F427835

General Info

Members Datasets Scaffolds Average Seq Length
377 181 754 164

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0259871|Ga0501047_0259871_697_1278
Length 163
Sequence MQKEDKERVIADLTEKLRSSETMIVADYRGLTMPQIDGLRSRLIESGARFTVVKNTLTRRAAEAAGADALLALLEGPSAIAFVEADGDALADSARDTKVLAIRGGVMQGRVISGSDVEELAKLPPLDVLRGQVIGAIIAPLSESGAAAAPAAETTDESQEENE

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.1
Metatranscriptomes 6.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.55
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 2.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0259871 3300049581 Bacteria 1584
2 Ga0070658_10106439 3300005327 Bacteria 2320
3 Ga0070658_10221188 3300005327 Bacteria 1601
4 Ga0070683_100103147 3300005329 Bacteria 2687
5 Ga0070683_100126953 3300005329 Bacteria 2411
6 Ga0070683_100267389 3300005329 Bacteria 1626
7 Ga0070680_100312515 3300005336 Bacteria 1333
8 Ga0070680_100362079 3300005336 Bacteria 1234
9 Ga0070682_100138787 3300005337 Bacteria 1654
10 Ga0070660_100086941 3300005339 Bacteria 2460
11 Ga0070660_100106429 3300005339 Bacteria 2227
12 Ga0070660_101011188 3300005339 Bacteria 702
13 Ga0070661_100505857 3300005344 Bacteria 967
14 Ga0070671_100328358 3300005355 Bacteria 1304
15 Ga0070659_100102406 3300005366 Bacteria 2305
16 Ga0070667_100159640 3300005367 Bacteria 1985
17 Ga0070709_10118789 3300005434 Bacteria 1788
18 Ga0070714_100056720 3300005435 Bacteria 3351
19 Ga0070714_100205030 3300005435 Bacteria 1805
20 Ga0070714_100256118 3300005435 Bacteria 1619
21 Ga0070714_100628459 3300005435 Bacteria 1033
22 Ga0070713_100169420 3300005436 Bacteria 1955
23 Ga0070710_10003691 3300005437 Bacteria 7237
24 Ga0070711_100270107 3300005439 Bacteria 1341
25 Ga0070663_100186112 3300005455 Bacteria 1613
26 Ga0070663_100330850 3300005455 Bacteria 1228
27 Ga0070678_100185745 3300005456 Bacteria 1706
28 Ga0070678_100318655 3300005456 Bacteria 1327
29 Ga0070678_100743308 3300005456 Bacteria 887
30 Ga0070681_10054967 3300005458 Bacteria 3966
31 Ga0070681_10301033 3300005458 Bacteria 1513
32 Ga0070681_10304063 3300005458 Bacteria 1504
33 Ga0070681_10593833 3300005458 Bacteria 1021
34 Ga0070707_100139923 3300005468 Bacteria 2355
35 Ga0070679_100129491 3300005530 Bacteria 2505
36 Ga0070679_100317476 3300005530 Bacteria 1507
37 Ga0070679_100707020 3300005530 Bacteria 950
38 Ga0070684_100183894 3300005535 Bacteria 1900
39 Ga0070684_100231689 3300005535 Bacteria 1686
40 Ga0070684_100445511 3300005535 Bacteria 1196
41 Ga0068853_100250913 3300005539 Bacteria 1623
42 Ga0068853_100267416 3300005539 Bacteria 1574
43 Ga0068853_100595586 3300005539 Bacteria 1050
44 Ga0070696_100033028 3300005546 Bacteria 3554
45 Ga0070696_100164877 3300005546 Bacteria 1635
46 Ga0070665_100023979 3300005548 Bacteria 6144
47 Ga0068855_100108623 3300005563 Bacteria 3186
48 Ga0068855_100605154 3300005563 Bacteria 1181
49 Ga0068857_100254764 3300005577 Bacteria 1609
50 Ga0068857_100688913 3300005577 Bacteria 970
51 Ga0068856_100253821 3300005614 Bacteria 1773
52 Ga0068856_100403061 3300005614 Bacteria 1387
53 Ga0068864_100208661 3300005618 Bacteria 1798
54 Ga0070717_10166222 3300006028 Bacteria 1916
55 Ga0070717_10171838 3300006028 Bacteria 1885
56 Ga0075432_10035623 3300006058 Bacteria 1729
57 Ga0070715_10129186 3300006163 Bacteria 1214
58 Ga0070712_100004954 3300006175 Bacteria 8236
59 Ga0075428_100359161 3300006844 Bacteria 1563
60 Ga0075433_10017172 3300006852 Bacteria 5988
61 Ga0075434_100013114 3300006871 Bacteria 7871
62 Ga0075435_100469049 3300007076 Unclassified 1087
63 Ga0105240_10081583 3300009093 Bacteria 3974
64 Ga0105240_10191549 3300009093 Bacteria 2404
65 Ga0111539_10030327 3300009094 Bacteria 6574
66 Ga0111539_10167845 3300009094 Bacteria 2565
67 Ga0105245_10084649 3300009098 Bacteria 2906
68 Ga0105245_10595513 3300009098 Bacteria 1131
69 Ga0105245_11255929 3300009098 Bacteria 789
70 Ga0105247_10140841 3300009101 Bacteria 1580
71 Ga0114129_10014626 3300009147 Bacteria 11181
72 Ga0114129_10083033 3300009147 Bacteria 4451
73 Ga0105237_10010685 3300009545 Bacteria 9746
74 Ga0105237_10077274 3300009545 Bacteria 3319
75 Ga0105238_10055655 3300009551 Bacteria 3970
76 Ga0157373_10113703 3300013100 Bacteria 1902
77 Ga0157373_10412246 3300013100 Bacteria 969
78 Ga0157370_10081355 3300013104 Bacteria 3048
79 Ga0157370_10089088 3300013104 Bacteria 2898
80 Ga0157370_10337006 3300013104 Bacteria 1390
81 Ga0157369_10056232 3300013105 Bacteria 4246
82 Ga0157374_10078392 3300013296 Bacteria 3129
83 Ga0157374_10112034 3300013296 Bacteria 2625
84 Ga0157374_10301107 3300013296 Bacteria 1586
85 Ga0157372_10053575 3300013307 Bacteria 4497
86 Ga0157372_10461432 3300013307 Bacteria 1480
87 Ga0157372_10548957 3300013307 Bacteria 1347
88 Ga0157372_10574248 3300013307 Bacteria 1314
89 Ga0157372_11483020 3300013307 Bacteria 781
90 Ga0157375_10674994 3300013308 Bacteria 1188
91 Ga0157377_10510913 3300014745 Bacteria 842
92 Ga0157376_10253528 3300014969 Bacteria 1645
93 Ga0197907_10659982 3300020069 Bacteria 1630
94 Ga0197907_11126231 3300020069 Bacteria 2214
95 Ga0197907_11158638 3300020069 Bacteria 1836
96 Ga0197907_11378218 3300020069 Bacteria 1189
97 Ga0206356_10975268 3300020070 Bacteria 1393
98 Ga0206356_11113926 3300020070 Bacteria 994
99 Ga0206356_11252740 3300020070 Bacteria 1819
100 Ga0206349_1255006 3300020075 Bacteria 1176
101 Ga0206349_1857532 3300020075 Bacteria 1092
102 Ga0206352_11223139 3300020078 Bacteria 2286
103 Ga0206350_10360023 3300020080 Bacteria 2471
104 Ga0206350_11055047 3300020080 Bacteria 1358
105 Ga0206350_11170172 3300020080 Bacteria 1419
106 Ga0206354_10065070 3300020081 Bacteria 2355
107 Ga0206354_10138850 3300020081 Bacteria 1021
108 Ga0206354_10179325 3300020081 Bacteria 1206
109 Ga0206354_11080608 3300020081 Bacteria 1878
110 Ga0206353_10063157 3300020082 Bacteria 1108
111 Ga0206353_11869015 3300020082 Bacteria 1154
112 Ga0213874_10065207 3300021377 Bacteria 1150
113 Ga0224712_10024329 3300022467 Bacteria 2114
114 Ga0224712_10024746 3300022467 Bacteria 2101
115 Ga0224712_10095171 3300022467 Bacteria 1254
116 Ga0224712_10181599 3300022467 Bacteria 948
117 Ga0207692_10116224 3300025898 Bacteria 1491
118 Ga0207688_10151433 3300025901 Bacteria 1370
119 Ga0207699_10003860 3300025906 Bacteria 7159
120 Ga0207699_10441132 3300025906 Bacteria 933
121 Ga0207705_10029102 3300025909 Bacteria 3938
122 Ga0207705_10078678 3300025909 Bacteria 2400
123 Ga0207705_10120524 3300025909 Bacteria 1946
124 Ga0207705_10350620 3300025909 Bacteria 1137
125 Ga0207684_10288851 3300025910 Bacteria 1414
126 Ga0207684_10716604 3300025910 Bacteria 849
127 Ga0207654_10693753 3300025911 Bacteria 731
128 Ga0207707_10115435 3300025912 Bacteria 2346
129 Ga0207707_10289543 3300025912 Bacteria 1417
130 Ga0207695_10218757 3300025913 Bacteria 1813
131 Ga0207695_10454892 3300025913 Bacteria 1163
132 Ga0207695_10816102 3300025913 Bacteria 813
133 Ga0207693_10007191 3300025915 Bacteria 9169
134 Ga0207693_10168626 3300025915 Bacteria 1724
135 Ga0207693_10181877 3300025915 Bacteria 1654
136 Ga0207663_10039215 3300025916 Bacteria 2868
137 Ga0207663_10348158 3300025916 Bacteria 1121
138 Ga0207660_10273221 3300025917 Bacteria 1339
139 Ga0207657_10045436 3300025919 Bacteria 3855
140 Ga0207657_10060181 3300025919 Bacteria 3260
141 Ga0207657_10062708 3300025919 Bacteria 3181
142 Ga0207652_10034007 3300025921 Bacteria 4294
143 Ga0207694_10019451 3300025924 Bacteria 5132
144 Ga0207694_10036171 3300025924 Bacteria 3789
145 Ga0207687_10039538 3300025927 Bacteria 3230
146 Ga0207687_10159444 3300025927 Bacteria 1730
147 Ga0207687_10245357 3300025927 Bacteria 1421
148 Ga0207700_10095659 3300025928 Bacteria 2356
149 Ga0207700_10293214 3300025928 Bacteria 1402
150 Ga0207700_10538699 3300025928 Bacteria 1035
151 Ga0207664_10020922 3300025929 Bacteria 4855
152 Ga0207664_10157337 3300025929 Bacteria 1935
153 Ga0207664_10162564 3300025929 Bacteria 1905
154 Ga0207690_10525867 3300025932 Bacteria 959
155 Ga0207690_10797762 3300025932 Unclassified 780
156 Ga0207709_10698429 3300025935 Bacteria 811
157 Ga0207665_10069639 3300025939 Bacteria 2399
158 Ga0207665_10132849 3300025939 Bacteria 1768
159 Ga0207711_10436607 3300025941 Bacteria 1218
160 Ga0207661_10059027 3300025944 Bacteria 3090
161 Ga0207661_10100455 3300025944 Bacteria 2428
162 Ga0207661_10168879 3300025944 Bacteria 1903
163 Ga0207667_10143707 3300025949 Bacteria 2456
164 Ga0207667_10248298 3300025949 Bacteria 1820
165 Ga0207667_10283952 3300025949 Bacteria 1691
166 Ga0207667_10647902 3300025949 Bacteria 1062
167 Ga0207640_10588469 3300025981 Bacteria 940
168 Ga0207658_10002202 3300025986 Bacteria 14475
169 Ga0207639_10080884 3300026041 Bacteria 2572
170 Ga0207639_10089395 3300026041 Bacteria 2461
171 Ga0207678_10080747 3300026067 Bacteria 2784
172 Ga0207702_10066307 3300026078 Bacteria 3094
173 Ga0207702_10287723 3300026078 Bacteria 1556
174 Ga0207641_10326345 3300026088 Bacteria 1457
175 Ga0207676_10513574 3300026095 Bacteria 1140
176 Ga0207674_10409393 3300026116 Bacteria 1311
177 Ga0207683_10063110 3300026121 Bacteria 3263
178 Ga0207428_10054745 3300027907 Bacteria 3176
179 Ga0268266_10155273 3300028379 Bacteria 2066
180 Ga0265338_10005531 3300028800 Bacteria 16460
181 Ga0265327_10143251 3300031251 Unclassified 1115
182 Ga0265313_10007407 3300031595 Bacteria 7516
183 Ga0307412_10906055 3300031911 Bacteria 773
184 Ga0307416_100653563 3300032002 Bacteria 1136
185 Ga0373943_0025719 3300035170 Bacteria 2752
186 Ga0373931_0014456 3300035691 Bacteria 3859
187 Ga0373935_0226216 3300035692 Bacteria 1301
188 Ga0373927_0360452 3300035695 Bacteria 958
189 Ga0373947_0005351 3300035725 Bacteria 7493
190 Ga0373925_0012920 3300037068 Bacteria 6047
191 Ga0395899_0105045 3300037312 Bacteria 2035
192 Ga0395899_0109822 3300037312 Bacteria 1984
193 Ga0395899_0347112 3300037312 Bacteria 994
194 Ga0395900_0076330 3300037418 Bacteria 3444
195 Ga0395900_0090542 3300037418 Bacteria 3144
196 Ga0395900_0095387 3300037418 Bacteria 3056
197 Ga0395900_0349959 3300037418 Bacteria 1451
198 Ga0395898_0001602 3300037466 Bacteria 30857
199 Ga0395898_0002399 3300037466 Bacteria 22249
200 Ga0395898_0090462 3300037466 Bacteria 2945
201 Ga0395898_0509836 3300037466 Bacteria 1144
202 Ga0395905_0013817 3300037471 Bacteria 7726
203 Ga0395905_0481583 3300037471 Bacteria 1140
204 Ga0395901_0002305 3300038443 Bacteria 19452
205 Ga0395901_0017521 3300038443 Bacteria 7311
206 Ga0395901_0073783 3300038443 Bacteria 3559
207 Ga0395901_0218656 3300038443 Bacteria 1992
208 Ga0395901_0800590 3300038443 Bacteria 931
209 Ga0436365_1763554 3300039437 Bacteria 2133
210 Ga0436363_0873180 3300039450 Bacteria 1273
211 Ga0436363_1274357 3300039450 Bacteria 1372
212 Ga0436363_1303569 3300039450 Bacteria 1916
213 Ga0466969_0007186 3300044656 Bacteria 5923
214 Ga0466965_0074531 3300044683 Bacteria 1710
215 Ga0466965_0342291 3300044683 Bacteria 818
216 Ga0466966_0026130 3300044684 Bacteria 3812
217 Ga0466966_0037475 3300044684 Bacteria 3127
218 Ga0466966_0052927 3300044684 Bacteria 2577
219 Ga0466966_0218689 3300044684 Bacteria 1150
220 Ga0466961_0011787 3300044693 Bacteria 5587
221 Ga0466961_0026102 3300044693 Bacteria 3756
222 Ga0466961_0047675 3300044693 Bacteria 2739
223 Ga0466961_0100733 3300044693 Bacteria 1820
224 Ga0466961_0119196 3300044693 Bacteria 1657
225 Ga0466963_0007550 3300044694 Bacteria 6490
226 Ga0466963_0022430 3300044694 Bacteria 3998
227 Ga0466963_0058604 3300044694 Bacteria 2568
228 Ga0466963_0066640 3300044694 Bacteria 2415
229 Ga0466963_0069654 3300044694 Bacteria 2364
230 Ga0466963_0150307 3300044694 Bacteria 1617
231 Ga0466963_0463712 3300044694 Bacteria 894
232 Ga0466963_0840387 3300044694 Bacteria 647
233 Ga0466964_0006906 3300044706 Bacteria 4239
234 Ga0466964_0111997 3300044706 Bacteria 1218
235 Ga0466964_0120729 3300044706 Bacteria 1181
236 Ga0466964_0352538 3300044706 Bacteria 756
237 Ga0466971_0006838 3300044719 Bacteria 4960
238 Ga0466971_0012688 3300044719 Bacteria 3695
239 Ga0466971_0014829 3300044719 Bacteria 3430
240 Ga0466971_0020959 3300044719 Bacteria 2906
241 Ga0466971_0027119 3300044719 Bacteria 2564
242 Ga0466971_0051516 3300044719 Bacteria 1853
243 Ga0466968_0001546 3300044735 Bacteria 8279
244 Ga0466968_0024129 3300044735 Bacteria 2483
245 Ga0466968_0078368 3300044735 Bacteria 1448
246 Ga0466968_0425660 3300044735 Bacteria 653
247 Ga0466970_0009847 3300044765 Bacteria 4840
248 Ga0466970_0053251 3300044765 Bacteria 2161
249 Ga0466957_0005599 3300044842 Bacteria 7059
250 Ga0466957_0021585 3300044842 Bacteria 3795
251 Ga0466957_0039708 3300044842 Bacteria 2840
252 Ga0466957_0065081 3300044842 Bacteria 2244
253 Ga0466957_0231170 3300044842 Bacteria 1224
254 Ga0466957_0349821 3300044842 Bacteria 1002
255 Ga0466957_0357648 3300044842 Bacteria 992
256 Ga0466957_0412147 3300044842 Unclassified 926
257 Ga0466959_0003548 3300045049 Bacteria 10253
258 Ga0466959_0014779 3300045049 Bacteria 5682
259 Ga0466959_0021742 3300045049 Bacteria 4734
260 Ga0466959_0032007 3300045049 Bacteria 3892
261 Ga0466959_0032693 3300045049 Bacteria 3850
262 Ga0466959_0043140 3300045049 Bacteria 3327
263 Ga0466959_0075282 3300045049 Bacteria 2439
264 Ga0466959_0217685 3300045049 Bacteria 1325
265 Ga0466958_0002592 3300045836 Bacteria 9126
266 Ga0466958_0010097 3300045836 Bacteria 5277
267 Ga0466958_0039232 3300045836 Bacteria 2844
268 Ga0466958_0118294 3300045836 Bacteria 1657
269 Ga0466958_0132053 3300045836 Bacteria 1568
270 Ga0466967_0014985 3300045976 Bacteria 6062
271 Ga0466967_0026850 3300045976 Bacteria 4778
272 Ga0466967_0065817 3300045976 Bacteria 3227
273 Ga0466967_0107105 3300045976 Bacteria 2563
274 Ga0466967_0130726 3300045976 Bacteria 2330
275 Ga0466967_0167136 3300045976 Bacteria 2068
276 Ga0466967_0263519 3300045976 Bacteria 1649
277 Ga0466967_0293161 3300045976 Bacteria 1563
278 Ga0466967_0436621 3300045976 Bacteria 1278
279 Ga0466967_0472882 3300045976 Bacteria 1227
280 Ga0466967_0490481 3300045976 Bacteria 1204
281 Ga0466967_0503559 3300045976 Bacteria 1189
282 Ga0466967_0602626 3300045976 Bacteria 1084
283 Ga0466967_0931051 3300045976 Bacteria 864
284 Ga0495641_0042642 3300046461 Bacteria 2101
285 Ga0495653_0267296 3300046463 Bacteria 1128
286 Ga0495662_0064661 3300046476 Bacteria 1768
287 Ga0495618_0288355 3300046514 Bacteria 1022
288 Ga0495630_0031055 3300046517 Bacteria 3976
289 Ga0495652_0110794 3300046529 Bacteria 2207
290 Ga0495587_0129162 3300046536 Bacteria 1445
291 Ga0495667_0100542 3300046559 Bacteria 1871
292 Ga0495635_0316643 3300046663 Bacteria 1045
293 Ga0495647_0038995 3300046681 Bacteria 1798
294 Ga0495658_0015508 3300046683 Bacteria 3910
295 Ga0495658_0135529 3300046683 Bacteria 1502
296 Ga0495613_0404361 3300046689 Unclassified 931
297 Ga0495680_0096948 3300047322 Bacteria 2202
298 Ga0496100_0115238 3300048903 Bacteria 1873
299 Ga0496101_0006135 3300048904 Bacteria 7714
300 Ga0496101_0079718 3300048904 Bacteria 2417
301 Ga0496101_0417862 3300048904 Bacteria 1057
302 Ga0496102_0005988 3300048905 Bacteria 10356
303 Ga0496102_0036303 3300048905 Bacteria 4439
304 Ga0496102_0125071 3300048905 Bacteria 2403
305 Ga0496102_0330948 3300048905 Bacteria 1435
306 Ga0496103_0016401 3300048906 Bacteria 4420
307 Ga0496103_0039883 3300048906 Bacteria 2886
308 Ga0496104_0093142 3300048907 Bacteria 2881
309 Ga0496104_0242305 3300048907 Bacteria 1715
310 Ga0496105_0052674 3300048908 Bacteria 3361
311 Ga0496106_0385437 3300048909 Bacteria 1126
312 Ga0496107_0002591 3300048910 Bacteria 11792
313 Ga0496107_0043877 3300048910 Bacteria 3213
314 Ga0496107_0358396 3300048910 Bacteria 1085
315 Ga0496107_0487484 3300048910 Unclassified 914
316 Ga0496108_0052543 3300048911 Bacteria 3415
317 Ga0496108_0085413 3300048911 Bacteria 2679
318 Ga0496108_0127337 3300048911 Bacteria 2187
319 Ga0496108_0408089 3300048911 Bacteria 1186
320 Ga0496109_0001583 3300048912 Bacteria 19001
321 Ga0496109_0180275 3300048912 Bacteria 1983
322 Ga0496110_0046541 3300048913 Bacteria 3795
323 Ga0496110_0090038 3300048913 Bacteria 2743
324 Ga0496110_0145846 3300048913 Bacteria 2141
325 Ga0496111_0076053 3300048914 Bacteria 2447
326 Ga0496111_0668434 3300048914 Unclassified 757
327 Ga0496112_0131026 3300048915 Bacteria 2478
328 Ga0496112_0146396 3300048915 Bacteria 2330
329 Ga0496112_0270347 3300048915 Bacteria 1648
330 Ga0496113_0078893 3300048916 Bacteria 2519
331 Ga0496114_0142007 3300048917 Bacteria 2079
332 Ga0496114_0714090 3300048917 Bacteria 878
333 Ga0496115_0015488 3300048918 Bacteria 5785
334 Ga0501039_0140099 3300049575 Bacteria 1900
335 Ga0501046_0270737 3300049580 Bacteria 1246
336 Ga0501067_0005984 3300049583 Bacteria 6744
337 Ga0501067_0060660 3300049583 Bacteria 2093
338 Ga0501067_0093588 3300049583 Bacteria 1668
339 Ga0501070_0161891 3300049586 Bacteria 1844
340 Ga0501070_0726293 3300049586 Bacteria 784
341 Ga0501071_0159005 3300049587 Bacteria 1688
342 Ga0501074_0049602 3300049590 Bacteria 3031
343 Ga0501075_0207849 3300049591 Bacteria 1493
344 Ga0501076_0237672 3300049592 Bacteria 1490
345 Ga0501076_0382481 3300049592 Bacteria 1157
346 Ga0501076_0389595 3300049592 Bacteria 1145
347 Ga0501079_0347916 3300049741 Bacteria 1161
348 Ga0501079_0761555 3300049741 Bacteria 762
349 Ga0501080_0352171 3300049742 Bacteria 1329
350 Ga0501080_0518723 3300049742 Bacteria 1063
351 Ga0501081_0310420 3300049743 Bacteria 1158
352 Ga0501083_0650076 3300049744 Unclassified 686
353 Ga0501044_0218194 3300049823 Bacteria 1859
354 Ga0501045_0113251 3300049824 Bacteria 2012
355 nmdc:mga05p37_316084_c1 3300050507 Bacteria 1850
356 nmdc:mga05p37_38439_c1 3300050507 Bacteria 5870
357 nmdc:mga08y16_145138_c1 3300050511 Bacteria 2467
358 nmdc:mga08y16_62527_c1 3300050511 Bacteria 3888
359 nmdc:mga0n895_1579_c1 3300050512 Bacteria 17141
360 nmdc:mga0rr50_694195_c1 3300050513 Unclassified 869
361 nmdc:mga0a205_515_c1 3300050515 Bacteria 30339
362 nmdc:mga0a205_524859_c1 3300050515 Bacteria 1040
363 Ga0495601_0115355 3300053077 Bacteria 1741
364 Ga0495619_0065660 3300053085 Bacteria 2421
365 Ga0501084_0236223 3300054114 Bacteria 1543
366 Ga0587083_0026928 3300059505 Bacteria 1114
367 Ga0587128_029437 3300059630 Bacteria 900
368 Ga0587067_054558 3300059640 Bacteria 819
369 Ga0466962_0002803 3300061719 Bacteria 8290
370 Ga0466962_0006003 3300061719 Bacteria 5839
371 Ga0466962_0008670 3300061719 Bacteria 4876
372 Ga0466962_0009590 3300061719 Bacteria 4643
373 Ga0466962_0047854 3300061719 Bacteria 2043
374 Ga0466962_0059080 3300061719 Bacteria 1830
375 Ga0530510_0061044 3300061734 Bacteria 2729
376 Ga0530510_0287359 3300061734 Bacteria 1229
377 Ga0530510_0480816 3300061734 Bacteria 941
378 Ga0501047_0259871
379 Ga0070658_10106439
380 Ga0070658_10221188
381 Ga0070683_100103147
382 Ga0070683_100126953
383 Ga0070683_100267389
384 Ga0070680_100312515
385 Ga0070680_100362079
386 Ga0070682_100138787
387 Ga0070660_100086941
388 Ga0070660_100106429
389 Ga0070660_101011188
390 Ga0070661_100505857
391 Ga0070671_100328358
392 Ga0070659_100102406
393 Ga0070667_100159640
394 Ga0070709_10118789
395 Ga0070714_100056720
396 Ga0070714_100205030
397 Ga0070714_100256118
398 Ga0070714_100628459
399 Ga0070713_100169420
400 Ga0070710_10003691
401 Ga0070711_100270107
402 Ga0070663_100186112
403 Ga0070663_100330850
404 Ga0070678_100185745
405 Ga0070678_100318655
406 Ga0070678_100743308
407 Ga0070681_10054967
408 Ga0070681_10301033
409 Ga0070681_10304063
410 Ga0070681_10593833
411 Ga0070707_100139923
412 Ga0070679_100129491
413 Ga0070679_100317476
414 Ga0070679_100707020
415 Ga0070684_100183894
416 Ga0070684_100231689
417 Ga0070684_100445511
418 Ga0068853_100250913
419 Ga0068853_100267416
420 Ga0068853_100595586
421 Ga0070696_100033028
422 Ga0070696_100164877
423 Ga0070665_100023979
424 Ga0068855_100108623
425 Ga0068855_100605154
426 Ga0068857_100254764
427 Ga0068857_100688913
428 Ga0068856_100253821
429 Ga0068856_100403061
430 Ga0068864_100208661
431 Ga0070717_10166222
432 Ga0070717_10171838
433 Ga0075432_10035623
434 Ga0070715_10129186
435 Ga0070712_100004954
436 Ga0075428_100359161
437 Ga0075433_10017172
438 Ga0075434_100013114
439 Ga0075435_100469049
440 Ga0105240_10081583
441 Ga0105240_10191549
442 Ga0111539_10030327
443 Ga0111539_10167845
444 Ga0105245_10084649
445 Ga0105245_10595513
446 Ga0105245_11255929
447 Ga0105247_10140841
448 Ga0114129_10014626
449 Ga0114129_10083033
450 Ga0105237_10010685
451 Ga0105237_10077274
452 Ga0105238_10055655
453 Ga0157373_10113703
454 Ga0157373_10412246
455 Ga0157370_10081355
456 Ga0157370_10089088
457 Ga0157370_10337006
458 Ga0157369_10056232
459 Ga0157374_10078392
460 Ga0157374_10112034
461 Ga0157374_10301107
462 Ga0157372_10053575
463 Ga0157372_10461432
464 Ga0157372_10548957
465 Ga0157372_10574248
466 Ga0157372_11483020
467 Ga0157375_10674994
468 Ga0157377_10510913
469 Ga0157376_10253528
470 Ga0197907_10659982
471 Ga0197907_11126231
472 Ga0197907_11158638
473 Ga0197907_11378218
474 Ga0206356_10975268
475 Ga0206356_11113926
476 Ga0206356_11252740
477 Ga0206349_1255006
478 Ga0206349_1857532
479 Ga0206352_11223139
480 Ga0206350_10360023
481 Ga0206350_11055047
482 Ga0206350_11170172
483 Ga0206354_10065070
484 Ga0206354_10138850
485 Ga0206354_10179325
486 Ga0206354_11080608
487 Ga0206353_10063157
488 Ga0206353_11869015
489 Ga0213874_10065207
490 Ga0224712_10024329
491 Ga0224712_10024746
492 Ga0224712_10095171
493 Ga0224712_10181599
494 Ga0207692_10116224
495 Ga0207688_10151433
496 Ga0207699_10003860
497 Ga0207699_10441132
498 Ga0207705_10029102
499 Ga0207705_10078678
500 Ga0207705_10120524
501 Ga0207705_10350620
502 Ga0207684_10288851
503 Ga0207684_10716604
504 Ga0207654_10693753
505 Ga0207707_10115435
506 Ga0207707_10289543
507 Ga0207695_10218757
508 Ga0207695_10454892
509 Ga0207695_10816102
510 Ga0207693_10007191
511 Ga0207693_10168626
512 Ga0207693_10181877
513 Ga0207663_10039215
514 Ga0207663_10348158
515 Ga0207660_10273221
516 Ga0207657_10045436
517 Ga0207657_10060181
518 Ga0207657_10062708
519 Ga0207652_10034007
520 Ga0207694_10019451
521 Ga0207694_10036171
522 Ga0207687_10039538
523 Ga0207687_10159444
524 Ga0207687_10245357
525 Ga0207700_10095659
526 Ga0207700_10293214
527 Ga0207700_10538699
528 Ga0207664_10020922
529 Ga0207664_10157337
530 Ga0207664_10162564
531 Ga0207690_10525867
532 Ga0207690_10797762
533 Ga0207709_10698429
534 Ga0207665_10069639
535 Ga0207665_10132849
536 Ga0207711_10436607
537 Ga0207661_10059027
538 Ga0207661_10100455
539 Ga0207661_10168879
540 Ga0207667_10143707
541 Ga0207667_10248298
542 Ga0207667_10283952
543 Ga0207667_10647902
544 Ga0207640_10588469
545 Ga0207658_10002202
546 Ga0207639_10080884
547 Ga0207639_10089395
548 Ga0207678_10080747
549 Ga0207702_10066307
550 Ga0207702_10287723
551 Ga0207641_10326345
552 Ga0207676_10513574
553 Ga0207674_10409393
554 Ga0207683_10063110
555 Ga0207428_10054745
556 Ga0268266_10155273
557 Ga0265338_10005531
558 Ga0265327_10143251
559 Ga0265313_10007407
560 Ga0307412_10906055
561 Ga0307416_100653563
562 Ga0373943_0025719
563 Ga0373931_0014456
564 Ga0373935_0226216
565 Ga0373927_0360452
566 Ga0373947_0005351
567 Ga0373925_0012920
568 Ga0395899_0105045
569 Ga0395899_0109822
570 Ga0395899_0347112
571 Ga0395900_0076330
572 Ga0395900_0090542
573 Ga0395900_0095387
574 Ga0395900_0349959
575 Ga0395898_0001602
576 Ga0395898_0002399
577 Ga0395898_0090462
578 Ga0395898_0509836
579 Ga0395905_0013817
580 Ga0395905_0481583
581 Ga0395901_0002305
582 Ga0395901_0017521
583 Ga0395901_0073783
584 Ga0395901_0218656
585 Ga0395901_0800590
586 Ga0436365_1763554
587 Ga0436363_0873180
588 Ga0436363_1274357
589 Ga0436363_1303569
590 Ga0466969_0007186
591 Ga0466965_0074531
592 Ga0466965_0342291
593 Ga0466966_0026130
594 Ga0466966_0037475
595 Ga0466966_0052927
596 Ga0466966_0218689
597 Ga0466961_0011787
598 Ga0466961_0026102
599 Ga0466961_0047675
600 Ga0466961_0100733
601 Ga0466961_0119196
602 Ga0466963_0007550
603 Ga0466963_0022430
604 Ga0466963_0058604
605 Ga0466963_0066640
606 Ga0466963_0069654
607 Ga0466963_0150307
608 Ga0466963_0463712
609 Ga0466963_0840387
610 Ga0466964_0006906
611 Ga0466964_0111997
612 Ga0466964_0120729
613 Ga0466964_0352538
614 Ga0466971_0006838
615 Ga0466971_0012688
616 Ga0466971_0014829
617 Ga0466971_0020959
618 Ga0466971_0027119
619 Ga0466971_0051516
620 Ga0466968_0001546
621 Ga0466968_0024129
622 Ga0466968_0078368
623 Ga0466968_0425660
624 Ga0466970_0009847
625 Ga0466970_0053251
626 Ga0466957_0005599
627 Ga0466957_0021585
628 Ga0466957_0039708
629 Ga0466957_0065081
630 Ga0466957_0231170
631 Ga0466957_0349821
632 Ga0466957_0357648
633 Ga0466957_0412147
634 Ga0466959_0003548
635 Ga0466959_0014779
636 Ga0466959_0021742
637 Ga0466959_0032007
638 Ga0466959_0032693
639 Ga0466959_0043140
640 Ga0466959_0075282
641 Ga0466959_0217685
642 Ga0466958_0002592
643 Ga0466958_0010097
644 Ga0466958_0039232
645 Ga0466958_0118294
646 Ga0466958_0132053
647 Ga0466967_0014985
648 Ga0466967_0026850
649 Ga0466967_0065817
650 Ga0466967_0107105
651 Ga0466967_0130726
652 Ga0466967_0167136
653 Ga0466967_0263519
654 Ga0466967_0293161
655 Ga0466967_0436621
656 Ga0466967_0472882
657 Ga0466967_0490481
658 Ga0466967_0503559
659 Ga0466967_0602626
660 Ga0466967_0931051
661 Ga0495641_0042642
662 Ga0495653_0267296
663 Ga0495662_0064661
664 Ga0495618_0288355
665 Ga0495630_0031055
666 Ga0495652_0110794
667 Ga0495587_0129162
668 Ga0495667_0100542
669 Ga0495635_0316643
670 Ga0495647_0038995
671 Ga0495658_0015508
672 Ga0495658_0135529
673 Ga0495613_0404361
674 Ga0495680_0096948
675 Ga0496100_0115238
676 Ga0496101_0006135
677 Ga0496101_0079718
678 Ga0496101_0417862
679 Ga0496102_0005988
680 Ga0496102_0036303
681 Ga0496102_0125071
682 Ga0496102_0330948
683 Ga0496103_0016401
684 Ga0496103_0039883
685 Ga0496104_0093142
686 Ga0496104_0242305
687 Ga0496105_0052674
688 Ga0496106_0385437
689 Ga0496107_0002591
690 Ga0496107_0043877
691 Ga0496107_0358396
692 Ga0496107_0487484
693 Ga0496108_0052543
694 Ga0496108_0085413
695 Ga0496108_0127337
696 Ga0496108_0408089
697 Ga0496109_0001583
698 Ga0496109_0180275
699 Ga0496110_0046541
700 Ga0496110_0090038
701 Ga0496110_0145846
702 Ga0496111_0076053
703 Ga0496111_0668434
704 Ga0496112_0131026
705 Ga0496112_0146396
706 Ga0496112_0270347
707 Ga0496113_0078893
708 Ga0496114_0142007
709 Ga0496114_0714090
710 Ga0496115_0015488
711 Ga0501039_0140099
712 Ga0501046_0270737
713 Ga0501067_0005984
714 Ga0501067_0060660
715 Ga0501067_0093588
716 Ga0501070_0161891
717 Ga0501070_0726293
718 Ga0501071_0159005
719 Ga0501074_0049602
720 Ga0501075_0207849
721 Ga0501076_0237672
722 Ga0501076_0382481
723 Ga0501076_0389595
724 Ga0501079_0347916
725 Ga0501079_0761555
726 Ga0501080_0352171
727 Ga0501080_0518723
728 Ga0501081_0310420
729 Ga0501083_0650076
730 Ga0501044_0218194
731 Ga0501045_0113251
732 nmdc:mga05p37_316084_c1
733 nmdc:mga05p37_38439_c1
734 nmdc:mga08y16_145138_c1
735 nmdc:mga08y16_62527_c1
736 nmdc:mga0n895_1579_c1
737 nmdc:mga0rr50_694195_c1
738 nmdc:mga0a205_515_c1
739 nmdc:mga0a205_524859_c1
740 Ga0495601_0115355
741 Ga0495619_0065660
742 Ga0501084_0236223
743 Ga0587083_0026928
744 Ga0587128_029437
745 Ga0587067_054558
746 Ga0466962_0002803
747 Ga0466962_0006003
748 Ga0466962_0008670
749 Ga0466962_0009590
750 Ga0466962_0047854
751 Ga0466962_0059080
752 Ga0530510_0061044
753 Ga0530510_0287359
754 Ga0530510_0480816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

1

98

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_J the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.8808 4 131
1zax-assembly1.cif.gz_A ribosomal protein l10-l12(ntd) complex, space group p212121, form b 0.8617 3 151
5gad-assembly1.cif.gz_I rnc-srp-sr complex early state 0.8563 1 125
7as8-assembly1.cif.gz_L bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.8553 4 128
7p6z-assembly1.cif.gz_g mycoplasma pneumoniae 70s ribosome in untreated cells 0.8537 2 127
ID Description Score Start End Superfamily
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8778 3 129 3.30.70.1730
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8474 3 129 3.30.70.1730
af_Q9VPL3_26_196_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8356 1 129 3.30.70.1730
5oolI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8336 2 129 3.30.70.1730
af_Q8I1U9_104_236_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.827 1 129 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A496RYS2-F1-model_v4 Large ribosomal subunit protein uL10 0.9296 3 151 GO:0005840
GO:0006412
GO:0070180
GO:1990904
AF-A0A2M7YEL4-F1-model_v4 Large ribosomal subunit protein uL10 0.9083 1 152 GO:0005840
GO:0006412
GO:0070180
GO:1990904
AF-A0A1F5YCF7-F1-model_v4 Large ribosomal subunit protein uL10 0.9061 1 151 GO:0005840
GO:0006412
GO:0070180
GO:1990904
AF-A0A523RQT9-F1-model_v4 Large ribosomal subunit protein uL10 0.9025 1 151 GO:0005840
GO:0006412
GO:0070180
GO:1990904
AF-A1UBJ0-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9012 1 151 GO:0003735
GO:0006412
GO:0015934
GO:0070180

Map