F427938

General Info

Members Datasets Scaffolds Average Seq Length
378 246 756 131

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101020125|Ga0070713_1010201252
Length 144
Sequence MLTKFSGEVKAMTIATEKTIGITRLGQIQVPTHDVERAANFYEQVLGLKLLFKAPPGLAFFDCGGVRLMLDRPEKPEFDHPSSILYFAVPDIQAAHAAMKDKGVKFEDEPHLIARMPDHDLWMTFFRDSEGNLLGLMSEVKSQS

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
107 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
108 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
109 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
166 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
177 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
237 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 2.38
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 26.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_101020125 3300005436 Unclassified 798
2 JGI24738J21930_10075213 3300002075 Unclassified 703
3 JGI24034J26672_10006798 3300002239 Bacteria 1654
4 JGI24751J29686_10000754 3300002459 Bacteria 7715
5 Ga0065715_10119474 3300005293 Bacteria 2285
6 Ga0065707_10097993 3300005295 Bacteria 3122
7 Ga0065707_10710441 3300005295 Unclassified 635
8 Ga0070658_10758876 3300005327 Bacteria 842
9 Ga0070683_100000242 3300005329 Bacteria 37383
10 Ga0070690_100211500 3300005330 Unclassified 1354
11 Ga0070670_100026180 3300005331 Bacteria 5021
12 Ga0070677_10417719 3300005333 Unclassified 711
13 Ga0068869_100998585 3300005334 Bacteria 728
14 Ga0070666_10044369 3300005335 Bacteria 2977
15 Ga0070666_10343573 3300005335 Unclassified 1067
16 Ga0070680_100167676 3300005336 Bacteria 1847
17 Ga0070682_100036477 3300005337 Bacteria 3006
18 Ga0068868_100481339 3300005338 Unclassified 1084
19 Ga0070660_100015584 3300005339 Bacteria 5492
20 Ga0070689_100001786 3300005340 Bacteria 13813
21 Ga0070687_100003469 3300005343 Bacteria 6130
22 Ga0070661_100020403 3300005344 Bacteria 4725
23 Ga0070668_100011472 3300005347 Bacteria 6597
24 Ga0070669_100393585 3300005353 Bacteria 1132
25 Ga0070675_100018915 3300005354 Bacteria 5487
26 Ga0070671_100370945 3300005355 Unclassified 1222
27 Ga0070673_100007875 3300005364 Bacteria 7060
28 Ga0070688_100000768 3300005365 Bacteria 15844
29 Ga0070659_100033045 3300005366 Bacteria 4017
30 Ga0070667_100213585 3300005367 Bacteria 1715
31 Ga0070709_10007917 3300005434 Bacteria 5836
32 Ga0070709_10024888 3300005434 Bacteria 3529
33 Ga0070709_10045255 3300005434 Bacteria 2730
34 Ga0070709_10124299 3300005434 Bacteria 1753
35 Ga0070709_10253402 3300005434 Unclassified 1269
36 Ga0070709_10398202 3300005434 Bacteria 1027
37 Ga0070709_11807071 3300005434 Unclassified 500
38 Ga0070714_100012233 3300005435 Bacteria 6845
39 Ga0070714_100525537 3300005435 Bacteria 1131
40 Ga0070714_100812761 3300005435 Bacteria 906
41 Ga0070714_100858479 3300005435 Unclassified 880
42 Ga0070714_101270296 3300005435 Bacteria 719
43 Ga0070714_101519657 3300005435 Bacteria 654
44 Ga0070713_100000574 3300005436 Bacteria 23325
45 Ga0070713_100006737 3300005436 Bacteria 8001
46 Ga0070713_100284466 3300005436 Bacteria 1518
47 Ga0070713_100363103 3300005436 Unclassified 1346
48 Ga0070713_100482056 3300005436 Bacteria 1168
49 Ga0070713_100855639 3300005436 Bacteria 873
50 Ga0070713_101606970 3300005436 Bacteria 631
51 Ga0070710_10001087 3300005437 Bacteria 12871
52 Ga0070710_10055622 3300005437 Unclassified 2237
53 Ga0070710_10399513 3300005437 Unclassified 921
54 Ga0070710_10708200 3300005437 Bacteria 711
55 Ga0070711_100000689 3300005439 Bacteria 17727
56 Ga0070711_101694112 3300005439 Unclassified 554
57 Ga0070705_100892051 3300005440 Unclassified 714
58 Ga0070700_100376154 3300005441 Bacteria 1061
59 Ga0070694_100985225 3300005444 Bacteria 699
60 Ga0070663_100002172 3300005455 Bacteria 10969
61 Ga0070663_100058190 3300005455 Bacteria 2775
62 Ga0070662_100035478 3300005457 Bacteria 3522
63 Ga0070681_10011653 3300005458 Bacteria 8706
64 Ga0068867_100038369 3300005459 Bacteria 3487
65 Ga0070685_10000904 3300005466 Bacteria 15937
66 Ga0070698_101370013 3300005471 Bacteria 658
67 Ga0070679_100181305 3300005530 Unclassified 2078
68 Ga0070684_100002766 3300005535 Bacteria 12983
69 Ga0068853_100004588 3300005539 Bacteria 10716
70 Ga0068853_100270216 3300005539 Bacteria 1565
71 Ga0070672_100049665 3300005543 Bacteria 3265
72 Ga0070695_100288658 3300005545 Bacteria 1208
73 Ga0070696_100227257 3300005546 Unclassified 1403
74 Ga0070693_100044172 3300005547 Unclassified 2520
75 Ga0070665_100027705 3300005548 Bacteria 5704
76 Ga0068855_100358851 3300005563 Bacteria 1604
77 Ga0068855_100713941 3300005563 Bacteria 1072
78 Ga0070664_100210750 3300005564 Bacteria 1736
79 Ga0068857_100000434 3300005577 Bacteria 29562
80 Ga0068854_100010161 3300005578 Bacteria 6098
81 Ga0068856_100005987 3300005614 Bacteria 11971
82 Ga0068856_100016115 3300005614 Bacteria 7225
83 Ga0068856_100215940 3300005614 Bacteria 1933
84 Ga0068856_100904286 3300005614 Unclassified 902
85 Ga0070702_100007134 3300005615 Bacteria 5337
86 Ga0068852_100253625 3300005616 Bacteria 1686
87 Ga0068852_100534519 3300005616 Unclassified 1171
88 Ga0068859_100295695 3300005617 Bacteria 1712
89 Ga0068864_100007470 3300005618 Bacteria 9002
90 Ga0068866_10002773 3300005718 Bacteria 7227
91 Ga0068851_10127825 3300005834 Unclassified 1371
92 Ga0068870_10017111 3300005840 Bacteria 3478
93 Ga0068863_100238687 3300005841 Bacteria 1754
94 Ga0068863_100274206 3300005841 Bacteria 1633
95 Ga0068863_101097169 3300005841 Bacteria 800
96 Ga0068858_100185284 3300005842 Bacteria 1966
97 Ga0068858_101167479 3300005842 Unclassified 756
98 Ga0068862_100166730 3300005844 Bacteria 1969
99 Ga0070717_10015373 3300006028 Bacteria 5912
100 Ga0070717_10023410 3300006028 Bacteria 4893
101 Ga0070717_10113472 3300006028 Unclassified 2314
102 Ga0070717_10234029 3300006028 Bacteria 1618
103 Ga0070717_10366370 3300006028 Bacteria 1291
104 Ga0070717_10470306 3300006028 Bacteria 1134
105 Ga0070717_11060016 3300006028 Unclassified 738
106 Ga0070715_10536217 3300006163 Bacteria 676
107 Ga0070716_100005887 3300006173 Bacteria 5964
108 Ga0070716_100281270 3300006173 Bacteria 1148
109 Ga0070716_100355748 3300006173 Bacteria 1038
110 Ga0070712_100000817 3300006175 Bacteria 18486
111 Ga0070712_100064726 3300006175 Bacteria 2593
112 Ga0070712_100565480 3300006175 Unclassified 959
113 Ga0070712_101185981 3300006175 Unclassified 664
114 Ga0070712_101538727 3300006175 Unclassified 581
115 Ga0097621_100026313 3300006237 Bacteria 4562
116 Ga0097621_101534619 3300006237 Unclassified 632
117 Ga0068871_100799410 3300006358 Bacteria 869
118 Ga0075431_101120938 3300006847 Bacteria 751
119 Ga0075434_100867970 3300006871 Unclassified 918
120 Ga0068865_101633413 3300006881 Unclassified 580
121 Ga0075436_100003957 3300006914 Bacteria 10154
122 Ga0075436_100009944 3300006914 Bacteria 6507
123 Ga0075436_100093207 3300006914 Bacteria 2094
124 Ga0097620_100295710 3300006931 Bacteria 1712
125 Ga0075435_100770561 3300007076 Unclassified 837
126 Ga0075435_100860403 3300007076 Bacteria 790
127 Ga0099795_10015371 3300007788 Bacteria 2396
128 Ga0099795_10027875 3300007788 Unclassified 1915
129 Ga0105251_10069534 3300009011 Bacteria 1641
130 Ga0105250_10016299 3300009092 Bacteria 3030
131 Ga0105240_10002945 3300009093 Bacteria 26849
132 Ga0105240_10047218 3300009093 Bacteria 5450
133 Ga0105240_10059476 3300009093 Bacteria 4769
134 Ga0105240_11761470 3300009093 Unclassified 646
135 Ga0111539_10740639 3300009094 Unclassified 1144
136 Ga0105245_10001967 3300009098 Bacteria 18660
137 Ga0105245_10139970 3300009098 Unclassified 2278
138 Ga0105247_10087019 3300009101 Bacteria 1978
139 Ga0105241_10005867 3300009174 Bacteria 9068
140 Ga0105241_10018288 3300009174 Bacteria 5154
141 Ga0105241_10246815 3300009174 Unclassified 1512
142 Ga0105242_10004860 3300009176 Bacteria 10400
143 Ga0105242_10365193 3300009176 Bacteria 1337
144 Ga0105248_10269808 3300009177 Bacteria 1916
145 Ga0105237_10023740 3300009545 Bacteria 6278
146 Ga0105237_10230374 3300009545 Bacteria 1853
147 Ga0105237_10695046 3300009545 Archaea 1024
148 Ga0105238_10015493 3300009551 Bacteria 7716
149 Ga0105249_10077185 3300009553 Bacteria 3089
150 Ga0105239_10003087 3300010375 Bacteria 20677
151 Ga0105239_10069656 3300010375 Bacteria 3864
152 Ga0105246_10000221 3300011119 Bacteria 28982
153 Ga0157339_1044092 3300012505 Unclassified 569
154 Ga0157373_10039398 3300013100 Bacteria 3383
155 Ga0157373_10992957 3300013100 Unclassified 626
156 Ga0157371_10019389 3300013102 Bacteria 5017
157 Ga0157369_10077222 3300013105 Bacteria 3569
158 Ga0157369_10844345 3300013105 Unclassified 940
159 Ga0157369_11425356 3300013105 Bacteria 705
160 Ga0157374_10083190 3300013296 Unclassified 3040
161 Ga0157378_10125592 3300013297 Bacteria 2369
162 Ga0163162_10209243 3300013306 Bacteria 2080
163 Ga0157372_10010223 3300013307 Bacteria 9963
164 Ga0157372_10046211 3300013307 Bacteria 4833
165 Ga0157372_10116746 3300013307 Unclassified 3060
166 Ga0157372_10965123 3300013307 Unclassified 988
167 Ga0157372_11306801 3300013307 Unclassified 837
168 Ga0157372_11776447 3300013307 Bacteria 709
169 Ga0163163_10000558 3300014325 Bacteria 32720
170 Ga0157380_10069633 3300014326 Bacteria 2840
171 Ga0157377_10001730 3300014745 Bacteria 9527
172 Ga0157379_10441906 3300014968 Bacteria 1199
173 Ga0157376_10005863 3300014969 Bacteria 8618
174 Ga0157376_10070266 3300014969 Bacteria 2971
175 Ga0163161_10002695 3300017792 Bacteria 12625
176 Ga0224570_102504 3300022730 Unclassified 1225
177 Ga0224569_102496 3300022732 Unclassified 1489
178 Ga0224572_1005193 3300024225 Bacteria 2311
179 Ga0224572_1006673 3300024225 Bacteria 2093
180 Ga0224572_1009137 3300024225 Bacteria 1845
181 Ga0228598_1000639 3300024227 Bacteria 7368
182 Ga0228598_1009040 3300024227 Bacteria 2002
183 Ga0228598_1016147 3300024227 Unclassified 1473
184 Ga0228598_1078474 3300024227 Unclassified 661
185 Ga0207697_10003711 3300025315 Bacteria 7473
186 Ga0207656_10137005 3300025321 Bacteria 1151
187 Ga0207682_10339731 3300025893 Unclassified 707
188 Ga0207692_10000544 3300025898 Bacteria 13356
189 Ga0207692_10131993 3300025898 Bacteria 1411
190 Ga0207642_10008902 3300025899 Bacteria 3468
191 Ga0207710_10380178 3300025900 Unclassified 723
192 Ga0207688_10009037 3300025901 Bacteria 5424
193 Ga0207680_10113708 3300025903 Unclassified 1760
194 Ga0207680_10318935 3300025903 Unclassified 1086
195 Ga0207647_10010789 3300025904 Bacteria 6431
196 Ga0207699_10006063 3300025906 Bacteria 5821
197 Ga0207699_10020440 3300025906 Bacteria 3550
198 Ga0207699_10147951 3300025906 Bacteria 1551
199 Ga0207699_10182500 3300025906 Bacteria 1411
200 Ga0207645_10005903 3300025907 Bacteria 8822
201 Ga0207643_10001092 3300025908 Bacteria 16068
202 Ga0207705_10014101 3300025909 Bacteria 5758
203 Ga0207654_10125802 3300025911 Bacteria 1616
204 Ga0207654_10199476 3300025911 Bacteria 1317
205 Ga0207707_10020121 3300025912 Bacteria 5825
206 Ga0207707_11142937 3300025912 Bacteria 633
207 Ga0207695_10000298 3300025913 Bacteria 123027
208 Ga0207695_10017487 3300025913 Bacteria 8344
209 Ga0207695_10275008 3300025913 Bacteria 1579
210 Ga0207693_10001304 3300025915 Bacteria 22111
211 Ga0207693_10004797 3300025915 Bacteria 11373
212 Ga0207693_10110803 3300025915 Bacteria 2152
213 Ga0207693_10463354 3300025915 Unclassified 990
214 Ga0207663_10000544 3300025916 Bacteria 16576
215 Ga0207663_10681142 3300025916 Unclassified 813
216 Ga0207662_10065443 3300025918 Bacteria 2189
217 Ga0207657_10003823 3300025919 Bacteria 15991
218 Ga0207649_10000430 3300025920 Bacteria 30543
219 Ga0207652_10083495 3300025921 Bacteria 2797
220 Ga0207681_10167217 3300025923 Bacteria 1663
221 Ga0207694_10036218 3300025924 Bacteria 3787
222 Ga0207650_10000063 3300025925 Bacteria 146432
223 Ga0207659_10296127 3300025926 Bacteria 1327
224 Ga0207687_10066762 3300025927 Bacteria 2557
225 Ga0207687_10305481 3300025927 Unclassified 1283
226 Ga0207700_10008160 3300025928 Bacteria 6468
227 Ga0207700_10044623 3300025928 Unclassified 3265
228 Ga0207700_10090597 3300025928 Bacteria 2414
229 Ga0207700_10428517 3300025928 Bacteria 1163
230 Ga0207700_10552316 3300025928 Bacteria 1022
231 Ga0207700_11319869 3300025928 Bacteria 643
232 Ga0207664_10000320 3300025929 Bacteria 35727
233 Ga0207664_10010051 3300025929 Bacteria 6668
234 Ga0207664_10305049 3300025929 Bacteria 1401
235 Ga0207664_10482603 3300025929 Bacteria 1109
236 Ga0207664_11931698 3300025929 Unclassified 513
237 Ga0207644_10008649 3300025931 Bacteria 6658
238 Ga0207690_10018979 3300025932 Bacteria 4222
239 Ga0207706_10001575 3300025933 Bacteria 22616
240 Ga0207686_10179489 3300025934 Unclassified 1500
241 Ga0207704_10353933 3300025938 Unclassified 1144
242 Ga0207665_10008556 3300025939 Bacteria 6735
243 Ga0207665_10082604 3300025939 Unclassified 2214
244 Ga0207665_10257595 3300025939 Unclassified 1291
245 Ga0207665_10714160 3300025939 Bacteria 788
246 Ga0207665_11104344 3300025939 Bacteria 632
247 Ga0207665_11609822 3300025939 Unclassified 515
248 Ga0207711_10298616 3300025941 Bacteria 1485
249 Ga0207711_11193810 3300025941 Bacteria 702
250 Ga0207689_10000199 3300025942 Bacteria 52878
251 Ga0207689_11064945 3300025942 Bacteria 682
252 Ga0207661_10000571 3300025944 Bacteria 23501
253 Ga0207679_10000809 3300025945 Bacteria 20286
254 Ga0207667_10197938 3300025949 Bacteria 2061
255 Ga0207651_10009054 3300025960 Bacteria 5418
256 Ga0207658_10268299 3300025986 Bacteria 1457
257 Ga0207677_10360452 3300026023 Unclassified 1221
258 Ga0207703_10228478 3300026035 Bacteria 1667
259 Ga0207703_10653315 3300026035 Unclassified 998
260 Ga0207639_10000006 3300026041 Bacteria 544415
261 Ga0207678_10000516 3300026067 Bacteria 34999
262 Ga0207678_10032232 3300026067 Bacteria 4567
263 Ga0207708_10219224 3300026075 Bacteria 1524
264 Ga0207702_10006430 3300026078 Bacteria 10136
265 Ga0207702_10009879 3300026078 Bacteria 8000
266 Ga0207702_10937919 3300026078 Unclassified 858
267 Ga0207641_10000361 3300026088 Bacteria 54249
268 Ga0207641_10328791 3300026088 Bacteria 1451
269 Ga0207648_10000403 3300026089 Bacteria 48140
270 Ga0207676_10000306 3300026095 Bacteria 41992
271 Ga0207674_10000034 3300026116 Bacteria 137337
272 Ga0207683_10001318 3300026121 Bacteria 22406
273 Ga0207698_10249399 3300026142 Bacteria 1623
274 Ga0209966_1021485 3300027695 Bacteria 1256
275 Ga0265356_1000003 3300028017 Bacteria 43423
276 Ga0265355_1000568 3300028036 Unclassified 2006
277 Ga0268266_10026261 3300028379 Bacteria 4956
278 Ga0268265_10004061 3300028380 Bacteria 10288
279 Ga0268264_10189410 3300028381 Bacteria 1874
280 Ga0265762_1000759 3300030760 Bacteria 5757
281 Ga0265762_1028393 3300030760 Bacteria 1054
282 Ga0265765_1000711 3300030879 Bacteria 2794
283 Ga0265760_10002109 3300031090 Bacteria 5824
284 Ga0265760_10008156 3300031090 Bacteria 2993
285 Ga0307405_10435930 3300031731 Bacteria 1035
286 Ga0307406_10760838 3300031901 Unclassified 814
287 Ga0307406_11246486 3300031901 Unclassified 647
288 Ga0307416_101397392 3300032002 Unclassified 806
289 Ga0307416_101487155 3300032002 Bacteria 783
290 Ga0316214_1009880 3300033545 Unclassified 1290
291 Ga0316212_1051158 3300033547 Bacteria 589
292 Ga0373936_0021119 3300035113 Unclassified 2531
293 Ga0373945_0009579 3300035116 Bacteria 3177
294 Ga0373953_0023024 3300035117 Bacteria 2355
295 Ga0373954_0017499 3300035118 Bacteria 3220
296 Ga0373956_0053744 3300035119 Bacteria 1814
297 Ga0373956_0283279 3300035119 Unclassified 789
298 Ga0373957_0262171 3300035120 Unclassified 728
299 Ga0373957_0502496 3300035120 Unclassified 528
300 Ga0373943_0000212 3300035170 Bacteria 23853
301 Ga0373946_0020594 3300035171 Bacteria 2550
302 Ga0373955_0017325 3300035172 Bacteria 3564
303 Ga0373955_0021718 3300035172 Bacteria 3244
304 Ga0373961_0170677 3300035241 Unclassified 752
305 Ga0373924_0036999 3300035410 Bacteria 1985
306 Ga0373935_0010971 3300035692 Bacteria 5442
307 Ga0373927_0000062 3300035695 Bacteria 77303
308 Ga0373927_0297589 3300035695 Unclassified 1062
309 Ga0373933_0007625 3300035724 Bacteria 5907
310 Ga0373933_0888973 3300035724 Unclassified 586
311 Ga0373947_0001513 3300035725 Bacteria 14265
312 Ga0373947_0224725 3300035725 Unclassified 1235
313 Ga0373937_0488509 3300036401 Bacteria 1170
314 Ga0373925_0001746 3300037068 Bacteria 18185
315 Ga0373925_0366990 3300037068 Unclassified 1171
316 Ga0436364_0766407 3300037853 Bacteria 643
317 Ga0436365_0034959 3300039437 Unclassified 526
318 Ga0436365_0319397 3300039437 Bacteria 1728
319 Ga0436360_0241318 3300039438 Unclassified 693
320 Ga0436360_0433174 3300039438 Bacteria 702
321 Ga0436363_0208302 3300039450 Unclassified 741
322 Ga0451807_0201500 3300041486 Bacteria 1941
323 Ga0451807_2552279 3300041486 Unclassified 1349
324 Ga0466966_0198930 3300044684 Bacteria 1213
325 Ga0466963_0385044 3300044694 Bacteria 989
326 Ga0466964_0041616 3300044706 Bacteria 1859
327 Ga0466968_0544185 3300044735 Unclassified 582
328 Ga0466959_0099266 3300045049 Unclassified 2085
329 Ga0466967_0077042 3300045976 Unclassified 3001
330 Ga0495629_0524785 3300046459 Bacteria 797
331 Ga0495653_0041723 3300046463 Bacteria 3580
332 Ga0495580_0013001 3300046472 Bacteria 6373
333 Ga0495580_0056413 3300046472 Bacteria 2766
334 Ga0495582_0096190 3300046473 Unclassified 1655
335 Ga0495664_0004937 3300046477 Bacteria 7300
336 Ga0495628_0479694 3300046516 Bacteria 900
337 Ga0495630_0370742 3300046517 Unclassified 1096
338 Ga0495644_0359682 3300046523 Unclassified 574
339 Ga0495665_0228123 3300046531 Bacteria 962
340 Ga0495669_0023538 3300046684 Unclassified 2682
341 Ga0495669_0254287 3300046684 Unclassified 844
342 Ga0495624_0726687 3300046690 Unclassified 589
343 Ga0495600_0828843 3300046809 Unclassified 550
344 Ga0495674_0022646 3300047319 Bacteria 5792
345 Ga0495684_0726299 3300047471 Bacteria 656
346 Ga0495593_0248774 3300047673 Unclassified 890
347 Ga0495593_0286996 3300047673 Unclassified 823
348 Ga0495602_0059572 3300048088 Bacteria 3332
349 Ga0495602_0401970 3300048088 Bacteria 977
350 Ga0495602_0508728 3300048088 Bacteria 841
351 Ga0496100_0598719 3300048903 Bacteria 856
352 Ga0496108_0000038 3300048911 Bacteria 149482
353 Ga0496109_0000082 3300048912 Bacteria 99164
354 Ga0496110_0046177 3300048913 Bacteria 3810
355 Ga0496111_0184197 3300048914 Unclassified 1552
356 Ga0496112_0000220 3300048915 Bacteria 36982
357 Ga0496113_0001335 3300048916 Bacteria 13661
358 Ga0501036_0482587 3300049572 Bacteria 1032
359 Ga0501039_0189661 3300049575 Bacteria 1617
360 Ga0501040_0888870 3300049576 Bacteria 645
361 Ga0501071_0594606 3300049587 Bacteria 851
362 Ga0501074_1226174 3300049590 Bacteria 526
363 Ga0501075_0431979 3300049591 Bacteria 1004
364 Ga0501076_1453743 3300049592 Bacteria 563
365 Ga0501247_042395 3300049677 Unclassified 654
366 Ga0501265_077843 3300049762 Unclassified 572
367 Ga0501045_0617467 3300049824 Bacteria 802
368 nmdc:mga05p37_8214_c1 3300050507 Bacteria 12345
369 nmdc:mga09592_434477_c1 3300050508 Bacteria 1133
370 nmdc:mga06r32_115729_c1 3300050510 Bacteria 2641
371 nmdc:mga06r32_1538938_c1 3300050510 Bacteria 605
372 nmdc:mga0n895_23984_c1 3300050512 Bacteria 5742
373 nmdc:mga08x19_126566_c1 3300050514 Bacteria 1716
374 nmdc:mga08x19_30360_c1 3300050514 Bacteria 3395
375 nmdc:mga08x19_919_c1 3300050514 Bacteria 18590
376 nmdc:mga0a205_354655_c1 3300050515 Bacteria 1334
377 Ga0500561_0105006 3300053137 Unclassified 850
378 Ga0530510_0419172 3300061734 Bacteria 1010
379 Ga0070713_101020125
380 JGI24738J21930_10075213
381 JGI24034J26672_10006798
382 JGI24751J29686_10000754
383 Ga0065715_10119474
384 Ga0065707_10097993
385 Ga0065707_10710441
386 Ga0070658_10758876
387 Ga0070683_100000242
388 Ga0070690_100211500
389 Ga0070670_100026180
390 Ga0070677_10417719
391 Ga0068869_100998585
392 Ga0070666_10044369
393 Ga0070666_10343573
394 Ga0070680_100167676
395 Ga0070682_100036477
396 Ga0068868_100481339
397 Ga0070660_100015584
398 Ga0070689_100001786
399 Ga0070687_100003469
400 Ga0070661_100020403
401 Ga0070668_100011472
402 Ga0070669_100393585
403 Ga0070675_100018915
404 Ga0070671_100370945
405 Ga0070673_100007875
406 Ga0070688_100000768
407 Ga0070659_100033045
408 Ga0070667_100213585
409 Ga0070709_10007917
410 Ga0070709_10024888
411 Ga0070709_10045255
412 Ga0070709_10124299
413 Ga0070709_10253402
414 Ga0070709_10398202
415 Ga0070709_11807071
416 Ga0070714_100012233
417 Ga0070714_100525537
418 Ga0070714_100812761
419 Ga0070714_100858479
420 Ga0070714_101270296
421 Ga0070714_101519657
422 Ga0070713_100000574
423 Ga0070713_100006737
424 Ga0070713_100284466
425 Ga0070713_100363103
426 Ga0070713_100482056
427 Ga0070713_100855639
428 Ga0070713_101606970
429 Ga0070710_10001087
430 Ga0070710_10055622
431 Ga0070710_10399513
432 Ga0070710_10708200
433 Ga0070711_100000689
434 Ga0070711_101694112
435 Ga0070705_100892051
436 Ga0070700_100376154
437 Ga0070694_100985225
438 Ga0070663_100002172
439 Ga0070663_100058190
440 Ga0070662_100035478
441 Ga0070681_10011653
442 Ga0068867_100038369
443 Ga0070685_10000904
444 Ga0070698_101370013
445 Ga0070679_100181305
446 Ga0070684_100002766
447 Ga0068853_100004588
448 Ga0068853_100270216
449 Ga0070672_100049665
450 Ga0070695_100288658
451 Ga0070696_100227257
452 Ga0070693_100044172
453 Ga0070665_100027705
454 Ga0068855_100358851
455 Ga0068855_100713941
456 Ga0070664_100210750
457 Ga0068857_100000434
458 Ga0068854_100010161
459 Ga0068856_100005987
460 Ga0068856_100016115
461 Ga0068856_100215940
462 Ga0068856_100904286
463 Ga0070702_100007134
464 Ga0068852_100253625
465 Ga0068852_100534519
466 Ga0068859_100295695
467 Ga0068864_100007470
468 Ga0068866_10002773
469 Ga0068851_10127825
470 Ga0068870_10017111
471 Ga0068863_100238687
472 Ga0068863_100274206
473 Ga0068863_101097169
474 Ga0068858_100185284
475 Ga0068858_101167479
476 Ga0068862_100166730
477 Ga0070717_10015373
478 Ga0070717_10023410
479 Ga0070717_10113472
480 Ga0070717_10234029
481 Ga0070717_10366370
482 Ga0070717_10470306
483 Ga0070717_11060016
484 Ga0070715_10536217
485 Ga0070716_100005887
486 Ga0070716_100281270
487 Ga0070716_100355748
488 Ga0070712_100000817
489 Ga0070712_100064726
490 Ga0070712_100565480
491 Ga0070712_101185981
492 Ga0070712_101538727
493 Ga0097621_100026313
494 Ga0097621_101534619
495 Ga0068871_100799410
496 Ga0075431_101120938
497 Ga0075434_100867970
498 Ga0068865_101633413
499 Ga0075436_100003957
500 Ga0075436_100009944
501 Ga0075436_100093207
502 Ga0097620_100295710
503 Ga0075435_100770561
504 Ga0075435_100860403
505 Ga0099795_10015371
506 Ga0099795_10027875
507 Ga0105251_10069534
508 Ga0105250_10016299
509 Ga0105240_10002945
510 Ga0105240_10047218
511 Ga0105240_10059476
512 Ga0105240_11761470
513 Ga0111539_10740639
514 Ga0105245_10001967
515 Ga0105245_10139970
516 Ga0105247_10087019
517 Ga0105241_10005867
518 Ga0105241_10018288
519 Ga0105241_10246815
520 Ga0105242_10004860
521 Ga0105242_10365193
522 Ga0105248_10269808
523 Ga0105237_10023740
524 Ga0105237_10230374
525 Ga0105237_10695046
526 Ga0105238_10015493
527 Ga0105249_10077185
528 Ga0105239_10003087
529 Ga0105239_10069656
530 Ga0105246_10000221
531 Ga0157339_1044092
532 Ga0157373_10039398
533 Ga0157373_10992957
534 Ga0157371_10019389
535 Ga0157369_10077222
536 Ga0157369_10844345
537 Ga0157369_11425356
538 Ga0157374_10083190
539 Ga0157378_10125592
540 Ga0163162_10209243
541 Ga0157372_10010223
542 Ga0157372_10046211
543 Ga0157372_10116746
544 Ga0157372_10965123
545 Ga0157372_11306801
546 Ga0157372_11776447
547 Ga0163163_10000558
548 Ga0157380_10069633
549 Ga0157377_10001730
550 Ga0157379_10441906
551 Ga0157376_10005863
552 Ga0157376_10070266
553 Ga0163161_10002695
554 Ga0224570_102504
555 Ga0224569_102496
556 Ga0224572_1005193
557 Ga0224572_1006673
558 Ga0224572_1009137
559 Ga0228598_1000639
560 Ga0228598_1009040
561 Ga0228598_1016147
562 Ga0228598_1078474
563 Ga0207697_10003711
564 Ga0207656_10137005
565 Ga0207682_10339731
566 Ga0207692_10000544
567 Ga0207692_10131993
568 Ga0207642_10008902
569 Ga0207710_10380178
570 Ga0207688_10009037
571 Ga0207680_10113708
572 Ga0207680_10318935
573 Ga0207647_10010789
574 Ga0207699_10006063
575 Ga0207699_10020440
576 Ga0207699_10147951
577 Ga0207699_10182500
578 Ga0207645_10005903
579 Ga0207643_10001092
580 Ga0207705_10014101
581 Ga0207654_10125802
582 Ga0207654_10199476
583 Ga0207707_10020121
584 Ga0207707_11142937
585 Ga0207695_10000298
586 Ga0207695_10017487
587 Ga0207695_10275008
588 Ga0207693_10001304
589 Ga0207693_10004797
590 Ga0207693_10110803
591 Ga0207693_10463354
592 Ga0207663_10000544
593 Ga0207663_10681142
594 Ga0207662_10065443
595 Ga0207657_10003823
596 Ga0207649_10000430
597 Ga0207652_10083495
598 Ga0207681_10167217
599 Ga0207694_10036218
600 Ga0207650_10000063
601 Ga0207659_10296127
602 Ga0207687_10066762
603 Ga0207687_10305481
604 Ga0207700_10008160
605 Ga0207700_10044623
606 Ga0207700_10090597
607 Ga0207700_10428517
608 Ga0207700_10552316
609 Ga0207700_11319869
610 Ga0207664_10000320
611 Ga0207664_10010051
612 Ga0207664_10305049
613 Ga0207664_10482603
614 Ga0207664_11931698
615 Ga0207644_10008649
616 Ga0207690_10018979
617 Ga0207706_10001575
618 Ga0207686_10179489
619 Ga0207704_10353933
620 Ga0207665_10008556
621 Ga0207665_10082604
622 Ga0207665_10257595
623 Ga0207665_10714160
624 Ga0207665_11104344
625 Ga0207665_11609822
626 Ga0207711_10298616
627 Ga0207711_11193810
628 Ga0207689_10000199
629 Ga0207689_11064945
630 Ga0207661_10000571
631 Ga0207679_10000809
632 Ga0207667_10197938
633 Ga0207651_10009054
634 Ga0207658_10268299
635 Ga0207677_10360452
636 Ga0207703_10228478
637 Ga0207703_10653315
638 Ga0207639_10000006
639 Ga0207678_10000516
640 Ga0207678_10032232
641 Ga0207708_10219224
642 Ga0207702_10006430
643 Ga0207702_10009879
644 Ga0207702_10937919
645 Ga0207641_10000361
646 Ga0207641_10328791
647 Ga0207648_10000403
648 Ga0207676_10000306
649 Ga0207674_10000034
650 Ga0207683_10001318
651 Ga0207698_10249399
652 Ga0209966_1021485
653 Ga0265356_1000003
654 Ga0265355_1000568
655 Ga0268266_10026261
656 Ga0268265_10004061
657 Ga0268264_10189410
658 Ga0265762_1000759
659 Ga0265762_1028393
660 Ga0265765_1000711
661 Ga0265760_10002109
662 Ga0265760_10008156
663 Ga0307405_10435930
664 Ga0307406_10760838
665 Ga0307406_11246486
666 Ga0307416_101397392
667 Ga0307416_101487155
668 Ga0316214_1009880
669 Ga0316212_1051158
670 Ga0373936_0021119
671 Ga0373945_0009579
672 Ga0373953_0023024
673 Ga0373954_0017499
674 Ga0373956_0053744
675 Ga0373956_0283279
676 Ga0373957_0262171
677 Ga0373957_0502496
678 Ga0373943_0000212
679 Ga0373946_0020594
680 Ga0373955_0017325
681 Ga0373955_0021718
682 Ga0373961_0170677
683 Ga0373924_0036999
684 Ga0373935_0010971
685 Ga0373927_0000062
686 Ga0373927_0297589
687 Ga0373933_0007625
688 Ga0373933_0888973
689 Ga0373947_0001513
690 Ga0373947_0224725
691 Ga0373937_0488509
692 Ga0373925_0001746
693 Ga0373925_0366990
694 Ga0436364_0766407
695 Ga0436365_0034959
696 Ga0436365_0319397
697 Ga0436360_0241318
698 Ga0436360_0433174
699 Ga0436363_0208302
700 Ga0451807_0201500
701 Ga0451807_2552279
702 Ga0466966_0198930
703 Ga0466963_0385044
704 Ga0466964_0041616
705 Ga0466968_0544185
706 Ga0466959_0099266
707 Ga0466967_0077042
708 Ga0495629_0524785
709 Ga0495653_0041723
710 Ga0495580_0013001
711 Ga0495580_0056413
712 Ga0495582_0096190
713 Ga0495664_0004937
714 Ga0495628_0479694
715 Ga0495630_0370742
716 Ga0495644_0359682
717 Ga0495665_0228123
718 Ga0495669_0023538
719 Ga0495669_0254287
720 Ga0495624_0726687
721 Ga0495600_0828843
722 Ga0495674_0022646
723 Ga0495684_0726299
724 Ga0495593_0248774
725 Ga0495593_0286996
726 Ga0495602_0059572
727 Ga0495602_0401970
728 Ga0495602_0508728
729 Ga0496100_0598719
730 Ga0496108_0000038
731 Ga0496109_0000082
732 Ga0496110_0046177
733 Ga0496111_0184197
734 Ga0496112_0000220
735 Ga0496113_0001335
736 Ga0501036_0482587
737 Ga0501039_0189661
738 Ga0501040_0888870
739 Ga0501071_0594606
740 Ga0501074_1226174
741 Ga0501075_0431979
742 Ga0501076_1453743
743 Ga0501247_042395
744 Ga0501265_077843
745 Ga0501045_0617467
746 nmdc:mga05p37_8214_c1
747 nmdc:mga09592_434477_c1
748 nmdc:mga06r32_115729_c1
749 nmdc:mga06r32_1538938_c1
750 nmdc:mga0n895_23984_c1
751 nmdc:mga08x19_126566_c1
752 nmdc:mga08x19_30360_c1
753 nmdc:mga08x19_919_c1
754 nmdc:mga0a205_354655_c1
755 Ga0500561_0105006
756 Ga0530510_0419172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

24

57

0.92

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

136

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8545 10 123
2i7r-assembly1.cif.gz_B conserved domain protein 0.8516 12 126
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8405 10 123
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8378 10 123
3ey8-assembly1.cif.gz_A structure from the mobile metagenome of v. pseudocholerae. vpc_cass1 0.8343 10 125
ID Description Score Start End Superfamily
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8605 12 125 3.10.180.10
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8465 12 125 3.10.180.10
af_Q09253_130_271_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8309 12 124 3.10.180.10
af_C6T374_10_137_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8302 14 128 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8264 14 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V7MXD9-F1-model_v4 Glyoxalase 0.976 12 130
AF-A0A5S4Z9L1-F1-model_v4 deleted 0.974 10 128
AF-A0A2V7XAT9-F1-model_v4 Glyoxalase 0.9738 9 131
AF-A0A1G0SVR9-F1-model_v4 VOC domain-containing protein 0.9728 10 130 GO:0004462
GO:0046872
AF-A0A4R2X421-F1-model_v4 deleted 0.972 10 128

Map