F427816

General Info

Members Datasets Scaffolds Average Seq Length
377 267 374 117

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_1029977|Ga0496102_1029977_210_614
Length 134
Sequence MIVKYEGGAHQMPTDRLSLIFSALADPTRRAILARLAEGEATVNELAEPFDISLPAVSRHLKVLEAAGLITRSRNAQWRSSKLEAAPLREVAEYMEEYRRFWDASFSRLDAHLRKIQQVPKNQEPGNEHAAEHP

Samples

Sample ID Description Type Environment
1 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
2 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
264 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.27
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.02
Nodule 0
Rhizoplane 11.94
Rhizosphere 76.13
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001360 3300003320 Bacteria 48496
2 rootH1_10300328 3300003323 Bacteria 2231
3 JGI25407J50210_10004489 3300003373 Bacteria 3394
4 Ga0055536_1006685 3300003781 Bacteria 5304
5 Ga0055536_1007630 3300003781 Bacteria 4798
6 Ga0055530_10006349 3300003791 Bacteria 5304
7 Ga0055530_10016055 3300003791 Bacteria 2408
8 Ga0055531_10000915 3300003794 Bacteria 23931
9 Ga0055531_10008113 3300003794 Bacteria 5596
10 Ga0055531_10098863 3300003794 Bacteria 603
11 Ga0065165_1123369 3300005262 Bacteria 626
12 Ga0065714_10248691 3300005288 Bacteria 780
13 Ga0070676_10001329 3300005328 Bacteria 12424
14 Ga0070690_100037545 3300005330 Bacteria 3054
15 Ga0068869_100013645 3300005334 Bacteria 5410
16 Ga0070680_100412306 3300005336 Bacteria 1152
17 Ga0068868_101218889 3300005338 Bacteria 696
18 Ga0070689_100004728 3300005340 Bacteria 9240
19 Ga0070691_10017847 3300005341 Bacteria 3265
20 Ga0070692_10197120 3300005345 Bacteria 1177
21 Ga0070668_100038810 3300005347 Bacteria 3642
22 Ga0070669_100102357 3300005353 Bacteria 2162
23 Ga0070669_101381150 3300005353 Bacteria 611
24 Ga0070674_100000979 3300005356 Bacteria 14891
25 Ga0070673_101220826 3300005364 Bacteria 705
26 Ga0070659_100260035 3300005366 Bacteria 1440
27 Ga0070667_100012333 3300005367 Bacteria 7071
28 Ga0070714_100059736 3300005435 Bacteria 3270
29 Ga0070713_100229546 3300005436 Bacteria 1687
30 Ga0070710_10000637 3300005437 Bacteria 16704
31 Ga0070701_10236940 3300005438 Bacteria 1096
32 Ga0070705_100005859 3300005440 Bacteria 6007
33 Ga0070700_100196290 3300005441 Bacteria 1415
34 Ga0070700_100210801 3300005441 Bacteria 1371
35 Ga0070694_100011899 3300005444 Bacteria 5399
36 Ga0070663_100175943 3300005455 Bacteria 1657
37 Ga0070678_100003011 3300005456 Bacteria 9338
38 Ga0070678_102130848 3300005456 Bacteria 531
39 Ga0070662_100001633 3300005457 Bacteria 13833
40 Ga0070662_101075723 3300005457 Bacteria 690
41 Ga0070681_10165361 3300005458 Bacteria 2135
42 Ga0068867_100005547 3300005459 Bacteria 8936
43 Ga0070706_100539465 3300005467 Bacteria 1085
44 Ga0070706_100599685 3300005467 Bacteria 1023
45 Ga0070707_100707104 3300005468 Bacteria 971
46 Ga0070699_100139080 3300005518 Bacteria 2143
47 Ga0070699_100153130 3300005518 Bacteria 2040
48 Ga0070679_100383032 3300005530 Bacteria 1353
49 Ga0068853_100172611 3300005539 Bacteria 1957
50 Ga0070672_100255596 3300005543 Bacteria 1476
51 Ga0070672_101141166 3300005543 Bacteria 693
52 Ga0070686_100095194 3300005544 Bacteria 2000
53 Ga0070695_100003158 3300005545 Bacteria 9612
54 Ga0070696_100004172 3300005546 Bacteria 9628
55 Ga0070693_100026465 3300005547 Bacteria 3132
56 Ga0068855_100037629 3300005563 Bacteria 5753
57 Ga0068855_100301587 3300005563 Bacteria 1774
58 Ga0068857_100086927 3300005577 Unclassified 2796
59 Ga0068854_100001781 3300005578 Bacteria 13115
60 Ga0068856_100422258 3300005614 Bacteria 1353
61 Ga0070702_100008694 3300005615 Bacteria 4931
62 Ga0068852_100923399 3300005616 Bacteria 890
63 Ga0068859_100194245 3300005617 Bacteria 2114
64 Ga0068859_101767242 3300005617 Bacteria 683
65 Ga0068864_100026994 3300005618 Bacteria 4844
66 Ga0068864_100099620 3300005618 Bacteria 2575
67 Ga0068864_100109884 3300005618 Bacteria 2455
68 Ga0068866_10008575 3300005718 Bacteria 4314
69 Ga0068861_100035098 3300005719 Bacteria 3713
70 Ga0068870_10022965 3300005840 Unclassified 3070
71 Ga0068863_100100100 3300005841 Bacteria 2754
72 Ga0068858_100272227 3300005842 Bacteria 1612
73 Ga0068860_100007967 3300005843 Bacteria 10566
74 Ga0068860_100214248 3300005843 Bacteria 1869
75 Ga0068860_102251030 3300005843 Bacteria 566
76 Ga0068862_100288810 3300005844 Unclassified 1505
77 Ga0068862_101858966 3300005844 Bacteria 612
78 Ga0081455_10261932 3300005937 Bacteria 1259
79 Ga0081538_10000034 3300005981 Bacteria 120557
80 Ga0081538_10001209 3300005981 Bacteria 27097
81 Ga0081538_10011744 3300005981 Bacteria 7066
82 Ga0075365_10671542 3300006038 Bacteria 732
83 Ga0075368_10193602 3300006042 Bacteria 859
84 Ga0075363_100391142 3300006048 Bacteria 816
85 Ga0070712_101296487 3300006175 Bacteria 635
86 Ga0075362_10029175 3300006177 Bacteria 2375
87 Ga0075367_10149000 3300006178 Bacteria 1451
88 Ga0075367_10332738 3300006178 Bacteria 957
89 Ga0075366_10043818 3300006195 Bacteria 2651
90 Ga0097621_100122735 3300006237 Bacteria 2205
91 Ga0075370_10207399 3300006353 Bacteria 1157
92 Ga0068871_100033152 3300006358 Bacteria 4087
93 Ga0075428_100363629 3300006844 Bacteria 1552
94 Ga0075431_100019201 3300006847 Bacteria 6967
95 Ga0075433_10700155 3300006852 Bacteria 887
96 Ga0075433_10819205 3300006852 Bacteria 813
97 Ga0075434_101115762 3300006871 Bacteria 802
98 Ga0075429_100676573 3300006880 Bacteria 904
99 Ga0068865_100009821 3300006881 Bacteria 5943
100 Ga0097620_100194242 3300006931 Bacteria 2114
101 Ga0097620_101767209 3300006931 Bacteria 683
102 Ga0075435_101283134 3300007076 Bacteria 641
103 Ga0099794_10078170 3300007265 Bacteria 1629
104 Ga0105244_10024294 3300009036 Bacteria 3309
105 Ga0105240_10057796 3300009093 Bacteria 4844
106 Ga0111539_10492952 3300009094 Bacteria 1427
107 Ga0114129_10033766 3300009147 Bacteria 7228
108 Ga0105243_10007844 3300009148 Bacteria 8206
109 Ga0105243_10417747 3300009148 Unclassified 1250
110 Ga0105242_10001753 3300009176 Bacteria 17138
111 Ga0105242_12146585 3300009176 Bacteria 603
112 Ga0105248_10032276 3300009177 Bacteria 5854
113 Ga0105248_10350517 3300009177 Unclassified 1662
114 Ga0105248_11247650 3300009177 Unclassified 841
115 Ga0105248_12900032 3300009177 Unclassified 547
116 Ga0105237_10437864 3300009545 Bacteria 1313
117 Ga0105249_10024782 3300009553 Bacteria 5394
118 Ga0105249_10065000 3300009553 Unclassified 3355
119 Ga0105249_10156669 3300009553 Bacteria 2197
120 Ga0099796_10074244 3300010159 Bacteria 1234
121 Ga0099796_10150366 3300010159 Bacteria 916
122 Ga0105239_10242108 3300010375 Bacteria 2025
123 Ga0105239_11764452 3300010375 Bacteria 717
124 Ga0105246_10162133 3300011119 Unclassified 1704
125 Ga0157371_10912441 3300013102 Bacteria 667
126 Ga0157369_10002781 3300013105 Bacteria 20894
127 Ga0157374_10672603 3300013296 Bacteria 1047
128 Ga0157378_10007186 3300013297 Bacteria 9726
129 Ga0163162_10015277 3300013306 Bacteria 7499
130 Ga0163162_10240519 3300013306 Bacteria 1941
131 Ga0163162_10267484 3300013306 Bacteria 1841
132 Ga0163162_11199371 3300013306 Unclassified 861
133 Ga0157372_10059597 3300013307 Bacteria 4270
134 Ga0157372_10155899 3300013307 Bacteria 2638
135 Ga0157375_10185949 3300013308 Bacteria 2231
136 Ga0157375_11633769 3300013308 Bacteria 762
137 Ga0163163_10117496 3300014325 Bacteria 2691
138 Ga0157380_10080246 3300014326 Bacteria 2667
139 Ga0157380_13008508 3300014326 Bacteria 537
140 Ga0157379_10767556 3300014968 Bacteria 908
141 Ga0157379_11054440 3300014968 Bacteria 777
142 Ga0157376_10304290 3300014969 Unclassified 1510
143 Ga0163161_10011012 3300017792 Bacteria 6267
144 Ga0206356_10201895 3300020070 Bacteria 974
145 Ga0209759_1023286 3300025256 Bacteria 1366
146 Ga0209676_1000119 3300025292 Bacteria 201094
147 Ga0209676_1000282 3300025292 Bacteria 105777
148 Ga0209050_1000745 3300025298 Bacteria 46839
149 Ga0209050_1001911 3300025298 Bacteria 19933
150 Ga0209051_1003490 3300025303 Bacteria 10285
151 Ga0209257_1000332 3300025304 Bacteria 98632
152 Ga0209257_1008733 3300025304 Bacteria 5642
153 Ga0207655_1094825 3300025728 Bacteria 1042
154 Ga0207653_10003682 3300025885 Bacteria 4820
155 Ga0207692_10007391 3300025898 Bacteria 4506
156 Ga0207642_10001257 3300025899 Bacteria 7861
157 Ga0207642_10725109 3300025899 Bacteria 628
158 Ga0207688_10470267 3300025901 Bacteria 785
159 Ga0207680_10017388 3300025903 Bacteria 3798
160 Ga0207680_11345075 3300025903 Bacteria 507
161 Ga0207685_10487989 3300025905 Bacteria 646
162 Ga0207645_10000208 3300025907 Bacteria 48175
163 Ga0207643_10022858 3300025908 Unclassified 3446
164 Ga0207684_10748416 3300025910 Bacteria 828
165 Ga0207695_10039721 3300025913 Bacteria 5054
166 Ga0207695_10256786 3300025913 Bacteria 1646
167 Ga0207660_10766426 3300025917 Bacteria 787
168 Ga0207646_10393937 3300025922 Bacteria 1251
169 Ga0207664_11673462 3300025929 Bacteria 559
170 Ga0207690_10544264 3300025932 Bacteria 943
171 Ga0207706_10000168 3300025933 Bacteria 72574
172 Ga0207706_11463924 3300025933 Unclassified 558
173 Ga0207686_10002310 3300025934 Bacteria 10441
174 Ga0207709_10015706 3300025935 Bacteria 4202
175 Ga0207709_10466834 3300025935 Bacteria 979
176 Ga0207670_10012965 3300025936 Bacteria 4899
177 Ga0207669_10074546 3300025937 Bacteria 2146
178 Ga0207704_10001076 3300025938 Bacteria 12142
179 Ga0207691_10344754 3300025940 Bacteria 1275
180 Ga0207711_10005304 3300025941 Bacteria 10930
181 Ga0207711_11180606 3300025941 Bacteria 707
182 Ga0207689_10007132 3300025942 Bacteria 9829
183 Ga0207689_10055494 3300025942 Bacteria 3261
184 Ga0207679_10728764 3300025945 Bacteria 901
185 Ga0207667_10546784 3300025949 Bacteria 1171
186 Ga0207651_10024393 3300025960 Bacteria 3741
187 Ga0207712_10009780 3300025961 Bacteria 6078
188 Ga0207712_11615373 3300025961 Bacteria 581
189 Ga0207668_10012061 3300025972 Bacteria 5277
190 Ga0207640_10032702 3300025981 Bacteria 3227
191 Ga0207658_10020268 3300025986 Bacteria 4604
192 Ga0207677_10411061 3300026023 Bacteria 1150
193 Ga0207677_12252723 3300026023 Bacteria 507
194 Ga0207703_10030221 3300026035 Bacteria 4280
195 Ga0207639_12090679 3300026041 Bacteria 527
196 Ga0207678_10110030 3300026067 Bacteria 2350
197 Ga0207678_10210789 3300026067 Bacteria 1662
198 Ga0207708_10014226 3300026075 Bacteria 5950
199 Ga0207708_10252040 3300026075 Bacteria 1423
200 Ga0207702_10379212 3300026078 Bacteria 1360
201 Ga0207641_10627798 3300026088 Bacteria 1054
202 Ga0207641_10686899 3300026088 Bacteria 1007
203 Ga0207641_11187427 3300026088 Unclassified 762
204 Ga0207648_10005607 3300026089 Bacteria 12621
205 Ga0207676_10796787 3300026095 Bacteria 922
206 Ga0207676_11120163 3300026095 Bacteria 778
207 Ga0207674_10013242 3300026116 Bacteria 9165
208 Ga0207675_100031506 3300026118 Bacteria 4939
209 Ga0207675_100231471 3300026118 Bacteria 1783
210 Ga0207683_10840029 3300026121 Bacteria 853
211 Ga0207683_11139352 3300026121 Bacteria 723
212 Ga0209971_1075069 3300027682 Bacteria 822
213 Ga0268266_10915628 3300028379 Bacteria 848
214 Ga0268265_10402604 3300028380 Bacteria 1265
215 Ga0268265_10625474 3300028380 Bacteria 1032
216 Ga0268265_11190160 3300028380 Bacteria 759
217 Ga0268264_10015925 3300028381 Bacteria 6159
218 Ga0268264_10119337 3300028381 Bacteria 2322
219 Ga0316180_1077143 3300030736 Bacteria 507
220 Ga0316181_1239975 3300030744 Bacteria 542
221 Ga0307408_101609057 3300031548 Bacteria 617
222 Ga0307416_101112082 3300032002 Bacteria 895
223 Ga0373950_0041535 3300034818 Bacteria 882
224 Ga0373928_0113768 3300035084 Bacteria 718
225 Ga0373928_0194786 3300035084 Bacteria 582
226 Ga0373940_0037472 3300035088 Bacteria 1320
227 Ga0373951_0025428 3300035091 Bacteria 1376
228 Ga0373936_0344154 3300035113 Bacteria 678
229 Ga0373939_0518995 3300035114 Unclassified 511
230 Ga0373960_0056618 3300035121 Bacteria 1178
231 Ga0373943_0168757 3300035170 Bacteria 1196
232 Ga0373931_0157027 3300035691 Bacteria 1330
233 Ga0395900_0734069 3300037418 Bacteria 919
234 Ga0395905_0102941 3300037471 Bacteria 2681
235 Ga0395905_0222405 3300037471 Bacteria 1767
236 Ga0436364_0553599 3300037853 Bacteria 867
237 Ga0395901_0931566 3300038443 Unclassified 849
238 Ga0436365_1914496 3300039437 Bacteria 614
239 Ga0439453_0006580 3300041408 Bacteria 1814
240 Ga0439453_0095850 3300041408 Bacteria 656
241 Ga0451791_0565443 3300041451 Bacteria 723
242 Ga0451807_1548322 3300041486 Bacteria 950
243 Ga0439454_028038 3300042011 Bacteria 868
244 Ga0451577_0274690 3300042876 Unclassified 1526
245 Ga0466972_0001875 3300044658 Bacteria 10311
246 Ga0453683_0472652 3300044673 Bacteria 812
247 Ga0453683_0484287 3300044673 Bacteria 802
248 Ga0466965_0010140 3300044683 Bacteria 4387
249 Ga0466965_0059543 3300044683 Bacteria 1906
250 Ga0466966_0122546 3300044684 Bacteria 1596
251 Ga0453684_0127050 3300044712 Unclassified 3067
252 Ga0466968_0055077 3300044735 Bacteria 1706
253 Ga0466968_0079267 3300044735 Bacteria 1441
254 Ga0466960_0045464 3300044901 Bacteria 2098
255 Ga0466960_0092711 3300044901 Bacteria 1542
256 Ga0466959_0398766 3300045049 Unclassified 935
257 Ga0466959_0919861 3300045049 Unclassified 583
258 Ga0451576_0448368 3300045051 Unclassified 1354
259 Ga0466967_1408663 3300045976 Bacteria 694
260 Ga0495590_0263265 3300046457 Bacteria 643
261 Ga0495629_0213948 3300046459 Bacteria 1331
262 Ga0495580_0298523 3300046472 Bacteria 1097
263 Ga0495585_0044718 3300046492 Bacteria 2473
264 Ga0495594_0458932 3300046499 Unclassified 724
265 Ga0495607_0469873 3300046501 Bacteria 562
266 Ga0495630_0246904 3300046517 Bacteria 1364
267 Ga0495631_0067286 3300046518 Bacteria 1550
268 Ga0495642_0018924 3300046528 Bacteria 2696
269 Ga0495642_0289764 3300046528 Bacteria 717
270 Ga0495654_0185220 3300046530 Bacteria 899
271 Ga0495645_0106334 3300046543 Bacteria 1990
272 Ga0495622_0079333 3300046557 Bacteria 1511
273 Ga0495633_0142504 3300046558 Bacteria 1108
274 Ga0495656_0066459 3300046615 Bacteria 1588
275 Ga0495635_0713362 3300046663 Bacteria 650
276 Ga0495659_0005064 3300046664 Bacteria 4140
277 Ga0495661_0140749 3300046665 Bacteria 1313
278 Ga0495670_0001126 3300046691 Bacteria 12962
279 Ga0495670_0024247 3300046691 Bacteria 2998
280 Ga0495670_0127136 3300046691 Bacteria 1327
281 Ga0495670_0408162 3300046691 Unclassified 734
282 Ga0495581_0354032 3300047315 Unclassified 857
283 Ga0495636_0030633 3300047318 Unclassified 2201
284 Ga0495636_0290362 3300047318 Bacteria 763
285 Ga0495677_0033265 3300047445 Bacteria 1879
286 Ga0495681_0076699 3300047470 Bacteria 1502
287 Ga0495686_0009291 3300047472 Bacteria 7099
288 Ga0495686_0409061 3300047472 Unclassified 727
289 Ga0495593_0265034 3300047673 Bacteria 860
290 Ga0495615_0158504 3300048090 Bacteria 678
291 Ga0496100_0003306 3300048903 Bacteria 8387
292 Ga0496100_1238815 3300048903 Bacteria 589
293 Ga0496101_0003726 3300048904 Bacteria 9506
294 Ga0496101_0178884 3300048904 Bacteria 1633
295 Ga0496101_0878432 3300048904 Bacteria 706
296 Ga0496102_0031762 3300048905 Bacteria 4739
297 Ga0496102_0349288 3300048905 Bacteria 1392
298 Ga0496102_1029977 3300048905 Bacteria 743
299 Ga0496103_0008762 3300048906 Bacteria 6002
300 Ga0496103_0463668 3300048906 Bacteria 812
301 Ga0496104_0082181 3300048907 Bacteria 3072
302 Ga0496105_0099554 3300048908 Bacteria 2401
303 Ga0496106_0005978 3300048909 Bacteria 8994
304 Ga0496106_0282648 3300048909 Bacteria 1329
305 Ga0496106_0504072 3300048909 Bacteria 972
306 Ga0496106_1527156 3300048909 Bacteria 513
307 Ga0496107_0002897 3300048910 Bacteria 11335
308 Ga0496108_0004920 3300048911 Bacteria 10792
309 Ga0496108_0007211 3300048911 Bacteria 9010
310 Ga0496108_0157890 3300048911 Bacteria 1959
311 Ga0496108_0713067 3300048911 Bacteria 869
312 Ga0496108_0776785 3300048911 Bacteria 827
313 Ga0496109_0066845 3300048912 Bacteria 3292
314 Ga0496109_0069430 3300048912 Bacteria 3231
315 Ga0496109_0088582 3300048912 Bacteria 2860
316 Ga0496109_0261422 3300048912 Bacteria 1630
317 Ga0496109_0300970 3300048912 Bacteria 1512
318 Ga0496110_0045729 3300048913 Bacteria 3827
319 Ga0496110_0129231 3300048913 Bacteria 2280
320 Ga0496110_0175915 3300048913 Bacteria 1942
321 Ga0496110_0201053 3300048913 Bacteria 1810
322 Ga0496110_0516348 3300048913 Bacteria 1087
323 Ga0496111_0018760 3300048914 Bacteria 4794
324 Ga0496111_0096623 3300048914 Bacteria 2168
325 Ga0496111_0133695 3300048914 Bacteria 1836
326 Ga0496112_0043320 3300048915 Bacteria 4406
327 Ga0496112_0081632 3300048915 Bacteria 3197
328 Ga0496112_0104192 3300048915 Bacteria 2807
329 Ga0496112_0555958 3300048915 Bacteria 1081
330 Ga0496113_0013030 3300048916 Bacteria 5612
331 Ga0496113_0226417 3300048916 Bacteria 1491
332 Ga0496113_0661914 3300048916 Bacteria 835
333 Ga0496114_1577684 3300048917 Bacteria 544
334 Ga0496123_0347679 3300048926 Bacteria 691
335 Ga0496124_0022257 3300048927 Bacteria 5817
336 Ga0496124_0079906 3300048927 Bacteria 2692
337 Ga0496125_0218374 3300048928 Bacteria 1231
338 Ga0496126_0023915 3300048929 Bacteria 5908
339 Ga0501299_016953 3300049522 Bacteria 1295
340 Ga0501041_0228166 3300049577 Bacteria 1169
341 Ga0501041_0653660 3300049577 Bacteria 672
342 Ga0501042_0226410 3300049578 Bacteria 1349
343 Ga0501048_1331615 3300049582 Bacteria 516
344 Ga0501067_0214537 3300049583 Bacteria 1072
345 Ga0501068_1131710 3300049584 Bacteria 518
346 Ga0501070_0635381 3300049586 Bacteria 849
347 Ga0501072_0150884 3300049588 Bacteria 1853
348 Ga0501075_0330395 3300049591 Bacteria 1162
349 Ga0501216_026168 3300049660 Bacteria 1052
350 Ga0501079_0602159 3300049741 Bacteria 865
351 Ga0501081_0940443 3300049743 Bacteria 652
352 Ga0501045_0168141 3300049824 Bacteria 1633
353 nmdc:mga03n38_928440_c1 3300050490 Bacteria 513
354 nmdc:mga00v17_269277_c1 3300050491 Bacteria 1105
355 nmdc:mga0k408_104346_c1 3300050493 Bacteria 1673
356 nmdc:mga06z11_77715_c1 3300050494 Bacteria 1773
357 nmdc:mga07m45_147279_c1 3300050496 Bacteria 1365
358 nmdc:mga07m45_350178_c1 3300050496 Bacteria 858
359 nmdc:mga05p37_21195_c1 3300050507 Bacteria 7868
360 nmdc:mga09592_705442_c1 3300050508 Bacteria 858
361 nmdc:mga09592_7995_c1 3300050508 Bacteria 8599
362 nmdc:mga0qj67_543747_c1 3300050509 Bacteria 932
363 nmdc:mga06r32_77232_c1 3300050510 Bacteria 3234
364 nmdc:mga08y16_376693_c1 3300050511 Bacteria 1455
365 nmdc:mga08y16_519723_c1 3300050511 Bacteria 1207
366 nmdc:mga0n895_972655_c1 3300050512 Bacteria 831
367 nmdc:mga0a205_1214601_c1 3300050515 Bacteria 602
368 nmdc:mga0a205_336482_c1 3300050515 Bacteria 1378
369 nmdc:mga0sz30_6224_c1 3300050516 Bacteria 3660
370 Ga0500650_0123873 3300053098 Bacteria 1204
371 Ga0500555_100809 3300053103 Bacteria 733
372 Ga0500622_0028536 3300053156 Bacteria 2938
373 Ga0500636_0010281 3300053177 Bacteria 5454
374 Ga0501082_0670471 3300060353 Bacteria 908

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0122546 Ga0466966_0122546_415_759 105
2 3300045049 Ga0466959_0398766 Ga0466959_0398766_18_362 105
3 3300005458 Ga0070681_10165361 Ga0070681_101653615 106
4 3300009177 Ga0105248_10350517 Ga0105248_103505172 106
5 3300053177 Ga0500636_0010281 Ga0500636_0010281_4829_5158 106
6 3300003323 rootH1_10300328 rootH1_103003283 107
7 3300005435 Ga0070714_100059736 Ga0070714_1000597363 107
8 3300005437 Ga0070710_10000637 Ga0070710_100006375 107
9 3300007265 Ga0099794_10078170 Ga0099794_100781701 107
10 3300010159 Ga0099796_10150366 Ga0099796_101503662 107
11 3300025898 Ga0207692_10007391 Ga0207692_100073911 107
12 3300030736 Ga0316180_1077143 Ga0316180_10771431 107
13 3300030744 Ga0316181_1239975 Ga0316181_12399752 107
14 3300037853 Ga0436364_0553599 Ga0436364_0553599_104_436 107
15 3300041486 Ga0451807_1548322 Ga0451807_1548322_512_838 107
16 3300044658 Ga0466972_0001875 Ga0466972_0001875_2777_3103 107
17 3300044683 Ga0466965_0010140 Ga0466965_0010140_253_579 107
18 3300044683 Ga0466965_0059543 Ga0466965_0059543_1556_1882 107
19 3300044735 Ga0466968_0055077 Ga0466968_0055077_1112_1456 107
20 3300044735 Ga0466968_0079267 Ga0466968_0079267_520_846 107
21 3300044901 Ga0466960_0092711 Ga0466960_0092711_1049_1375 107
22 3300045049 Ga0466959_0919861 Ga0466959_0919861_36_380 107
23 3300048916 Ga0496113_0661914 Ga0496113_0661914_279_623 107
24 3300048926 Ga0496123_0347679 Ga0496123_0347679_207_551 107
25 3300048927 Ga0496124_0022257 Ga0496124_0022257_5003_5347 107
26 3300048927 Ga0496124_0079906 Ga0496124_0079906_1944_2285 107
27 3300048929 Ga0496126_0023915 Ga0496126_0023915_5395_5739 107
28 3300049586 Ga0501070_0635381 Ga0501070_0635381_508_834 107
29 3300050516 nmdc:mga0sz30_6224_c1 nmdc:mga0sz30_6224_c1_2449_2790 107
30 iso_pu_bacteria 2643221634 2644192138 107
31 iso_pu_bacteria 2837268691 2837269636 107
32 3300005366 Ga0070659_100260035 Ga0070659_1002600352 108
33 3300005457 Ga0070662_101075723 Ga0070662_1010757232 108
34 3300005981 Ga0081538_10011744 Ga0081538_100117443 108
35 3300005981 Ga0081538_10011744 Ga0081538_100117444 108
36 3300006353 Ga0075370_10207399 Ga0075370_102073992 108
37 3300025899 Ga0207642_10725109 Ga0207642_107251091 108
38 3300025901 Ga0207688_10470267 Ga0207688_104702671 108
39 3300025929 Ga0207664_11673462 Ga0207664_116734621 108
40 3300025932 Ga0207690_10544264 Ga0207690_105442642 108
41 3300025942 Ga0207689_10055494 Ga0207689_100554944 108
42 3300025945 Ga0207679_10728764 Ga0207679_107287641 108
43 3300025961 Ga0207712_11615373 Ga0207712_116153731 108
44 3300026023 Ga0207677_10411061 Ga0207677_104110612 108
45 3300026067 Ga0207678_10110030 Ga0207678_101100302 108
46 3300026088 Ga0207641_10627798 Ga0207641_106277982 108
47 3300026095 Ga0207676_10796787 Ga0207676_107967872 108
48 3300026121 Ga0207683_10840029 Ga0207683_108400291 108
49 3300028379 Ga0268266_10915628 Ga0268266_109156282 108
50 3300048903 Ga0496100_1238815 Ga0496100_1238815_66_398 108
51 3300048911 Ga0496108_0713067 Ga0496108_0713067_400_732 108
52 3300048912 Ga0496109_0300970 Ga0496109_0300970_1153_1485 108
53 3300048913 Ga0496110_0516348 Ga0496110_0516348_157_489 108
54 3300050496 nmdc:mga07m45_350178_c1 nmdc:mga07m45_350178_c1_14_370 108
55 3300003373 JGI25407J50210_10004489 JGI25407J50210_100044895 109
56 3300005981 Ga0081538_10000034 Ga0081538_10000034100 109
57 3300006038 Ga0075365_10671542 Ga0075365_106715421 109
58 3300041408 Ga0439453_0095850 Ga0439453_0095850_133_495 109
59 3300005436 Ga0070713_100229546 Ga0070713_1002295461 110
60 3300005843 Ga0068860_100214248 Ga0068860_1002142482 110
61 3300006175 Ga0070712_101296487 Ga0070712_1012964871 110
62 3300006871 Ga0075434_101115762 Ga0075434_1011157621 110
63 3300007076 Ga0075435_101283134 Ga0075435_1012831342 110
64 3300009176 Ga0105242_12146585 Ga0105242_121465851 110
65 3300028381 Ga0268264_10119337 Ga0268264_101193374 110
66 3300035113 Ga0373936_0344154 Ga0373936_0344154_275_619 110
67 3300035170 Ga0373943_0168757 Ga0373943_0168757_712_1056 110
68 3300039437 Ga0436365_1914496 Ga0436365_1914496_106_474 110
69 3300041408 Ga0439453_0006580 Ga0439453_0006580_448_846 110
70 3300041451 Ga0451791_0565443 Ga0451791_0565443_50_394 110
71 3300044901 Ga0466960_0045464 Ga0466960_0045464_990_1328 110
72 3300046459 Ga0495629_0213948 Ga0495629_0213948_385_729 110
73 3300046517 Ga0495630_0246904 Ga0495630_0246904_137_496 110
74 3300046663 Ga0495635_0713362 Ga0495635_0713362_186_530 110
75 3300047673 Ga0495593_0265034 Ga0495593_0265034_469_813 110
76 3300049577 Ga0501041_0228166 Ga0501041_0228166_651_989 110
77 3300049578 Ga0501042_0226410 Ga0501042_0226410_802_1140 110
78 3300049582 Ga0501048_1331615 Ga0501048_1331615_66_404 110
79 3300049588 Ga0501072_0150884 Ga0501072_0150884_360_701 110
80 3300049591 Ga0501075_0330395 Ga0501075_0330395_271_609 110
81 3300049741 Ga0501079_0602159 Ga0501079_0602159_386_724 110
82 3300049743 Ga0501081_0940443 Ga0501081_0940443_96_434 110
83 3300049824 Ga0501045_0168141 Ga0501045_0168141_518_856 110
84 3300050509 nmdc:mga0qj67_543747_c1 nmdc:mga0qj67_543747_c1_167_505 110
85 3300050512 nmdc:mga0n895_972655_c1 nmdc:mga0n895_972655_c1_406_765 110
86 3300060353 Ga0501082_0670471 Ga0501082_0670471_530_868 110
87 3300003781 Ga0055536_1006685 Ga0055536_10066854 111
88 3300003781 Ga0055536_1007630 Ga0055536_10076304 111
89 3300003791 Ga0055530_10006349 Ga0055530_100063494 111
90 3300003791 Ga0055530_10016055 Ga0055530_100160554 111
91 3300003794 Ga0055531_10000915 Ga0055531_1000091527 111
92 3300003794 Ga0055531_10008113 Ga0055531_100081134 111
93 3300003794 Ga0055531_10098863 Ga0055531_100988632 111
94 3300025292 Ga0209676_1000119 Ga0209676_100011964 111
95 3300025292 Ga0209676_1000282 Ga0209676_100028285 111
96 3300025298 Ga0209050_1000745 Ga0209050_100074527 111
97 3300025298 Ga0209050_1001911 Ga0209050_10019118 111
98 3300025303 Ga0209051_1003490 Ga0209051_10034907 111
99 3300025304 Ga0209257_1000332 Ga0209257_100033279 111
100 3300025304 Ga0209257_1008733 Ga0209257_10087333 111
101 3300045976 Ga0466967_1408663 Ga0466967_1408663_104_451 111
102 3300046492 Ga0495585_0044718 Ga0495585_0044718_1549_1887 111
103 3300046665 Ga0495661_0140749 Ga0495661_0140749_885_1223 111
104 3300047472 Ga0495686_0409061 Ga0495686_0409061_350_688 111
105 3300013296 Ga0157374_10672603 Ga0157374_106726031 112
106 3300025256 Ga0209759_1023286 Ga0209759_10232862 112
107 3300031548 Ga0307408_101609057 Ga0307408_1016090571 112
108 3300046472 Ga0495580_0298523 Ga0495580_0298523_698_1063 112
109 3300046543 Ga0495645_0106334 Ga0495645_0106334_1241_1591 112
110 3300048904 Ga0496101_0878432 Ga0496101_0878432_28_378 112
111 3300048906 Ga0496103_0463668 Ga0496103_0463668_157_507 112
112 3300048915 Ga0496112_0104192 Ga0496112_0104192_2287_2637 112
113 3300005262 Ga0065165_1123369 Ga0065165_11233692 113
114 3300005328 Ga0070676_10001329 Ga0070676_100013295 113
115 3300005330 Ga0070690_100037545 Ga0070690_1000375451 113
116 3300005334 Ga0068869_100013645 Ga0068869_1000136452 113
117 3300005336 Ga0070680_100412306 Ga0070680_1004123062 113
118 3300005338 Ga0068868_101218889 Ga0068868_1012188892 113
119 3300005341 Ga0070691_10017847 Ga0070691_100178472 113
120 3300005345 Ga0070692_10197120 Ga0070692_101971201 113
121 3300005347 Ga0070668_100038810 Ga0070668_1000388104 113
122 3300005353 Ga0070669_100102357 Ga0070669_1001023573 113
123 3300005356 Ga0070674_100000979 Ga0070674_10000097923 113
124 3300005364 Ga0070673_101220826 Ga0070673_1012208262 113
125 3300005367 Ga0070667_100012333 Ga0070667_1000123332 113
126 3300005438 Ga0070701_10236940 Ga0070701_102369401 113
127 3300005440 Ga0070705_100005859 Ga0070705_1000058593 113
128 3300005441 Ga0070700_100196290 Ga0070700_1001962902 113
129 3300005441 Ga0070700_100210801 Ga0070700_1002108013 113
130 3300005444 Ga0070694_100011899 Ga0070694_1000118997 113
131 3300005455 Ga0070663_100175943 Ga0070663_1001759433 113
132 3300005456 Ga0070678_100003011 Ga0070678_10000301114 113
133 3300005457 Ga0070662_100001633 Ga0070662_1000016333 113
134 3300005459 Ga0068867_100005547 Ga0068867_10000554710 113
135 3300005467 Ga0070706_100539465 Ga0070706_1005394652 113
136 3300005468 Ga0070707_100707104 Ga0070707_1007071042 113
137 3300005518 Ga0070699_100153130 Ga0070699_1001531303 113
138 3300005530 Ga0070679_100383032 Ga0070679_1003830321 113
139 3300005539 Ga0068853_100172611 Ga0068853_1001726112 113
140 3300005543 Ga0070672_100255596 Ga0070672_1002555961 113
141 3300005545 Ga0070695_100003158 Ga0070695_10000315813 113
142 3300005546 Ga0070696_100004172 Ga0070696_10000417213 113
143 3300005547 Ga0070693_100026465 Ga0070693_1000264652 113
144 3300005563 Ga0068855_100301587 Ga0068855_1003015873 113
145 3300005577 Ga0068857_100086927 Ga0068857_1000869273 113
146 3300005578 Ga0068854_100001781 Ga0068854_1000017816 113
147 3300005614 Ga0068856_100422258 Ga0068856_1004222583 113
148 3300005615 Ga0070702_100008694 Ga0070702_1000086947 113
149 3300005617 Ga0068859_100194245 Ga0068859_1001942453 113
150 3300005618 Ga0068864_100109884 Ga0068864_1001098842 113
151 3300005718 Ga0068866_10008575 Ga0068866_100085758 113
152 3300005719 Ga0068861_100035098 Ga0068861_1000350983 113
153 3300005840 Ga0068870_10022965 Ga0068870_100229654 113
154 3300005842 Ga0068858_100272227 Ga0068858_1002722273 113
155 3300005843 Ga0068860_100007967 Ga0068860_1000079679 113
156 3300005844 Ga0068862_101858966 Ga0068862_1018589661 113
157 3300006042 Ga0075368_10193602 Ga0075368_101936022 113
158 3300006048 Ga0075363_100391142 Ga0075363_1003911422 113
159 3300006177 Ga0075362_10029175 Ga0075362_100291752 113
160 3300006178 Ga0075367_10149000 Ga0075367_101490003 113
161 3300006195 Ga0075366_10043818 Ga0075366_100438182 113
162 3300006237 Ga0097621_100122735 Ga0097621_1001227353 113
163 3300006358 Ga0068871_100033152 Ga0068871_1000331528 113
164 3300006881 Ga0068865_100009821 Ga0068865_1000098215 113
165 3300006931 Ga0097620_100194242 Ga0097620_1001942423 113
166 3300009093 Ga0105240_10057796 Ga0105240_100577969 113
167 3300009094 Ga0111539_10492952 Ga0111539_104929522 113
168 3300009148 Ga0105243_10007844 Ga0105243_1000784413 113
169 3300009148 Ga0105243_10417747 Ga0105243_104177472 113
170 3300009176 Ga0105242_10001753 Ga0105242_100017533 113
171 3300009177 Ga0105248_10032276 Ga0105248_100322761 113
172 3300009553 Ga0105249_10024782 Ga0105249_100247824 113
173 3300009553 Ga0105249_10156669 Ga0105249_101566693 113
174 3300010375 Ga0105239_10242108 Ga0105239_102421082 113
175 3300011119 Ga0105246_10162133 Ga0105246_101621332 113
176 3300013102 Ga0157371_10912441 Ga0157371_109124411 113
177 3300013297 Ga0157378_10007186 Ga0157378_1000718610 113
178 3300013306 Ga0163162_10240519 Ga0163162_102405192 113
179 3300013306 Ga0163162_10267484 Ga0163162_102674841 113
180 3300013306 Ga0163162_11199371 Ga0163162_111993712 113
181 3300013307 Ga0157372_10155899 Ga0157372_101558993 113
182 3300013308 Ga0157375_11633769 Ga0157375_116337692 113
183 3300014326 Ga0157380_10080246 Ga0157380_100802462 113
184 3300014968 Ga0157379_11054440 Ga0157379_110544401 113
185 3300014969 Ga0157376_10304290 Ga0157376_103042901 113
186 3300017792 Ga0163161_10011012 Ga0163161_100110127 113
187 3300025885 Ga0207653_10003682 Ga0207653_100036828 113
188 3300025899 Ga0207642_10001257 Ga0207642_100012571 113
189 3300025903 Ga0207680_10017388 Ga0207680_100173881 113
190 3300025907 Ga0207645_10000208 Ga0207645_1000020851 113
191 3300025908 Ga0207643_10022858 Ga0207643_100228582 113
192 3300025910 Ga0207684_10748416 Ga0207684_107484162 113
193 3300025913 Ga0207695_10256786 Ga0207695_102567863 113
194 3300025917 Ga0207660_10766426 Ga0207660_107664262 113
195 3300025922 Ga0207646_10393937 Ga0207646_103939372 113
196 3300025933 Ga0207706_10000168 Ga0207706_100001683 113
197 3300025934 Ga0207686_10002310 Ga0207686_1000231016 113
198 3300025935 Ga0207709_10015706 Ga0207709_100157062 113
199 3300025935 Ga0207709_10466834 Ga0207709_104668342 113
200 3300025937 Ga0207669_10074546 Ga0207669_100745462 113
201 3300025938 Ga0207704_10001076 Ga0207704_100010764 113
202 3300025940 Ga0207691_10344754 Ga0207691_103447541 113
203 3300025941 Ga0207711_10005304 Ga0207711_1000530414 113
204 3300025942 Ga0207689_10007132 Ga0207689_1000713214 113
205 3300025949 Ga0207667_10546784 Ga0207667_105467841 113
206 3300025960 Ga0207651_10024393 Ga0207651_100243937 113
207 3300025961 Ga0207712_10009780 Ga0207712_100097807 113
208 3300025972 Ga0207668_10012061 Ga0207668_100120614 113
209 3300025981 Ga0207640_10032702 Ga0207640_100327026 113
210 3300025986 Ga0207658_10020268 Ga0207658_100202682 113
211 3300026023 Ga0207677_12252723 Ga0207677_122527232 113
212 3300026035 Ga0207703_10030221 Ga0207703_100302218 113
213 3300026041 Ga0207639_12090679 Ga0207639_120906792 113
214 3300026067 Ga0207678_10210789 Ga0207678_102107893 113
215 3300026075 Ga0207708_10014226 Ga0207708_100142269 113
216 3300026075 Ga0207708_10252040 Ga0207708_102520402 113
217 3300026078 Ga0207702_10379212 Ga0207702_103792121 113
218 3300026089 Ga0207648_10005607 Ga0207648_1000560714 113
219 3300026095 Ga0207676_11120163 Ga0207676_111201632 113
220 3300026116 Ga0207674_10013242 Ga0207674_100132423 113
221 3300026118 Ga0207675_100031506 Ga0207675_1000315063 113
222 3300026118 Ga0207675_100231471 Ga0207675_1002314713 113
223 3300028380 Ga0268265_10402604 Ga0268265_104026042 113
224 3300028380 Ga0268265_10625474 Ga0268265_106254742 113
225 3300028381 Ga0268264_10015925 Ga0268264_100159253 113
226 3300034818 Ga0373950_0041535 Ga0373950_0041535_409_765 113
227 3300035084 Ga0373928_0194786 Ga0373928_0194786_214_570 113
228 3300035121 Ga0373960_0056618 Ga0373960_0056618_29_385 113
229 3300044673 Ga0453683_0484287 Ga0453683_0484287_49_405 113
230 3300047318 Ga0495636_0030633 Ga0495636_0030633_611_967 113
231 3300047318 Ga0495636_0290362 Ga0495636_0290362_391_747 113
232 3300047472 Ga0495686_0009291 Ga0495686_0009291_942_1310 113
233 3300048904 Ga0496101_0178884 Ga0496101_0178884_851_1207 113
234 3300048909 Ga0496106_1527156 Ga0496106_1527156_119_475 113
235 3300048917 Ga0496114_1577684 Ga0496114_1577684_125_481 113
236 3300049577 Ga0501041_0653660 Ga0501041_0653660_227_580 113
237 3300050490 nmdc:mga03n38_928440_c1 nmdc:mga03n38_928440_c1_137_481 113
238 3300050491 nmdc:mga00v17_269277_c1 nmdc:mga00v17_269277_c1_317_661 113
239 3300050493 nmdc:mga0k408_104346_c1 nmdc:mga0k408_104346_c1_641_985 113
240 3300050494 nmdc:mga06z11_77715_c1 nmdc:mga06z11_77715_c1_365_709 113
241 3300050496 nmdc:mga07m45_147279_c1 nmdc:mga07m45_147279_c1_970_1314 113
242 3300050511 nmdc:mga08y16_376693_c1 nmdc:mga08y16_376693_c1_477_824 113
243 3300050515 nmdc:mga0a205_336482_c1 nmdc:mga0a205_336482_c1_26_382 113
244 3300003320 rootH2_10001360 rootH2_1000136011 114
245 3300005288 Ga0065714_10248691 Ga0065714_102486911 114
246 3300005340 Ga0070689_100004728 Ga0070689_1000047287 114
247 3300005353 Ga0070669_101381150 Ga0070669_1013811501 114
248 3300005456 Ga0070678_102130848 Ga0070678_1021308481 114
249 3300005467 Ga0070706_100599685 Ga0070706_1005996851 114
250 3300005518 Ga0070699_100139080 Ga0070699_1001390802 114
251 3300005543 Ga0070672_101141166 Ga0070672_1011411662 114
252 3300005544 Ga0070686_100095194 Ga0070686_1000951942 114
253 3300005563 Ga0068855_100037629 Ga0068855_1000376292 114
254 3300005616 Ga0068852_100923399 Ga0068852_1009233992 114
255 3300005617 Ga0068859_101767242 Ga0068859_1017672422 114
256 3300005618 Ga0068864_100026994 Ga0068864_1000269944 114
257 3300005618 Ga0068864_100099620 Ga0068864_1000996201 114
258 3300005841 Ga0068863_100100100 Ga0068863_1001001002 114
259 3300005843 Ga0068860_102251030 Ga0068860_1022510301 114
260 3300005844 Ga0068862_100288810 Ga0068862_1002888102 114
261 3300005937 Ga0081455_10261932 Ga0081455_102619322 114
262 3300005981 Ga0081538_10001209 Ga0081538_1000120925 114
263 3300006178 Ga0075367_10332738 Ga0075367_103327382 114
264 3300006844 Ga0075428_100363629 Ga0075428_1003636292 114
265 3300006847 Ga0075431_100019201 Ga0075431_1000192017 114
266 3300006852 Ga0075433_10700155 Ga0075433_107001551 114
267 3300006852 Ga0075433_10819205 Ga0075433_108192052 114
268 3300006880 Ga0075429_100676573 Ga0075429_1006765732 114
269 3300006931 Ga0097620_101767209 Ga0097620_1017672091 114
270 3300009036 Ga0105244_10024294 Ga0105244_100242943 114
271 3300009147 Ga0114129_10033766 Ga0114129_100337662 114
272 3300009177 Ga0105248_11247650 Ga0105248_112476501 114
273 3300009177 Ga0105248_12900032 Ga0105248_129000321 114
274 3300009545 Ga0105237_10437864 Ga0105237_104378642 114
275 3300009553 Ga0105249_10065000 Ga0105249_100650003 114
276 3300010159 Ga0099796_10074244 Ga0099796_100742442 114
277 3300010375 Ga0105239_11764452 Ga0105239_117644522 114
278 3300013105 Ga0157369_10002781 Ga0157369_1000278111 114
279 3300013306 Ga0163162_10015277 Ga0163162_100152779 114
280 3300013307 Ga0157372_10059597 Ga0157372_100595975 114
281 3300013308 Ga0157375_10185949 Ga0157375_101859492 114
282 3300014325 Ga0163163_10117496 Ga0163163_101174964 114
283 3300014326 Ga0157380_13008508 Ga0157380_130085081 114
284 3300014968 Ga0157379_10767556 Ga0157379_107675562 114
285 3300020070 Ga0206356_10201895 Ga0206356_102018952 114
286 3300025728 Ga0207655_1094825 Ga0207655_10948251 114
287 3300025903 Ga0207680_11345075 Ga0207680_113450751 114
288 3300025905 Ga0207685_10487989 Ga0207685_104879892 114
289 3300025913 Ga0207695_10039721 Ga0207695_100397212 114
290 3300025933 Ga0207706_11463924 Ga0207706_114639241 114
291 3300025936 Ga0207670_10012965 Ga0207670_100129653 114
292 3300025941 Ga0207711_11180606 Ga0207711_111806061 114
293 3300026088 Ga0207641_10686899 Ga0207641_106868992 114
294 3300026088 Ga0207641_11187427 Ga0207641_111874272 114
295 3300026121 Ga0207683_11139352 Ga0207683_111393522 114
296 3300027682 Ga0209971_1075069 Ga0209971_10750692 114
297 3300028380 Ga0268265_11190160 Ga0268265_111901601 114
298 3300032002 Ga0307416_101112082 Ga0307416_1011120822 114
299 3300035084 Ga0373928_0113768 Ga0373928_0113768_204_560 114
300 3300035088 Ga0373940_0037472 Ga0373940_0037472_725_1081 114
301 3300035091 Ga0373951_0025428 Ga0373951_0025428_976_1332 114
302 3300035114 Ga0373939_0518995 Ga0373939_0518995_62_418 114
303 3300035691 Ga0373931_0157027 Ga0373931_0157027_624_980 114
304 3300037418 Ga0395900_0734069 Ga0395900_0734069_82_438 114
305 3300037471 Ga0395905_0102941 Ga0395905_0102941_864_1220 114
306 3300037471 Ga0395905_0222405 Ga0395905_0222405_969_1322 114
307 3300038443 Ga0395901_0931566 Ga0395901_0931566_404_760 114
308 3300042011 Ga0439454_028038 Ga0439454_028038_260_682 114
309 3300042876 Ga0451577_0274690 Ga0451577_0274690_234_593 114
310 3300044673 Ga0453683_0472652 Ga0453683_0472652_122_481 114
311 3300044712 Ga0453684_0127050 Ga0453684_0127050_1932_2291 114
312 3300045051 Ga0451576_0448368 Ga0451576_0448368_486_845 114
313 3300046457 Ga0495590_0263265 Ga0495590_0263265_17_388 114
314 3300046499 Ga0495594_0458932 Ga0495594_0458932_228_587 114
315 3300046501 Ga0495607_0469873 Ga0495607_0469873_12_383 114
316 3300046518 Ga0495631_0067286 Ga0495631_0067286_689_1060 114
317 3300046528 Ga0495642_0018924 Ga0495642_0018924_2021_2392 114
318 3300046528 Ga0495642_0289764 Ga0495642_0289764_148_519 114
319 3300046530 Ga0495654_0185220 Ga0495654_0185220_197_568 114
320 3300046557 Ga0495622_0079333 Ga0495622_0079333_66_425 114
321 3300046558 Ga0495633_0142504 Ga0495633_0142504_64_435 114
322 3300046615 Ga0495656_0066459 Ga0495656_0066459_987_1358 114
323 3300046664 Ga0495659_0005064 Ga0495659_0005064_1824_2195 114
324 3300046691 Ga0495670_0001126 Ga0495670_0001126_12561_12932 114
325 3300046691 Ga0495670_0024247 Ga0495670_0024247_2165_2536 114
326 3300046691 Ga0495670_0127136 Ga0495670_0127136_35_406 114
327 3300046691 Ga0495670_0408162 Ga0495670_0408162_234_605 114
328 3300047315 Ga0495581_0354032 Ga0495581_0354032_200_571 114
329 3300047445 Ga0495677_0033265 Ga0495677_0033265_1040_1411 114
330 3300047470 Ga0495681_0076699 Ga0495681_0076699_237_608 114
331 3300048090 Ga0495615_0158504 Ga0495615_0158504_230_601 114
332 3300048903 Ga0496100_0003306 Ga0496100_0003306_4726_5097 114
333 3300048904 Ga0496101_0003726 Ga0496101_0003726_4301_4672 114
334 3300048905 Ga0496102_0031762 Ga0496102_0031762_902_1273 114
335 3300048905 Ga0496102_0349288 Ga0496102_0349288_759_1130 114
336 3300048905 Ga0496102_1029977 Ga0496102_1029977_210_614 114
337 3300048906 Ga0496103_0008762 Ga0496103_0008762_3027_3398 114
338 3300048907 Ga0496104_0082181 Ga0496104_0082181_1211_1567 114
339 3300048908 Ga0496105_0099554 Ga0496105_0099554_1257_1613 114
340 3300048909 Ga0496106_0005978 Ga0496106_0005978_4582_4953 114
341 3300048909 Ga0496106_0282648 Ga0496106_0282648_316_672 114
342 3300048909 Ga0496106_0504072 Ga0496106_0504072_593_949 114
343 3300048910 Ga0496107_0002897 Ga0496107_0002897_4492_4863 114
344 3300048911 Ga0496108_0004920 Ga0496108_0004920_1368_1724 114
345 3300048911 Ga0496108_0007211 Ga0496108_0007211_7377_7733 114
346 3300048911 Ga0496108_0157890 Ga0496108_0157890_637_1008 114
347 3300048911 Ga0496108_0776785 Ga0496108_0776785_420_773 114
348 3300048912 Ga0496109_0066845 Ga0496109_0066845_1603_1959 114
349 3300048912 Ga0496109_0069430 Ga0496109_0069430_2554_2925 114
350 3300048912 Ga0496109_0088582 Ga0496109_0088582_1167_1523 114
351 3300048912 Ga0496109_0261422 Ga0496109_0261422_163_534 114
352 3300048913 Ga0496110_0045729 Ga0496110_0045729_2604_2975 114
353 3300048913 Ga0496110_0129231 Ga0496110_0129231_1149_1505 114
354 3300048913 Ga0496110_0175915 Ga0496110_0175915_1451_1807 114
355 3300048913 Ga0496110_0201053 Ga0496110_0201053_1057_1428 114
356 3300048914 Ga0496111_0018760 Ga0496111_0018760_992_1363 114
357 3300048914 Ga0496111_0096623 Ga0496111_0096623_1514_1870 114
358 3300048914 Ga0496111_0133695 Ga0496111_0133695_223_594 114
359 3300048915 Ga0496112_0043320 Ga0496112_0043320_2705_3061 114
360 3300048915 Ga0496112_0081632 Ga0496112_0081632_1603_1959 114
361 3300048915 Ga0496112_0555958 Ga0496112_0555958_345_701 114
362 3300048916 Ga0496113_0013030 Ga0496113_0013030_4121_4477 114
363 3300048916 Ga0496113_0226417 Ga0496113_0226417_740_1093 114
364 3300048928 Ga0496125_0218374 Ga0496125_0218374_168_539 114
365 3300049522 Ga0501299_016953 Ga0501299_016953_338_703 114
366 3300049583 Ga0501067_0214537 Ga0501067_0214537_27_389 114
367 3300049584 Ga0501068_1131710 Ga0501068_1131710_32_394 114
368 3300049660 Ga0501216_026168 Ga0501216_026168_330_695 114
369 3300050507 nmdc:mga05p37_21195_c1 nmdc:mga05p37_21195_c1_1117_1470 114
370 3300050508 nmdc:mga09592_705442_c1 nmdc:mga09592_705442_c1_421_786 114
371 3300050508 nmdc:mga09592_7995_c1 nmdc:mga09592_7995_c1_6831_7184 114
372 3300050510 nmdc:mga06r32_77232_c1 nmdc:mga06r32_77232_c1_800_1153 114
373 3300050511 nmdc:mga08y16_519723_c1 nmdc:mga08y16_519723_c1_232_591 114
374 3300050515 nmdc:mga0a205_1214601_c1 nmdc:mga0a205_1214601_c1_66_422 114
375 3300053098 Ga0500650_0123873 Ga0500650_0123873_674_1018 114
376 3300053103 Ga0500555_100809 Ga0500555_100809_117_461 114
377 3300053156 Ga0500622_0028536 Ga0500622_0028536_1448_1822 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

26

72

0.98

PF12840

HTH_20

Helix-turn-helix domain

24

73

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

26

71

0.98

PF09339

HTH_IclR

IclR helix-turn-helix domain

30

74

0.9

PF01047

MarR

MarR family

27

77

0.89

PF12802

MarR_2

MarR family

26

77

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9557 3 86
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9474 3 88
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9163 8 84
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9111 3 91
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9052 4 91
ID Description Score Start End Superfamily
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9387 4 81 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9371 16 71 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9278 14 70 1.10.10.10
af_I1J7S3_149_266_1.10.10.1890 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ska1 microtubule binding domain-like 0.9267 44 71 1.10.10.1890
af_A0A1D6HDX3_114_200_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9216 14 63 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q7WQW8-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9795 5 83 GO:0003677
GO:0003700
AF-H1S4V4-F1-model_v4 ArsR family transcriptional regulator 0.9751 2 83 GO:0003700
AF-A0A1S2J3F8-F1-model_v4 deleted 0.9728 3 87
AF-A0A2M8HG34-F1-model_v4 Transcriptional regulator 0.9694 4 88 GO:0003700
AF-A0A2D7C7C1-F1-model_v4 Transcriptional regulator 0.9685 6 88 GO:0003700

Feature Viewer

pLDDT pTM Quality
91.62 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map