496108_0663163
706 Ga0496108_0741925
707 Ga0496109_0411167
708 Ga0496109_0806521
709 Ga0496110_1488410
710 Ga0496111_0194480
711 Ga0496111_0555815
712 Ga0496111_0903816
713 Ga0496112_1537298
714 Ga0496112_1937492
715 Ga0496113_0428041
716 Ga0496113_0525291
717 Ga0496113_0556565
718 Ga0496114_0465872
719 Ga0496115_0016439
720 Ga0496115_0169518
721 Ga0501036_0376599
722 Ga0501038_0276836
723 Ga0501040_0084048
724 Ga0501042_0121001
725 Ga0501046_0670818
726 Ga0501070_1530367
727 Ga0501071_0014584
728 Ga0501072_0064399
729 Ga0501075_0115470
730 Ga0501076_0359988
731 Ga0501079_0078098
732 Ga0501083_0213544
733 nmdc:mga03683_171350_c1
734 nmdc:mga03n38_10028_c1
735 nmdc:mga00v17_4748_c1
736 nmdc:mga00v17_56597_c1
737 nmdc:mga0yw44_49182_c1
738 nmdc:mga0yw44_527114_c1
739 nmdc:mga07m45_14033_c1
740 nmdc:mga05p37_2255294_c1
741 nmdc:mga05p37_866856_c1
742 nmdc:mga0qj67_1236328_c1
743 nmdc:mga06r32_804820_c1
744 nmdc:mga08y16_13782_c1
745 nmdc:mga08y16_853353_c1
746 nmdc:mga0a205_43624_c2
747 nmdc:mga0sz30_9851_c1
748 Ga0495601_0049023
749 Ga0495601_0077493
750 Ga0495601_0837862
751 Ga0495612_0116346
752 Ga0495619_0345605
753 Ga0495619_0836006
754 Ga0501084_0116239
755 Ga0530510_0037680
756 2833712289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

14

77

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9471 3 68
2v19-assembly1.cif.gz_D crystal structure of the t. thermophilus dodecin r45a mutant 0.942 3 69
6ri3-assembly1.cif.gz_A dodecin from streptomyces davaonensis 0.9414 2 69
2cz8-assembly1.cif.gz_D crystal structure of tt0972 protein from thermus thermophilus 0.9402 3 69
2vyx-assembly1.cif.gz_F crystal structure of the t. thermophilus dodecin w38f mutant 0.9391 3 69
ID Description Score Start End Superfamily
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9049 5 68 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8955 1 68 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8916 5 68 3.30.1660.10
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8807 5 65 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.872 1 68 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A7Y2K931-F1-model_v4 Dodecin domain-containing protein 0.995 9 65
AF-A0A087NBA7-F1-model_v4 Dodecin 0.9909 11 65
AF-A0A6N8B2Y1-F1-model_v4 Dodecin domain-containing protein 0.9858 5 65
AF-A0A559RIT1-F1-model_v4 Dodecin 0.9834 9 68
AF-A0A6H3PZB5-F1-model_v4 deleted 0.9816 5 65

Map