F427967

General Info

Members Datasets Scaffolds Average Seq Length
378 192 756 337

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10079685|Ga0081455_100796852
Length 383
Sequence MNGGIAQKRIELAFIEAELGADHRRPEIRRDTVEGGAIENIDIKPELALPLRLLTEEVELVRAFRHHEAAGQLEIEIGPELALECLPERDRLGIERQLPFHARHILRIEPHEAALHLDMKAAGIGVGAAMTGMRPVVDIMFGDFITLTMDQLVNQAAKIHYMSGGKLKVPMVLRTTLGASRRSAAQHSQSLHAWLSHIPGLKVVVPSTPYDAKGLLKSAIRDDNPVVFFEDKMMYQLKGQVPVEEYIIPLGVADVKRAGSDITLVATSSMVHVALAAADALQASGVSAEVVDVRTTVPLDKETIIESVKKTSRAIVIDEGYERYGVTAEIASVIADGAFYYLDAPVKRMGAMDVPVPFSPVLEDQTVPTSESVAELAKTLCNK

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
192 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.26
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10079685 3300005937 Bacteria 2688
2 JGI25405J52794_10000699 3300003911 Bacteria 5094
3 Ga0065707_10086729 3300005295 Bacteria 5335
4 Ga0070658_10084496 3300005327 Bacteria 2610
5 Ga0070683_100001328 3300005329 Bacteria 18830
6 Ga0070683_100056490 3300005329 Bacteria 3646
7 Ga0068869_100033363 3300005334 Bacteria 3634
8 Ga0070680_100045212 3300005336 Bacteria 3580
9 Ga0070680_100057584 3300005336 Bacteria 3177
10 Ga0070689_100109072 3300005340 Archaea 2200
11 Ga0070691_10002077 3300005341 Bacteria 8849
12 Ga0070709_10006286 3300005434 Bacteria 6467
13 Ga0070714_100045787 3300005435 Bacteria 3709
14 Ga0070714_100069399 3300005435 Bacteria 3043
15 Ga0070713_100001368 3300005436 Bacteria 15597
16 Ga0070713_100052575 3300005436 Bacteria 3373
17 Ga0070713_100067841 3300005436 Bacteria 3005
18 Ga0070713_100275026 3300005436 Bacteria 1543
19 Ga0070701_10007158 3300005438 Bacteria 4745
20 Ga0070708_100000360 3300005445 Bacteria 34450
21 Ga0070708_100001590 3300005445 Bacteria 17399
22 Ga0070708_100029840 3300005445 Bacteria 4707
23 Ga0070708_100265516 3300005445 Bacteria 1614
24 Ga0070662_100093677 3300005457 Bacteria 2260
25 Ga0070662_100307485 3300005457 Bacteria 1290
26 Ga0070681_10198615 3300005458 Bacteria 1924
27 Ga0070706_100002772 3300005467 Bacteria 17508
28 Ga0070706_100007607 3300005467 Bacteria 10141
29 Ga0070706_100012536 3300005467 Bacteria 7850
30 Ga0070706_100055539 3300005467 Bacteria 3655
31 Ga0070706_100082533 3300005467 Bacteria 2977
32 Ga0070706_100241784 3300005467 Bacteria 1686
33 Ga0070707_100000360 3300005468 Bacteria 44793
34 Ga0070707_100003435 3300005468 Bacteria 14975
35 Ga0070707_100012667 3300005468 Bacteria 7876
36 Ga0070707_100022221 3300005468 Bacteria 5996
37 Ga0070707_100032472 3300005468 Bacteria 4975
38 Ga0070707_100054663 3300005468 Bacteria 3828
39 Ga0070707_100315944 3300005468 Bacteria 1518
40 Ga0070698_100004091 3300005471 Bacteria 16019
41 Ga0070698_100011720 3300005471 Bacteria 9298
42 Ga0070698_100065230 3300005471 Bacteria 3666
43 Ga0070698_100230116 3300005471 Bacteria 1787
44 Ga0070698_100263349 3300005471 Bacteria 1656
45 Ga0070698_100309101 3300005471 Bacteria 1511
46 Ga0070698_100408693 3300005471 Bacteria 1291
47 Ga0070699_100000026 3300005518 Bacteria 157963
48 Ga0070699_100001534 3300005518 Bacteria 21102
49 Ga0070699_100002828 3300005518 Bacteria 15489
50 Ga0070699_100016578 3300005518 Bacteria 6324
51 Ga0070679_100084037 3300005530 Bacteria 3171
52 Ga0070684_100001025 3300005535 Bacteria 19928
53 Ga0070684_100110182 3300005535 Bacteria 2468
54 Ga0070697_100000158 3300005536 Bacteria 55228
55 Ga0070697_100015928 3300005536 Bacteria 5908
56 Ga0070697_100329583 3300005536 Bacteria 1316
57 Ga0070696_100147185 3300005546 Bacteria 1726
58 Ga0070704_100114067 3300005549 Bacteria 2062
59 Ga0070704_100158391 3300005549 Bacteria 1788
60 Ga0068857_100000247 3300005577 Bacteria 36125
61 Ga0068857_100004323 3300005577 Bacteria 11984
62 Ga0068857_100101559 3300005577 Bacteria 2581
63 Ga0068856_100009190 3300005614 Bacteria 9609
64 Ga0068859_100359114 3300005617 Bacteria 1552
65 Ga0068859_100389755 3300005617 Bacteria 1489
66 Ga0068870_10087619 3300005840 Bacteria 1734
67 Ga0068860_100145622 3300005843 Bacteria 2279
68 Ga0081455_10001216 3300005937 Bacteria 32264
69 Ga0081455_10003829 3300005937 Bacteria 17162
70 Ga0081538_10000017 3300005981 Bacteria 145769
71 Ga0081538_10002234 3300005981 Bacteria 19168
72 Ga0081538_10104959 3300005981 Bacteria 1408
73 Ga0070717_10070883 3300006028 Bacteria 2906
74 Ga0070717_10080036 3300006028 Bacteria 2741
75 Ga0070717_10165736 3300006028 Bacteria 1919
76 Ga0070717_10286544 3300006028 Bacteria 1462
77 Ga0070715_10076061 3300006163 Unclassified 1512
78 Ga0075428_100040453 3300006844 Bacteria 5128
79 Ga0075428_100253862 3300006844 Bacteria 1894
80 Ga0075430_100031737 3300006846 Bacteria 4483
81 Ga0075430_100061094 3300006846 Bacteria 3167
82 Ga0075431_100507930 3300006847 Bacteria 1196
83 Ga0075433_10024968 3300006852 Bacteria 5049
84 Ga0075433_10065339 3300006852 Bacteria 3191
85 Ga0075434_100006893 3300006871 Bacteria 10465
86 Ga0075434_100007907 3300006871 Bacteria 9854
87 Ga0075434_100074576 3300006871 Bacteria 3386
88 Ga0075434_100208032 3300006871 Bacteria 1977
89 Ga0075429_100326117 3300006880 Bacteria 1344
90 Ga0075436_100012669 3300006914 Bacteria 5778
91 Ga0075436_100148814 3300006914 Bacteria 1647
92 Ga0097620_100359109 3300006931 Bacteria 1552
93 Ga0097620_100389752 3300006931 Bacteria 1489
94 Ga0075435_100013230 3300007076 Bacteria 6132
95 Ga0075435_100057787 3300007076 Bacteria 3139
96 Ga0099794_10000198 3300007265 Bacteria 21915
97 Ga0099794_10032256 3300007265 Bacteria 2458
98 Ga0099794_10042609 3300007265 Bacteria 2164
99 Ga0105240_10010455 3300009093 Bacteria 13042
100 Ga0111539_10065363 3300009094 Bacteria 4298
101 Ga0111539_10136168 3300009094 Bacteria 2876
102 Ga0111539_10298966 3300009094 Bacteria 1873
103 Ga0114129_10003443 3300009147 Bacteria 22254
104 Ga0114129_10009036 3300009147 Bacteria 14201
105 Ga0114129_10028105 3300009147 Bacteria 7968
106 Ga0114129_10107315 3300009147 Bacteria 3857
107 Ga0105242_10194700 3300009176 Bacteria 1797
108 Ga0157371_10130834 3300013102 Bacteria 1785
109 Ga0157369_10001540 3300013105 Bacteria 28240
110 Ga0157378_10054973 3300013297 Bacteria 3546
111 Ga0157372_10309268 3300013307 Bacteria 1839
112 Ga0157372_10365924 3300013307 Bacteria 1680
113 Ga0213874_10002352 3300021377 Bacteria 4056
114 Ga0213875_10055609 3300021388 Bacteria 1853
115 Ga0224712_10048660 3300022467 Unclassified 1638
116 Ga0207653_10026157 3300025885 Bacteria 1870
117 Ga0207699_10005200 3300025906 Bacteria 6222
118 Ga0207705_10138248 3300025909 Bacteria 1817
119 Ga0207684_10001690 3300025910 Bacteria 23447
120 Ga0207684_10002343 3300025910 Bacteria 19191
121 Ga0207684_10002697 3300025910 Bacteria 17739
122 Ga0207684_10003371 3300025910 Bacteria 15643
123 Ga0207684_10202130 3300025910 Bacteria 1714
124 Ga0207707_10003077 3300025912 Bacteria 14811
125 Ga0207695_10044615 3300025913 Bacteria 4713
126 Ga0207660_10123894 3300025917 Bacteria 1961
127 Ga0207652_10055538 3300025921 Bacteria 3407
128 Ga0207652_10199671 3300025921 Bacteria 1800
129 Ga0207646_10000538 3300025922 Bacteria 50371
130 Ga0207646_10000962 3300025922 Bacteria 37134
131 Ga0207646_10011631 3300025922 Bacteria 8509
132 Ga0207646_10041098 3300025922 Bacteria 4158
133 Ga0207646_10046049 3300025922 Bacteria 3915
134 Ga0207646_10180463 3300025922 Bacteria 1907
135 Ga0207646_10271727 3300025922 Bacteria 1532
136 Ga0207700_10017184 3300025928 Bacteria 4827
137 Ga0207700_10040131 3300025928 Bacteria 3414
138 Ga0207700_10085430 3300025928 Bacteria 2477
139 Ga0207700_10100858 3300025928 Bacteria 2302
140 Ga0207670_10103695 3300025936 Archaea 2036
141 Ga0207661_10000102 3300025944 Bacteria 54330
142 Ga0207661_10413264 3300025944 Bacteria 1225
143 Ga0207712_10103505 3300025961 Bacteria 2121
144 Ga0207712_10170539 3300025961 Bacteria 1701
145 Ga0207678_10125836 3300026067 Bacteria 2186
146 Ga0207702_10002513 3300026078 Bacteria 17301
147 Ga0207674_10000194 3300026116 Bacteria 75212
148 Ga0207674_10001068 3300026116 Bacteria 35655
149 Ga0207674_10115985 3300026116 Bacteria 2649
150 Ga0210000_1001970 3300027462 Bacteria 2898
151 Ga0209179_1015372 3300027512 Bacteria 1421
152 Ga0209588_1000101 3300027671 Bacteria 26684
153 Ga0209588_1006570 3300027671 Bacteria 3388
154 Ga0209588_1018647 3300027671 Bacteria 2161
155 Ga0209998_10005664 3300027717 Bacteria 2607
156 Ga0207428_10147511 3300027907 Bacteria 1792
157 Ga0207428_10278475 3300027907 Bacteria 1242
158 Ga0265338_10008718 3300028800 Bacteria 12257
159 Ga0265338_10010302 3300028800 Bacteria 10986
160 Ga0265338_10079618 3300028800 Bacteria 2757
161 Ga0265338_10142120 3300028800 Unclassified 1879
162 Ga0265339_10014289 3300031249 Bacteria 4787
163 Ga0307408_100005942 3300031548 Bacteria 8129
164 Ga0307408_100402038 3300031548 Bacteria 1176
165 Ga0316578_10040821 3300031728 Bacteria 2685
166 Ga0307405_10013151 3300031731 Bacteria 4407
167 Ga0307405_10052487 3300031731 Bacteria 2535
168 Ga0307406_10029130 3300031901 Bacteria 3342
169 Ga0307407_10115094 3300031903 Bacteria 1695
170 Ga0307416_100013268 3300032002 Bacteria 5593
171 Ga0307416_100274633 3300032002 Bacteria 1657
172 Ga0307415_100208029 3300032126 Bacteria 1558
173 Ga0316583_10018660 3300032133 Bacteria 2491
174 Ga0373928_0013696 3300035084 Bacteria 1631
175 Ga0373954_0005053 3300035118 Bacteria 5691
176 Ga0373956_0000716 3300035119 Bacteria 13660
177 Ga0373943_0019439 3300035170 Bacteria 3124
178 Ga0373931_0065898 3300035691 Bacteria 1964
179 Ga0373935_0053929 3300035692 Bacteria 2558
180 Ga0373927_0000367 3300035695 Bacteria 35127
181 Ga0373933_0003991 3300035724 Bacteria 8134
182 Ga0373933_0010791 3300035724 Bacteria 5013
183 Ga0373947_0016847 3300035725 Bacteria 4197
184 Ga0373947_0017239 3300035725 Bacteria 4153
185 Ga0373937_0036540 3300036401 Bacteria 4477
186 Ga0373925_0043729 3300037068 Bacteria 3325
187 Ga0395899_0072920 3300037312 Bacteria 2512
188 Ga0395900_0023714 3300037418 Bacteria 6278
189 Ga0395900_0079053 3300037418 Bacteria 3379
190 Ga0395900_0174338 3300037418 Bacteria 2188
191 Ga0395898_0430347 3300037466 Bacteria 1257
192 Ga0395905_0170399 3300037471 Bacteria 2045
193 Ga0395905_0174374 3300037471 Bacteria 2019
194 Ga0395905_0209141 3300037471 Bacteria 1828
195 Ga0436364_0479765 3300037853 Bacteria 3138
196 Ga0436364_0862687 3300037853 Bacteria 4425
197 Ga0436364_1050032 3300037853 Bacteria 2194
198 Ga0436364_1249393 3300037853 Bacteria 1192
199 Ga0395901_0041314 3300038443 Bacteria 4779
200 Ga0395901_0140912 3300038443 Bacteria 2534
201 Ga0395901_0324089 3300038443 Bacteria 1593
202 Ga0436365_0145803 3300039437 Bacteria 7567
203 Ga0436363_0113512 3300039450 Unclassified 4528
204 Ga0453683_0000324 3300044673 Bacteria 58910
205 Ga0453683_0071908 3300044673 Bacteria 2165
206 Ga0466957_0052241 3300044842 Bacteria 2488
207 Ga0466957_0097274 3300044842 Bacteria 1851
208 Ga0451576_0047233 3300045051 Bacteria 4527
209 Ga0495592_0062893 3300046454 Bacteria 2723
210 Ga0495603_0067347 3300046455 Bacteria 2108
211 Ga0495629_0125764 3300046459 Bacteria 1786
212 Ga0495651_0018306 3300046462 Bacteria 5424
213 Ga0495651_0027872 3300046462 Bacteria 4402
214 Ga0495653_0014636 3300046463 Bacteria 6400
215 Ga0495653_0084398 3300046463 Bacteria 2339
216 Ga0495580_0001110 3300046472 Bacteria 23651
217 Ga0495580_0106014 3300046472 Bacteria 1952
218 Ga0495580_0227258 3300046472 Bacteria 1282
219 Ga0495582_0034083 3300046473 Bacteria 2799
220 Ga0495582_0123499 3300046473 Bacteria 1460
221 Ga0495662_0048597 3300046476 Bacteria 2049
222 Ga0495585_0093691 3300046492 Bacteria 1615
223 Ga0495594_0115398 3300046499 Bacteria 1516
224 Ga0495608_0125343 3300046511 Bacteria 1645
225 Ga0495618_0086611 3300046514 Bacteria 2003
226 Ga0495640_0020509 3300046533 Bacteria 4863
227 Ga0495587_0049210 3300046536 Bacteria 2495
228 Ga0495633_0086353 3300046558 Bacteria 1459
229 Ga0495667_0001978 3300046559 Bacteria 13569
230 Ga0495667_0015635 3300046559 Bacteria 5131
231 Ga0495656_0047740 3300046615 Bacteria 1817
232 Ga0495635_0007242 3300046663 Bacteria 7750
233 Ga0495635_0057604 3300046663 Bacteria 2673
234 Ga0495588_0186397 3300046674 Bacteria 1096
235 Ga0495657_0054205 3300046675 Bacteria 2680
236 Ga0495646_0103849 3300046680 Bacteria 1626
237 Ga0495613_0088757 3300046689 Bacteria 2240
238 Ga0495624_0049666 3300046690 Bacteria 2660
239 Ga0495600_0003914 3300046809 Bacteria 8844
240 Ga0495600_0015204 3300046809 Bacteria 4862
241 Ga0495604_0013125 3300047317 Bacteria 6599
242 Ga0495604_0119192 3300047317 Bacteria 1912
243 Ga0495674_0003473 3300047319 Bacteria 15315
244 Ga0495674_0018221 3300047319 Bacteria 6538
245 Ga0495676_0038445 3300047321 Bacteria 3974
246 Ga0495680_0051541 3300047322 Bacteria 3212
247 Ga0495675_0061505 3300047444 Bacteria 2378
248 Ga0495684_0002925 3300047471 Bacteria 13448
249 Ga0496102_0216964 3300048905 Bacteria 1803
250 Ga0496104_0118812 3300048907 Bacteria 2538
251 Ga0496108_0013560 3300048911 Bacteria 6652
252 Ga0496108_0294317 3300048911 Bacteria 1414
253 Ga0496112_0001872 3300048915 Bacteria 16588
254 Ga0496112_0131712 3300048915 Bacteria 2471
255 Ga0496112_0186051 3300048915 Bacteria 2040
256 Ga0496114_0240822 3300048917 Bacteria 1591
257 Ga0496115_0032078 3300048918 Bacteria 4143
258 Ga0496126_0050259 3300048929 Bacteria 3801
259 Ga0501031_0014274 3300049568 Bacteria 5166
260 Ga0501031_0105343 3300049568 Bacteria 1840
261 Ga0501032_0045222 3300049569 Bacteria 2979
262 Ga0501032_0058556 3300049569 Bacteria 2586
263 Ga0501032_0066297 3300049569 Bacteria 2413
264 Ga0501034_0237860 3300049571 Bacteria 1768
265 Ga0501034_0251181 3300049571 Bacteria 1713
266 Ga0501036_0009831 3300049572 Bacteria 7876
267 Ga0501036_0023954 3300049572 Bacteria 5146
268 Ga0501036_0321800 3300049572 Bacteria 1292
269 Ga0501037_0006441 3300049573 Bacteria 8592
270 Ga0501037_0086566 3300049573 Bacteria 2268
271 Ga0501037_0242392 3300049573 Bacteria 1263
272 Ga0501038_0001272 3300049574 Bacteria 22889
273 Ga0501038_0044585 3300049574 Bacteria 3851
274 Ga0501038_0048656 3300049574 Bacteria 3668
275 Ga0501038_0226794 3300049574 Bacteria 1488
276 Ga0501039_0003280 3300049575 Bacteria 12103
277 Ga0501039_0017530 3300049575 Bacteria 5493
278 Ga0501039_0048451 3300049575 Bacteria 3284
279 Ga0501040_0000441 3300049576 Bacteria 24703
280 Ga0501040_0006424 3300049576 Bacteria 7634
281 Ga0501040_0040975 3300049576 Bacteria 3154
282 Ga0501040_0059454 3300049576 Bacteria 2625
283 Ga0501041_0000713 3300049577 Bacteria 17644
284 Ga0501041_0004215 3300049577 Bacteria 8324
285 Ga0501042_0000559 3300049578 Bacteria 19677
286 Ga0501042_0005226 3300049578 Bacteria 8345
287 Ga0501042_0056608 3300049578 Bacteria 2798
288 Ga0501043_0014204 3300049579 Bacteria 6232
289 Ga0501043_0046497 3300049579 Bacteria 3413
290 Ga0501046_0008577 3300049580 Bacteria 8894
291 Ga0501046_0014701 3300049580 Bacteria 6591
292 Ga0501047_0184855 3300049581 Bacteria 1950
293 Ga0501048_0006427 3300049582 Bacteria 8932
294 Ga0501048_0021013 3300049582 Bacteria 4782
295 Ga0501048_0038998 3300049582 Bacteria 3409
296 Ga0501068_0018312 3300049584 Bacteria 4057
297 Ga0501068_0072473 3300049584 Bacteria 2103
298 Ga0501069_0033225 3300049585 Bacteria 2841
299 Ga0501070_0217415 3300049586 Bacteria 1568
300 Ga0501070_0231110 3300049586 Bacteria 1515
301 Ga0501071_0001695 3300049587 Bacteria 12930
302 Ga0501071_0005246 3300049587 Bacteria 8305
303 Ga0501071_0035354 3300049587 Bacteria 3559
304 Ga0501071_0070072 3300049587 Bacteria 2554
305 Ga0501072_0001024 3300049588 Bacteria 20714
306 Ga0501072_0005851 3300049588 Bacteria 9372
307 Ga0501072_0006626 3300049588 Bacteria 8814
308 Ga0501073_0101724 3300049589 Bacteria 1995
309 Ga0501074_0005803 3300049590 Bacteria 8901
310 Ga0501074_0066163 3300049590 Bacteria 2600
311 Ga0501074_0232390 3300049590 Bacteria 1312
312 Ga0501075_0001543 3300049591 Bacteria 15031
313 Ga0501075_0005629 3300049591 Bacteria 8568
314 Ga0501076_0000163 3300049592 Bacteria 38611
315 Ga0501076_0005879 3300049592 Bacteria 8848
316 Ga0501077_0000268 3300049593 Bacteria 30713
317 Ga0501077_0013724 3300049593 Bacteria 5078
318 Ga0501077_0014527 3300049593 Bacteria 4949
319 Ga0501077_0038596 3300049593 Bacteria 3041
320 Ga0501077_0106078 3300049593 Bacteria 1781
321 Ga0501077_0123591 3300049593 Bacteria 1640
322 Ga0501077_0137566 3300049593 Bacteria 1549
323 Ga0501079_0004394 3300049741 Bacteria 10437
324 Ga0501079_0065441 3300049741 Bacteria 2804
325 Ga0501080_0007908 3300049742 Bacteria 9632
326 Ga0501081_0003276 3300049743 Bacteria 10284
327 Ga0501081_0060579 3300049743 Bacteria 2622
328 Ga0501083_0028170 3300049744 Bacteria 3874
329 Ga0501083_0034681 3300049744 Bacteria 3450
330 Ga0501035_0011558 3300049822 Bacteria 8182
331 Ga0501035_0021350 3300049822 Bacteria 5951
332 Ga0501044_0003081 3300049823 Bacteria 18876
333 Ga0501044_0068956 3300049823 Bacteria 3601
334 Ga0501045_0005434 3300049824 Bacteria 8824
335 Ga0501045_0014104 3300049824 Bacteria 5659
336 nmdc:mga05p37_2032_c1 3300050507 Bacteria 23592
337 nmdc:mga05p37_22216_c1 3300050507 Bacteria 7692
338 nmdc:mga05p37_256218_c1 3300050507 Bacteria 1740
339 nmdc:mga05p37_33985_c1 3300050507 Bacteria 6246
340 nmdc:mga05p37_4451_c1 3300050507 Bacteria 16377
341 nmdc:mga0qj67_53125_c1 3300050509 Bacteria 3207
342 nmdc:mga06r32_146102_c1 3300050510 Bacteria 2342
343 nmdc:mga06r32_174048_c1 3300050510 Bacteria 2137
344 nmdc:mga08y16_108831_c1 3300050511 Bacteria 2885
345 nmdc:mga08y16_25384_c1 3300050511 Bacteria 6249
346 nmdc:mga0n895_1361_c1 3300050512 Bacteria 18174
347 nmdc:mga0n895_28535_c1 3300050512 Bacteria 5309
348 nmdc:mga0n895_49683_c1 3300050512 Bacteria 4111
349 nmdc:mga0n895_84117_c1 3300050512 Bacteria 3175
350 nmdc:mga0rr50_13123_c1 3300050513 Bacteria 5382
351 nmdc:mga0rr50_133899_c1 3300050513 Bacteria 1987
352 nmdc:mga0rr50_150388_c1 3300050513 Bacteria 1881
353 nmdc:mga0rr50_304561_c1 3300050513 Bacteria 1333
354 nmdc:mga0rr50_64682_c1 3300050513 Bacteria 2768
355 nmdc:mga08x19_28295_c1 3300050514 Bacteria 3509
356 nmdc:mga08x19_3822_c1 3300050514 Bacteria 8961
357 nmdc:mga0a205_18155_c1 3300050515 Bacteria 6608
358 nmdc:mga0a205_464945_c1 3300050515 Bacteria 1124
359 nmdc:mga0a205_48525_c1 3300050515 Bacteria 4097
360 Ga0495601_0074068 3300053077 Bacteria 2178
361 Ga0495612_0027733 3300053078 Bacteria 2278
362 Ga0495595_0008496 3300053084 Bacteria 4216
363 Ga0495619_0006327 3300053085 Bacteria 7512
364 Ga0495619_0007654 3300053085 Bacteria 6839
365 Ga0495619_0024113 3300053085 Bacteria 3901
366 Ga0501084_0023161 3300054114 Bacteria 5184
367 Ga0501082_0000530 3300060353 Bacteria 33956
368 Ga0501082_0008482 3300060353 Bacteria 8861
369 Ga0501082_0018322 3300060353 Bacteria 6029
370 Ga0501082_0179700 3300060353 Bacteria 1840
371 Ga0530510_0000321 3300061734 Bacteria 30942
372 Ga0530510_0000336 3300061734 Bacteria 30243
373 Ga0530510_0005348 3300061734 Bacteria 8879
374 Ga0530510_0088703 3300061734 Bacteria 2255
375 Ga0530510_0169479 3300061734 Bacteria 1617
376 Ga0530510_0329679 3300061734 Bacteria 1145
377 2891049351 2891048133 Bacteria 4447501
378 8054564934 8054563764 Bacteria 5592885
379 Ga0081455_10079685
380 JGI25405J52794_10000699
381 Ga0065707_10086729
382 Ga0070658_10084496
383 Ga0070683_100001328
384 Ga0070683_100056490
385 Ga0068869_100033363
386 Ga0070680_100045212
387 Ga0070680_100057584
388 Ga0070689_100109072
389 Ga0070691_10002077
390 Ga0070709_10006286
391 Ga0070714_100045787
392 Ga0070714_100069399
393 Ga0070713_100001368
394 Ga0070713_100052575
395 Ga0070713_100067841
396 Ga0070713_100275026
397 Ga0070701_10007158
398 Ga0070708_100000360
399 Ga0070708_100001590
400 Ga0070708_100029840
401 Ga0070708_100265516
402 Ga0070662_100093677
403 Ga0070662_100307485
404 Ga0070681_10198615
405 Ga0070706_100002772
406 Ga0070706_100007607
407 Ga0070706_100012536
408 Ga0070706_100055539
409 Ga0070706_100082533
410 Ga0070706_100241784
411 Ga0070707_100000360
412 Ga0070707_100003435
413 Ga0070707_100012667
414 Ga0070707_100022221
415 Ga0070707_100032472
416 Ga0070707_100054663
417 Ga0070707_100315944
418 Ga0070698_100004091
419 Ga0070698_100011720
420 Ga0070698_100065230
421 Ga0070698_100230116
422 Ga0070698_100263349
423 Ga0070698_100309101
424 Ga0070698_100408693
425 Ga0070699_100000026
426 Ga0070699_100001534
427 Ga0070699_100002828
428 Ga0070699_100016578
429 Ga0070679_100084037
430 Ga0070684_100001025
431 Ga0070684_100110182
432 Ga0070697_100000158
433 Ga0070697_100015928
434 Ga0070697_100329583
435 Ga0070696_100147185
436 Ga0070704_100114067
437 Ga0070704_100158391
438 Ga0068857_100000247
439 Ga0068857_100004323
440 Ga0068857_100101559
441 Ga0068856_100009190
442 Ga0068859_100359114
443 Ga0068859_100389755
444 Ga0068870_10087619
445 Ga0068860_100145622
446 Ga0081455_10001216
447 Ga0081455_10003829
448 Ga0081538_10000017
449 Ga0081538_10002234
450 Ga0081538_10104959
451 Ga0070717_10070883
452 Ga0070717_10080036
453 Ga0070717_10165736
454 Ga0070717_10286544
455 Ga0070715_10076061
456 Ga0075428_100040453
457 Ga0075428_100253862
458 Ga0075430_100031737
459 Ga0075430_100061094
460 Ga0075431_100507930
461 Ga0075433_10024968
462 Ga0075433_10065339
463 Ga0075434_100006893
464 Ga0075434_100007907
465 Ga0075434_100074576
466 Ga0075434_100208032
467 Ga0075429_100326117
468 Ga0075436_100012669
469 Ga0075436_100148814
470 Ga0097620_100359109
471 Ga0097620_100389752
472 Ga0075435_100013230
473 Ga0075435_100057787
474 Ga0099794_10000198
475 Ga0099794_10032256
476 Ga0099794_10042609
477 Ga0105240_10010455
478 Ga0111539_10065363
479 Ga0111539_10136168
480 Ga0111539_10298966
481 Ga0114129_10003443
482 Ga0114129_10009036
483 Ga0114129_10028105
484 Ga0114129_10107315
485 Ga0105242_10194700
486 Ga0157371_10130834
487 Ga0157369_10001540
488 Ga0157378_10054973
489 Ga0157372_10309268
490 Ga0157372_10365924
491 Ga0213874_10002352
492 Ga0213875_10055609
493 Ga0224712_10048660
494 Ga0207653_10026157
495 Ga0207699_10005200
496 Ga0207705_10138248
497 Ga0207684_10001690
498 Ga0207684_10002343
499 Ga0207684_10002697
500 Ga0207684_10003371
501 Ga0207684_10202130
502 Ga0207707_10003077
503 Ga0207695_10044615
504 Ga0207660_10123894
505 Ga0207652_10055538
506 Ga0207652_10199671
507 Ga0207646_10000538
508 Ga0207646_10000962
509 Ga0207646_10011631
510 Ga0207646_10041098
511 Ga0207646_10046049
512 Ga0207646_10180463
513 Ga0207646_10271727
514 Ga0207700_10017184
515 Ga0207700_10040131
516 Ga0207700_10085430
517 Ga0207700_10100858
518 Ga0207670_10103695
519 Ga0207661_10000102
520 Ga0207661_10413264
521 Ga0207712_10103505
522 Ga0207712_10170539
523 Ga0207678_10125836
524 Ga0207702_10002513
525 Ga0207674_10000194
526 Ga0207674_10001068
527 Ga0207674_10115985
528 Ga0210000_1001970
529 Ga0209179_1015372
530 Ga0209588_1000101
531 Ga0209588_1006570
532 Ga0209588_1018647
533 Ga0209998_10005664
534 Ga0207428_10147511
535 Ga0207428_10278475
536 Ga0265338_10008718
537 Ga0265338_10010302
538 Ga0265338_10079618
539 Ga0265338_10142120
540 Ga0265339_10014289
541 Ga0307408_100005942
542 Ga0307408_100402038
543 Ga0316578_10040821
544 Ga0307405_10013151
545 Ga0307405_10052487
546 Ga0307406_10029130
547 Ga0307407_10115094
548 Ga0307416_100013268
549 Ga0307416_100274633
550 Ga0307415_100208029
551 Ga0316583_10018660
552 Ga0373928_0013696
553 Ga0373954_0005053
554 Ga0373956_0000716
555 Ga0373943_0019439
556 Ga0373931_0065898
557 Ga0373935_0053929
558 Ga0373927_0000367
559 Ga0373933_0003991
560 Ga0373933_0010791
561 Ga0373947_0016847
562 Ga0373947_0017239
563 Ga0373937_0036540
564 Ga0373925_0043729
565 Ga0395899_0072920
566 Ga0395900_0023714
567 Ga0395900_0079053
568 Ga0395900_0174338
569 Ga0395898_0430347
570 Ga0395905_0170399
571 Ga0395905_0174374
572 Ga0395905_0209141
573 Ga0436364_0479765
574 Ga0436364_0862687
575 Ga0436364_1050032
576 Ga0436364_1249393
577 Ga0395901_0041314
578 Ga0395901_0140912
579 Ga0395901_0324089
580 Ga0436365_0145803
581 Ga0436363_0113512
582 Ga0453683_0000324
583 Ga0453683_0071908
584 Ga0466957_0052241
585 Ga0466957_0097274
586 Ga0451576_0047233
587 Ga0495592_0062893
588 Ga0495603_0067347
589 Ga0495629_0125764
590 Ga0495651_0018306
591 Ga0495651_0027872
592 Ga0495653_0014636
593 Ga0495653_0084398
594 Ga0495580_0001110
595 Ga0495580_0106014
596 Ga0495580_0227258
597 Ga0495582_0034083
598 Ga0495582_0123499
599 Ga0495662_0048597
600 Ga0495585_0093691
601 Ga0495594_0115398
602 Ga0495608_0125343
603 Ga0495618_0086611
604 Ga0495640_0020509
605 Ga0495587_0049210
606 Ga0495633_0086353
607 Ga0495667_0001978
608 Ga0495667_0015635
609 Ga0495656_0047740
610 Ga0495635_0007242
611 Ga0495635_0057604
612 Ga0495588_0186397
613 Ga0495657_0054205
614 Ga0495646_0103849
615 Ga0495613_0088757
616 Ga0495624_0049666
617 Ga0495600_0003914
618 Ga0495600_0015204
619 Ga0495604_0013125
620 Ga0495604_0119192
621 Ga0495674_0003473
622 Ga0495674_0018221
623 Ga0495676_0038445
624 Ga0495680_0051541
625 Ga0495675_0061505
626 Ga0495684_0002925
627 Ga0496102_0216964
628 Ga0496104_0118812
629 Ga0496108_0013560
630 Ga0496108_0294317
631 Ga0496112_0001872
632 Ga0496112_0131712
633 Ga0496112_0186051
634 Ga0496114_0240822
635 Ga0496115_0032078
636 Ga0496126_0050259
637 Ga0501031_0014274
638 Ga0501031_0105343
639 Ga0501032_0045222
640 Ga0501032_0058556
641 Ga0501032_0066297
642 Ga0501034_0237860
643 Ga0501034_0251181
644 Ga0501036_0009831
645 Ga0501036_0023954
646 Ga0501036_0321800
647 Ga0501037_0006441
648 Ga0501037_0086566
649 Ga0501037_0242392
650 Ga0501038_0001272
651 Ga0501038_0044585
652 Ga0501038_0048656
653 Ga0501038_0226794
654 Ga0501039_0003280
655 Ga0501039_0017530
656 Ga0501039_0048451
657 Ga0501040_0000441
658 Ga0501040_0006424
659 Ga0501040_0040975
660 Ga0501040_0059454
661 Ga0501041_0000713
662 Ga0501041_0004215
663 Ga0501042_0000559
664 Ga0501042_0005226
665 Ga0501042_0056608
666 Ga0501043_0014204
667 Ga0501043_0046497
668 Ga0501046_0008577
669 Ga0501046_0014701
670 Ga0501047_0184855
671 Ga0501048_0006427
672 Ga0501048_0021013
673 Ga0501048_0038998
674 Ga0501068_0018312
675 Ga0501068_0072473
676 Ga0501069_0033225
677 Ga0501070_0217415
678 Ga0501070_0231110
679 Ga0501071_0001695
680 Ga0501071_0005246
681 Ga0501071_0035354
682 Ga0501071_0070072
683 Ga0501072_0001024
684 Ga0501072_0005851
685 Ga0501072_0006626
686 Ga0501073_0101724
687 Ga0501074_0005803
688 Ga0501074_0066163
689 Ga0501074_0232390
690 Ga0501075_0001543
691 Ga0501075_0005629
692 Ga0501076_0000163
693 Ga0501076_0005879
694 Ga0501077_0000268
695 Ga0501077_0013724
696 Ga0501077_0014527
697 Ga0501077_0038596
698 Ga0501077_0106078
699 Ga0501077_0123591
700 Ga0501077_0137566
701 Ga0501079_0004394
702 Ga0501079_0065441
703 Ga0501080_0007908
704 Ga0501081_0003276
705 Ga0501081_0060579
706 Ga0501083_0028170
707 Ga0501083_0034681
708 Ga0501035_0011558
709 Ga0501035_0021350
710 Ga0501044_0003081
711 Ga0501044_0068956
712 Ga0501045_0005434
713 Ga0501045_0014104
714 nmdc:mga05p37_2032_c1
715 nmdc:mga05p37_22216_c1
716 nmdc:mga05p37_256218_c1
717 nmdc:mga05p37_33985_c1
718 nmdc:mga05p37_4451_c1
719 nmdc:mga0qj67_53125_c1
720 nmdc:mga06r32_146102_c1
721 nmdc:mga06r32_174048_c1
722 nmdc:mga08y16_108831_c1
723 nmdc:mga08y16_25384_c1
724 nmdc:mga0n895_1361_c1
725 nmdc:mga0n895_28535_c1
726 nmdc:mga0n895_49683_c1
727 nmdc:mga0n895_84117_c1
728 nmdc:mga0rr50_13123_c1
729 nmdc:mga0rr50_133899_c1
730 nmdc:mga0rr50_150388_c1
731 nmdc:mga0rr50_304561_c1
732 nmdc:mga0rr50_64682_c1
733 nmdc:mga08x19_28295_c1
734 nmdc:mga08x19_3822_c1
735 nmdc:mga0a205_18155_c1
736 nmdc:mga0a205_464945_c1
737 nmdc:mga0a205_48525_c1
738 Ga0495601_0074068
739 Ga0495612_0027733
740 Ga0495595_0008496
741 Ga0495619_0006327
742 Ga0495619_0007654
743 Ga0495619_0024113
744 Ga0501084_0023161
745 Ga0501082_0000530
746 Ga0501082_0008482
747 Ga0501082_0018322
748 Ga0501082_0179700
749 Ga0530510_0000321
750 Ga0530510_0000336
751 Ga0530510_0005348
752 Ga0530510_0088703
753 Ga0530510_0169479
754 Ga0530510_0329679
755 2891049351
756 8054564934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02780

Transketolase_C

Transketolase, C-terminal domain

251

373

0.98

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

119

238

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cer-assembly1.cif.gz_D human pyruvate dehydrogenase complex e1 component v138m mutation 0.9606 14 338
1ik6-assembly1.cif.gz_A 3d structure of the e1beta subunit of pyruvate dehydrogenase from the archeon pyrobaculum aerophilum 0.9498 12 338
3duf-assembly2.cif.gz_H snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex 0.9484 16 338
1umd-assembly1.cif.gz_D branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate 0.9481 16 338
1w88-assembly2.cif.gz_F the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9468 16 338
ID Description Score Start End Superfamily
af_B4FUC1_232_362_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9621 206 337 3.40.50.920
1w85B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9537 206 338 3.40.50.920
af_E5RPJ6_273_405_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9483 206 337 3.40.50.920
af_B4FUC1_232_362_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9479 206 337 3.40.50.920
1ik6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.947 14 198 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7X6EMC4-F1-model_v4 deleted 0.9752 200 292
AF-A0A3D1ZMS7-F1-model_v4 Transketolase C-terminal domain-containing protein 0.9701 171 335 GO:0003824
AF-A0A6N7FA51-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9688 145 337 GO:0003824
AF-A0A2T4S6S0-F1-model_v4 Pyruvate dehydrogenase E1 component subunit beta 0.9677 149 338 GO:0003824
AF-K0ZXG6-F1-model_v4 deleted 0.9667 21 270

Map