F427816
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 377 | 267 | 374 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_1029977|Ga0496102_1029977_210_614 |
| Length | 134 |
| Sequence | MIVKYEGGAHQMPTDRLSLIFSALADPTRRAILARLAEGEATVNELAEPFDISLPAVSRHLKVLEAAGLITRSRNAQWRSSKLEAAPLREVAEYMEEYRRFWDASFSRLDAHLRKIQQVPKNQEPGNEHAAEHP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 2 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 161 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 179 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 181 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 234 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 247 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 251 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 252 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 253 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 264 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 265 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 266 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.2 |
| Metatranscriptomes | 0.27 |
| Isolates | 0.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.02 |
| Nodule | 0 |
| Rhizoplane | 11.94 |
| Rhizosphere | 76.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10001360 | 3300003320 | Bacteria | 48496 |
| 2 | rootH1_10300328 | 3300003323 | Bacteria | 2231 |
| 3 | JGI25407J50210_10004489 | 3300003373 | Bacteria | 3394 |
| 4 | Ga0055536_1006685 | 3300003781 | Bacteria | 5304 |
| 5 | Ga0055536_1007630 | 3300003781 | Bacteria | 4798 |
| 6 | Ga0055530_10006349 | 3300003791 | Bacteria | 5304 |
| 7 | Ga0055530_10016055 | 3300003791 | Bacteria | 2408 |
| 8 | Ga0055531_10000915 | 3300003794 | Bacteria | 23931 |
| 9 | Ga0055531_10008113 | 3300003794 | Bacteria | 5596 |
| 10 | Ga0055531_10098863 | 3300003794 | Bacteria | 603 |
| 11 | Ga0065165_1123369 | 3300005262 | Bacteria | 626 |
| 12 | Ga0065714_10248691 | 3300005288 | Bacteria | 780 |
| 13 | Ga0070676_10001329 | 3300005328 | Bacteria | 12424 |
| 14 | Ga0070690_100037545 | 3300005330 | Bacteria | 3054 |
| 15 | Ga0068869_100013645 | 3300005334 | Bacteria | 5410 |
| 16 | Ga0070680_100412306 | 3300005336 | Bacteria | 1152 |
| 17 | Ga0068868_101218889 | 3300005338 | Bacteria | 696 |
| 18 | Ga0070689_100004728 | 3300005340 | Bacteria | 9240 |
| 19 | Ga0070691_10017847 | 3300005341 | Bacteria | 3265 |
| 20 | Ga0070692_10197120 | 3300005345 | Bacteria | 1177 |
| 21 | Ga0070668_100038810 | 3300005347 | Bacteria | 3642 |
| 22 | Ga0070669_100102357 | 3300005353 | Bacteria | 2162 |
| 23 | Ga0070669_101381150 | 3300005353 | Bacteria | 611 |
| 24 | Ga0070674_100000979 | 3300005356 | Bacteria | 14891 |
| 25 | Ga0070673_101220826 | 3300005364 | Bacteria | 705 |
| 26 | Ga0070659_100260035 | 3300005366 | Bacteria | 1440 |
| 27 | Ga0070667_100012333 | 3300005367 | Bacteria | 7071 |
| 28 | Ga0070714_100059736 | 3300005435 | Bacteria | 3270 |
| 29 | Ga0070713_100229546 | 3300005436 | Bacteria | 1687 |
| 30 | Ga0070710_10000637 | 3300005437 | Bacteria | 16704 |
| 31 | Ga0070701_10236940 | 3300005438 | Bacteria | 1096 |
| 32 | Ga0070705_100005859 | 3300005440 | Bacteria | 6007 |
| 33 | Ga0070700_100196290 | 3300005441 | Bacteria | 1415 |
| 34 | Ga0070700_100210801 | 3300005441 | Bacteria | 1371 |
| 35 | Ga0070694_100011899 | 3300005444 | Bacteria | 5399 |
| 36 | Ga0070663_100175943 | 3300005455 | Bacteria | 1657 |
| 37 | Ga0070678_100003011 | 3300005456 | Bacteria | 9338 |
| 38 | Ga0070678_102130848 | 3300005456 | Bacteria | 531 |
| 39 | Ga0070662_100001633 | 3300005457 | Bacteria | 13833 |
| 40 | Ga0070662_101075723 | 3300005457 | Bacteria | 690 |
| 41 | Ga0070681_10165361 | 3300005458 | Bacteria | 2135 |
| 42 | Ga0068867_100005547 | 3300005459 | Bacteria | 8936 |
| 43 | Ga0070706_100539465 | 3300005467 | Bacteria | 1085 |
| 44 | Ga0070706_100599685 | 3300005467 | Bacteria | 1023 |
| 45 | Ga0070707_100707104 | 3300005468 | Bacteria | 971 |
| 46 | Ga0070699_100139080 | 3300005518 | Bacteria | 2143 |
| 47 | Ga0070699_100153130 | 3300005518 | Bacteria | 2040 |
| 48 | Ga0070679_100383032 | 3300005530 | Bacteria | 1353 |
| 49 | Ga0068853_100172611 | 3300005539 | Bacteria | 1957 |
| 50 | Ga0070672_100255596 | 3300005543 | Bacteria | 1476 |
| 51 | Ga0070672_101141166 | 3300005543 | Bacteria | 693 |
| 52 | Ga0070686_100095194 | 3300005544 | Bacteria | 2000 |
| 53 | Ga0070695_100003158 | 3300005545 | Bacteria | 9612 |
| 54 | Ga0070696_100004172 | 3300005546 | Bacteria | 9628 |
| 55 | Ga0070693_100026465 | 3300005547 | Bacteria | 3132 |
| 56 | Ga0068855_100037629 | 3300005563 | Bacteria | 5753 |
| 57 | Ga0068855_100301587 | 3300005563 | Bacteria | 1774 |
| 58 | Ga0068857_100086927 | 3300005577 | Unclassified | 2796 |
| 59 | Ga0068854_100001781 | 3300005578 | Bacteria | 13115 |
| 60 | Ga0068856_100422258 | 3300005614 | Bacteria | 1353 |
| 61 | Ga0070702_100008694 | 3300005615 | Bacteria | 4931 |
| 62 | Ga0068852_100923399 | 3300005616 | Bacteria | 890 |
| 63 | Ga0068859_100194245 | 3300005617 | Bacteria | 2114 |
| 64 | Ga0068859_101767242 | 3300005617 | Bacteria | 683 |
| 65 | Ga0068864_100026994 | 3300005618 | Bacteria | 4844 |
| 66 | Ga0068864_100099620 | 3300005618 | Bacteria | 2575 |
| 67 | Ga0068864_100109884 | 3300005618 | Bacteria | 2455 |
| 68 | Ga0068866_10008575 | 3300005718 | Bacteria | 4314 |
| 69 | Ga0068861_100035098 | 3300005719 | Bacteria | 3713 |
| 70 | Ga0068870_10022965 | 3300005840 | Unclassified | 3070 |
| 71 | Ga0068863_100100100 | 3300005841 | Bacteria | 2754 |
| 72 | Ga0068858_100272227 | 3300005842 | Bacteria | 1612 |
| 73 | Ga0068860_100007967 | 3300005843 | Bacteria | 10566 |
| 74 | Ga0068860_100214248 | 3300005843 | Bacteria | 1869 |
| 75 | Ga0068860_102251030 | 3300005843 | Bacteria | 566 |
| 76 | Ga0068862_100288810 | 3300005844 | Unclassified | 1505 |
| 77 | Ga0068862_101858966 | 3300005844 | Bacteria | 612 |
| 78 | Ga0081455_10261932 | 3300005937 | Bacteria | 1259 |
| 79 | Ga0081538_10000034 | 3300005981 | Bacteria | 120557 |
| 80 | Ga0081538_10001209 | 3300005981 | Bacteria | 27097 |
| 81 | Ga0081538_10011744 | 3300005981 | Bacteria | 7066 |
| 82 | Ga0075365_10671542 | 3300006038 | Bacteria | 732 |
| 83 | Ga0075368_10193602 | 3300006042 | Bacteria | 859 |
| 84 | Ga0075363_100391142 | 3300006048 | Bacteria | 816 |
| 85 | Ga0070712_101296487 | 3300006175 | Bacteria | 635 |
| 86 | Ga0075362_10029175 | 3300006177 | Bacteria | 2375 |
| 87 | Ga0075367_10149000 | 3300006178 | Bacteria | 1451 |
| 88 | Ga0075367_10332738 | 3300006178 | Bacteria | 957 |
| 89 | Ga0075366_10043818 | 3300006195 | Bacteria | 2651 |
| 90 | Ga0097621_100122735 | 3300006237 | Bacteria | 2205 |
| 91 | Ga0075370_10207399 | 3300006353 | Bacteria | 1157 |
| 92 | Ga0068871_100033152 | 3300006358 | Bacteria | 4087 |
| 93 | Ga0075428_100363629 | 3300006844 | Bacteria | 1552 |
| 94 | Ga0075431_100019201 | 3300006847 | Bacteria | 6967 |
| 95 | Ga0075433_10700155 | 3300006852 | Bacteria | 887 |
| 96 | Ga0075433_10819205 | 3300006852 | Bacteria | 813 |
| 97 | Ga0075434_101115762 | 3300006871 | Bacteria | 802 |
| 98 | Ga0075429_100676573 | 3300006880 | Bacteria | 904 |
| 99 | Ga0068865_100009821 | 3300006881 | Bacteria | 5943 |
| 100 | Ga0097620_100194242 | 3300006931 | Bacteria | 2114 |
| 101 | Ga0097620_101767209 | 3300006931 | Bacteria | 683 |
| 102 | Ga0075435_101283134 | 3300007076 | Bacteria | 641 |
| 103 | Ga0099794_10078170 | 3300007265 | Bacteria | 1629 |
| 104 | Ga0105244_10024294 | 3300009036 | Bacteria | 3309 |
| 105 | Ga0105240_10057796 | 3300009093 | Bacteria | 4844 |
| 106 | Ga0111539_10492952 | 3300009094 | Bacteria | 1427 |
| 107 | Ga0114129_10033766 | 3300009147 | Bacteria | 7228 |
| 108 | Ga0105243_10007844 | 3300009148 | Bacteria | 8206 |
| 109 | Ga0105243_10417747 | 3300009148 | Unclassified | 1250 |
| 110 | Ga0105242_10001753 | 3300009176 | Bacteria | 17138 |
| 111 | Ga0105242_12146585 | 3300009176 | Bacteria | 603 |
| 112 | Ga0105248_10032276 | 3300009177 | Bacteria | 5854 |
| 113 | Ga0105248_10350517 | 3300009177 | Unclassified | 1662 |
| 114 | Ga0105248_11247650 | 3300009177 | Unclassified | 841 |
| 115 | Ga0105248_12900032 | 3300009177 | Unclassified | 547 |
| 116 | Ga0105237_10437864 | 3300009545 | Bacteria | 1313 |
| 117 | Ga0105249_10024782 | 3300009553 | Bacteria | 5394 |
| 118 | Ga0105249_10065000 | 3300009553 | Unclassified | 3355 |
| 119 | Ga0105249_10156669 | 3300009553 | Bacteria | 2197 |
| 120 | Ga0099796_10074244 | 3300010159 | Bacteria | 1234 |
| 121 | Ga0099796_10150366 | 3300010159 | Bacteria | 916 |
| 122 | Ga0105239_10242108 | 3300010375 | Bacteria | 2025 |
| 123 | Ga0105239_11764452 | 3300010375 | Bacteria | 717 |
| 124 | Ga0105246_10162133 | 3300011119 | Unclassified | 1704 |
| 125 | Ga0157371_10912441 | 3300013102 | Bacteria | 667 |
| 126 | Ga0157369_10002781 | 3300013105 | Bacteria | 20894 |
| 127 | Ga0157374_10672603 | 3300013296 | Bacteria | 1047 |
| 128 | Ga0157378_10007186 | 3300013297 | Bacteria | 9726 |
| 129 | Ga0163162_10015277 | 3300013306 | Bacteria | 7499 |
| 130 | Ga0163162_10240519 | 3300013306 | Bacteria | 1941 |
| 131 | Ga0163162_10267484 | 3300013306 | Bacteria | 1841 |
| 132 | Ga0163162_11199371 | 3300013306 | Unclassified | 861 |
| 133 | Ga0157372_10059597 | 3300013307 | Bacteria | 4270 |
| 134 | Ga0157372_10155899 | 3300013307 | Bacteria | 2638 |
| 135 | Ga0157375_10185949 | 3300013308 | Bacteria | 2231 |
| 136 | Ga0157375_11633769 | 3300013308 | Bacteria | 762 |
| 137 | Ga0163163_10117496 | 3300014325 | Bacteria | 2691 |
| 138 | Ga0157380_10080246 | 3300014326 | Bacteria | 2667 |
| 139 | Ga0157380_13008508 | 3300014326 | Bacteria | 537 |
| 140 | Ga0157379_10767556 | 3300014968 | Bacteria | 908 |
| 141 | Ga0157379_11054440 | 3300014968 | Bacteria | 777 |
| 142 | Ga0157376_10304290 | 3300014969 | Unclassified | 1510 |
| 143 | Ga0163161_10011012 | 3300017792 | Bacteria | 6267 |
| 144 | Ga0206356_10201895 | 3300020070 | Bacteria | 974 |
| 145 | Ga0209759_1023286 | 3300025256 | Bacteria | 1366 |
| 146 | Ga0209676_1000119 | 3300025292 | Bacteria | 201094 |
| 147 | Ga0209676_1000282 | 3300025292 | Bacteria | 105777 |
| 148 | Ga0209050_1000745 | 3300025298 | Bacteria | 46839 |
| 149 | Ga0209050_1001911 | 3300025298 | Bacteria | 19933 |
| 150 | Ga0209051_1003490 | 3300025303 | Bacteria | 10285 |
| 151 | Ga0209257_1000332 | 3300025304 | Bacteria | 98632 |
| 152 | Ga0209257_1008733 | 3300025304 | Bacteria | 5642 |
| 153 | Ga0207655_1094825 | 3300025728 | Bacteria | 1042 |
| 154 | Ga0207653_10003682 | 3300025885 | Bacteria | 4820 |
| 155 | Ga0207692_10007391 | 3300025898 | Bacteria | 4506 |
| 156 | Ga0207642_10001257 | 3300025899 | Bacteria | 7861 |
| 157 | Ga0207642_10725109 | 3300025899 | Bacteria | 628 |
| 158 | Ga0207688_10470267 | 3300025901 | Bacteria | 785 |
| 159 | Ga0207680_10017388 | 3300025903 | Bacteria | 3798 |
| 160 | Ga0207680_11345075 | 3300025903 | Bacteria | 507 |
| 161 | Ga0207685_10487989 | 3300025905 | Bacteria | 646 |
| 162 | Ga0207645_10000208 | 3300025907 | Bacteria | 48175 |
| 163 | Ga0207643_10022858 | 3300025908 | Unclassified | 3446 |
| 164 | Ga0207684_10748416 | 3300025910 | Bacteria | 828 |
| 165 | Ga0207695_10039721 | 3300025913 | Bacteria | 5054 |
| 166 | Ga0207695_10256786 | 3300025913 | Bacteria | 1646 |
| 167 | Ga0207660_10766426 | 3300025917 | Bacteria | 787 |
| 168 | Ga0207646_10393937 | 3300025922 | Bacteria | 1251 |
| 169 | Ga0207664_11673462 | 3300025929 | Bacteria | 559 |
| 170 | Ga0207690_10544264 | 3300025932 | Bacteria | 943 |
| 171 | Ga0207706_10000168 | 3300025933 | Bacteria | 72574 |
| 172 | Ga0207706_11463924 | 3300025933 | Unclassified | 558 |
| 173 | Ga0207686_10002310 | 3300025934 | Bacteria | 10441 |
| 174 | Ga0207709_10015706 | 3300025935 | Bacteria | 4202 |
| 175 | Ga0207709_10466834 | 3300025935 | Bacteria | 979 |
| 176 | Ga0207670_10012965 | 3300025936 | Bacteria | 4899 |
| 177 | Ga0207669_10074546 | 3300025937 | Bacteria | 2146 |
| 178 | Ga0207704_10001076 | 3300025938 | Bacteria | 12142 |
| 179 | Ga0207691_10344754 | 3300025940 | Bacteria | 1275 |
| 180 | Ga0207711_10005304 | 3300025941 | Bacteria | 10930 |
| 181 | Ga0207711_11180606 | 3300025941 | Bacteria | 707 |
| 182 | Ga0207689_10007132 | 3300025942 | Bacteria | 9829 |
| 183 | Ga0207689_10055494 | 3300025942 | Bacteria | 3261 |
| 184 | Ga0207679_10728764 | 3300025945 | Bacteria | 901 |
| 185 | Ga0207667_10546784 | 3300025949 | Bacteria | 1171 |
| 186 | Ga0207651_10024393 | 3300025960 | Bacteria | 3741 |
| 187 | Ga0207712_10009780 | 3300025961 | Bacteria | 6078 |
| 188 | Ga0207712_11615373 | 3300025961 | Bacteria | 581 |
| 189 | Ga0207668_10012061 | 3300025972 | Bacteria | 5277 |
| 190 | Ga0207640_10032702 | 3300025981 | Bacteria | 3227 |
| 191 | Ga0207658_10020268 | 3300025986 | Bacteria | 4604 |
| 192 | Ga0207677_10411061 | 3300026023 | Bacteria | 1150 |
| 193 | Ga0207677_12252723 | 3300026023 | Bacteria | 507 |
| 194 | Ga0207703_10030221 | 3300026035 | Bacteria | 4280 |
| 195 | Ga0207639_12090679 | 3300026041 | Bacteria | 527 |
| 196 | Ga0207678_10110030 | 3300026067 | Bacteria | 2350 |
| 197 | Ga0207678_10210789 | 3300026067 | Bacteria | 1662 |
| 198 | Ga0207708_10014226 | 3300026075 | Bacteria | 5950 |
| 199 | Ga0207708_10252040 | 3300026075 | Bacteria | 1423 |
| 200 | Ga0207702_10379212 | 3300026078 | Bacteria | 1360 |
| 201 | Ga0207641_10627798 | 3300026088 | Bacteria | 1054 |
| 202 | Ga0207641_10686899 | 3300026088 | Bacteria | 1007 |
| 203 | Ga0207641_11187427 | 3300026088 | Unclassified | 762 |
| 204 | Ga0207648_10005607 | 3300026089 | Bacteria | 12621 |
| 205 | Ga0207676_10796787 | 3300026095 | Bacteria | 922 |
| 206 | Ga0207676_11120163 | 3300026095 | Bacteria | 778 |
| 207 | Ga0207674_10013242 | 3300026116 | Bacteria | 9165 |
| 208 | Ga0207675_100031506 | 3300026118 | Bacteria | 4939 |
| 209 | Ga0207675_100231471 | 3300026118 | Bacteria | 1783 |
| 210 | Ga0207683_10840029 | 3300026121 | Bacteria | 853 |
| 211 | Ga0207683_11139352 | 3300026121 | Bacteria | 723 |
| 212 | Ga0209971_1075069 | 3300027682 | Bacteria | 822 |
| 213 | Ga0268266_10915628 | 3300028379 | Bacteria | 848 |
| 214 | Ga0268265_10402604 | 3300028380 | Bacteria | 1265 |
| 215 | Ga0268265_10625474 | 3300028380 | Bacteria | 1032 |
| 216 | Ga0268265_11190160 | 3300028380 | Bacteria | 759 |
| 217 | Ga0268264_10015925 | 3300028381 | Bacteria | 6159 |
| 218 | Ga0268264_10119337 | 3300028381 | Bacteria | 2322 |
| 219 | Ga0316180_1077143 | 3300030736 | Bacteria | 507 |
| 220 | Ga0316181_1239975 | 3300030744 | Bacteria | 542 |
| 221 | Ga0307408_101609057 | 3300031548 | Bacteria | 617 |
| 222 | Ga0307416_101112082 | 3300032002 | Bacteria | 895 |
| 223 | Ga0373950_0041535 | 3300034818 | Bacteria | 882 |
| 224 | Ga0373928_0113768 | 3300035084 | Bacteria | 718 |
| 225 | Ga0373928_0194786 | 3300035084 | Bacteria | 582 |
| 226 | Ga0373940_0037472 | 3300035088 | Bacteria | 1320 |
| 227 | Ga0373951_0025428 | 3300035091 | Bacteria | 1376 |
| 228 | Ga0373936_0344154 | 3300035113 | Bacteria | 678 |
| 229 | Ga0373939_0518995 | 3300035114 | Unclassified | 511 |
| 230 | Ga0373960_0056618 | 3300035121 | Bacteria | 1178 |
| 231 | Ga0373943_0168757 | 3300035170 | Bacteria | 1196 |
| 232 | Ga0373931_0157027 | 3300035691 | Bacteria | 1330 |
| 233 | Ga0395900_0734069 | 3300037418 | Bacteria | 919 |
| 234 | Ga0395905_0102941 | 3300037471 | Bacteria | 2681 |
| 235 | Ga0395905_0222405 | 3300037471 | Bacteria | 1767 |
| 236 | Ga0436364_0553599 | 3300037853 | Bacteria | 867 |
| 237 | Ga0395901_0931566 | 3300038443 | Unclassified | 849 |
| 238 | Ga0436365_1914496 | 3300039437 | Bacteria | 614 |
| 239 | Ga0439453_0006580 | 3300041408 | Bacteria | 1814 |
| 240 | Ga0439453_0095850 | 3300041408 | Bacteria | 656 |
| 241 | Ga0451791_0565443 | 3300041451 | Bacteria | 723 |
| 242 | Ga0451807_1548322 | 3300041486 | Bacteria | 950 |
| 243 | Ga0439454_028038 | 3300042011 | Bacteria | 868 |
| 244 | Ga0451577_0274690 | 3300042876 | Unclassified | 1526 |
| 245 | Ga0466972_0001875 | 3300044658 | Bacteria | 10311 |
| 246 | Ga0453683_0472652 | 3300044673 | Bacteria | 812 |
| 247 | Ga0453683_0484287 | 3300044673 | Bacteria | 802 |
| 248 | Ga0466965_0010140 | 3300044683 | Bacteria | 4387 |
| 249 | Ga0466965_0059543 | 3300044683 | Bacteria | 1906 |
| 250 | Ga0466966_0122546 | 3300044684 | Bacteria | 1596 |
| 251 | Ga0453684_0127050 | 3300044712 | Unclassified | 3067 |
| 252 | Ga0466968_0055077 | 3300044735 | Bacteria | 1706 |
| 253 | Ga0466968_0079267 | 3300044735 | Bacteria | 1441 |
| 254 | Ga0466960_0045464 | 3300044901 | Bacteria | 2098 |
| 255 | Ga0466960_0092711 | 3300044901 | Bacteria | 1542 |
| 256 | Ga0466959_0398766 | 3300045049 | Unclassified | 935 |
| 257 | Ga0466959_0919861 | 3300045049 | Unclassified | 583 |
| 258 | Ga0451576_0448368 | 3300045051 | Unclassified | 1354 |
| 259 | Ga0466967_1408663 | 3300045976 | Bacteria | 694 |
| 260 | Ga0495590_0263265 | 3300046457 | Bacteria | 643 |
| 261 | Ga0495629_0213948 | 3300046459 | Bacteria | 1331 |
| 262 | Ga0495580_0298523 | 3300046472 | Bacteria | 1097 |
| 263 | Ga0495585_0044718 | 3300046492 | Bacteria | 2473 |
| 264 | Ga0495594_0458932 | 3300046499 | Unclassified | 724 |
| 265 | Ga0495607_0469873 | 3300046501 | Bacteria | 562 |
| 266 | Ga0495630_0246904 | 3300046517 | Bacteria | 1364 |
| 267 | Ga0495631_0067286 | 3300046518 | Bacteria | 1550 |
| 268 | Ga0495642_0018924 | 3300046528 | Bacteria | 2696 |
| 269 | Ga0495642_0289764 | 3300046528 | Bacteria | 717 |
| 270 | Ga0495654_0185220 | 3300046530 | Bacteria | 899 |
| 271 | Ga0495645_0106334 | 3300046543 | Bacteria | 1990 |
| 272 | Ga0495622_0079333 | 3300046557 | Bacteria | 1511 |
| 273 | Ga0495633_0142504 | 3300046558 | Bacteria | 1108 |
| 274 | Ga0495656_0066459 | 3300046615 | Bacteria | 1588 |
| 275 | Ga0495635_0713362 | 3300046663 | Bacteria | 650 |
| 276 | Ga0495659_0005064 | 3300046664 | Bacteria | 4140 |
| 277 | Ga0495661_0140749 | 3300046665 | Bacteria | 1313 |
| 278 | Ga0495670_0001126 | 3300046691 | Bacteria | 12962 |
| 279 | Ga0495670_0024247 | 3300046691 | Bacteria | 2998 |
| 280 | Ga0495670_0127136 | 3300046691 | Bacteria | 1327 |
| 281 | Ga0495670_0408162 | 3300046691 | Unclassified | 734 |
| 282 | Ga0495581_0354032 | 3300047315 | Unclassified | 857 |
| 283 | Ga0495636_0030633 | 3300047318 | Unclassified | 2201 |
| 284 | Ga0495636_0290362 | 3300047318 | Bacteria | 763 |
| 285 | Ga0495677_0033265 | 3300047445 | Bacteria | 1879 |
| 286 | Ga0495681_0076699 | 3300047470 | Bacteria | 1502 |
| 287 | Ga0495686_0009291 | 3300047472 | Bacteria | 7099 |
| 288 | Ga0495686_0409061 | 3300047472 | Unclassified | 727 |
| 289 | Ga0495593_0265034 | 3300047673 | Bacteria | 860 |
| 290 | Ga0495615_0158504 | 3300048090 | Bacteria | 678 |
| 291 | Ga0496100_0003306 | 3300048903 | Bacteria | 8387 |
| 292 | Ga0496100_1238815 | 3300048903 | Bacteria | 589 |
| 293 | Ga0496101_0003726 | 3300048904 | Bacteria | 9506 |
| 294 | Ga0496101_0178884 | 3300048904 | Bacteria | 1633 |
| 295 | Ga0496101_0878432 | 3300048904 | Bacteria | 706 |
| 296 | Ga0496102_0031762 | 3300048905 | Bacteria | 4739 |
| 297 | Ga0496102_0349288 | 3300048905 | Bacteria | 1392 |
| 298 | Ga0496102_1029977 | 3300048905 | Bacteria | 743 |
| 299 | Ga0496103_0008762 | 3300048906 | Bacteria | 6002 |
| 300 | Ga0496103_0463668 | 3300048906 | Bacteria | 812 |
| 301 | Ga0496104_0082181 | 3300048907 | Bacteria | 3072 |
| 302 | Ga0496105_0099554 | 3300048908 | Bacteria | 2401 |
| 303 | Ga0496106_0005978 | 3300048909 | Bacteria | 8994 |
| 304 | Ga0496106_0282648 | 3300048909 | Bacteria | 1329 |
| 305 | Ga0496106_0504072 | 3300048909 | Bacteria | 972 |
| 306 | Ga0496106_1527156 | 3300048909 | Bacteria | 513 |
| 307 | Ga0496107_0002897 | 3300048910 | Bacteria | 11335 |
| 308 | Ga0496108_0004920 | 3300048911 | Bacteria | 10792 |
| 309 | Ga0496108_0007211 | 3300048911 | Bacteria | 9010 |
| 310 | Ga0496108_0157890 | 3300048911 | Bacteria | 1959 |
| 311 | Ga0496108_0713067 | 3300048911 | Bacteria | 869 |
| 312 | Ga0496108_0776785 | 3300048911 | Bacteria | 827 |
| 313 | Ga0496109_0066845 | 3300048912 | Bacteria | 3292 |
| 314 | Ga0496109_0069430 | 3300048912 | Bacteria | 3231 |
| 315 | Ga0496109_0088582 | 3300048912 | Bacteria | 2860 |
| 316 | Ga0496109_0261422 | 3300048912 | Bacteria | 1630 |
| 317 | Ga0496109_0300970 | 3300048912 | Bacteria | 1512 |
| 318 | Ga0496110_0045729 | 3300048913 | Bacteria | 3827 |
| 319 | Ga0496110_0129231 | 3300048913 | Bacteria | 2280 |
| 320 | Ga0496110_0175915 | 3300048913 | Bacteria | 1942 |
| 321 | Ga0496110_0201053 | 3300048913 | Bacteria | 1810 |
| 322 | Ga0496110_0516348 | 3300048913 | Bacteria | 1087 |
| 323 | Ga0496111_0018760 | 3300048914 | Bacteria | 4794 |
| 324 | Ga0496111_0096623 | 3300048914 | Bacteria | 2168 |
| 325 | Ga0496111_0133695 | 3300048914 | Bacteria | 1836 |
| 326 | Ga0496112_0043320 | 3300048915 | Bacteria | 4406 |
| 327 | Ga0496112_0081632 | 3300048915 | Bacteria | 3197 |
| 328 | Ga0496112_0104192 | 3300048915 | Bacteria | 2807 |
| 329 | Ga0496112_0555958 | 3300048915 | Bacteria | 1081 |
| 330 | Ga0496113_0013030 | 3300048916 | Bacteria | 5612 |
| 331 | Ga0496113_0226417 | 3300048916 | Bacteria | 1491 |
| 332 | Ga0496113_0661914 | 3300048916 | Bacteria | 835 |
| 333 | Ga0496114_1577684 | 3300048917 | Bacteria | 544 |
| 334 | Ga0496123_0347679 | 3300048926 | Bacteria | 691 |
| 335 | Ga0496124_0022257 | 3300048927 | Bacteria | 5817 |
| 336 | Ga0496124_0079906 | 3300048927 | Bacteria | 2692 |
| 337 | Ga0496125_0218374 | 3300048928 | Bacteria | 1231 |
| 338 | Ga0496126_0023915 | 3300048929 | Bacteria | 5908 |
| 339 | Ga0501299_016953 | 3300049522 | Bacteria | 1295 |
| 340 | Ga0501041_0228166 | 3300049577 | Bacteria | 1169 |
| 341 | Ga0501041_0653660 | 3300049577 | Bacteria | 672 |
| 342 | Ga0501042_0226410 | 3300049578 | Bacteria | 1349 |
| 343 | Ga0501048_1331615 | 3300049582 | Bacteria | 516 |
| 344 | Ga0501067_0214537 | 3300049583 | Bacteria | 1072 |
| 345 | Ga0501068_1131710 | 3300049584 | Bacteria | 518 |
| 346 | Ga0501070_0635381 | 3300049586 | Bacteria | 849 |
| 347 | Ga0501072_0150884 | 3300049588 | Bacteria | 1853 |
| 348 | Ga0501075_0330395 | 3300049591 | Bacteria | 1162 |
| 349 | Ga0501216_026168 | 3300049660 | Bacteria | 1052 |
| 350 | Ga0501079_0602159 | 3300049741 | Bacteria | 865 |
| 351 | Ga0501081_0940443 | 3300049743 | Bacteria | 652 |
| 352 | Ga0501045_0168141 | 3300049824 | Bacteria | 1633 |
| 353 | nmdc:mga03n38_928440_c1 | 3300050490 | Bacteria | 513 |
| 354 | nmdc:mga00v17_269277_c1 | 3300050491 | Bacteria | 1105 |
| 355 | nmdc:mga0k408_104346_c1 | 3300050493 | Bacteria | 1673 |
| 356 | nmdc:mga06z11_77715_c1 | 3300050494 | Bacteria | 1773 |
| 357 | nmdc:mga07m45_147279_c1 | 3300050496 | Bacteria | 1365 |
| 358 | nmdc:mga07m45_350178_c1 | 3300050496 | Bacteria | 858 |
| 359 | nmdc:mga05p37_21195_c1 | 3300050507 | Bacteria | 7868 |
| 360 | nmdc:mga09592_705442_c1 | 3300050508 | Bacteria | 858 |
| 361 | nmdc:mga09592_7995_c1 | 3300050508 | Bacteria | 8599 |
| 362 | nmdc:mga0qj67_543747_c1 | 3300050509 | Bacteria | 932 |
| 363 | nmdc:mga06r32_77232_c1 | 3300050510 | Bacteria | 3234 |
| 364 | nmdc:mga08y16_376693_c1 | 3300050511 | Bacteria | 1455 |
| 365 | nmdc:mga08y16_519723_c1 | 3300050511 | Bacteria | 1207 |
| 366 | nmdc:mga0n895_972655_c1 | 3300050512 | Bacteria | 831 |
| 367 | nmdc:mga0a205_1214601_c1 | 3300050515 | Bacteria | 602 |
| 368 | nmdc:mga0a205_336482_c1 | 3300050515 | Bacteria | 1378 |
| 369 | nmdc:mga0sz30_6224_c1 | 3300050516 | Bacteria | 3660 |
| 370 | Ga0500650_0123873 | 3300053098 | Bacteria | 1204 |
| 371 | Ga0500555_100809 | 3300053103 | Bacteria | 733 |
| 372 | Ga0500622_0028536 | 3300053156 | Bacteria | 2938 |
| 373 | Ga0500636_0010281 | 3300053177 | Bacteria | 5454 |
| 374 | Ga0501082_0670471 | 3300060353 | Bacteria | 908 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044684 | Ga0466966_0122546 | Ga0466966_0122546_415_759 | 105 |
| 2 | 3300045049 | Ga0466959_0398766 | Ga0466959_0398766_18_362 | 105 |
| 3 | 3300005458 | Ga0070681_10165361 | Ga0070681_101653615 | 106 |
| 4 | 3300009177 | Ga0105248_10350517 | Ga0105248_103505172 | 106 |
| 5 | 3300053177 | Ga0500636_0010281 | Ga0500636_0010281_4829_5158 | 106 |
| 6 | 3300003323 | rootH1_10300328 | rootH1_103003283 | 107 |
| 7 | 3300005435 | Ga0070714_100059736 | Ga0070714_1000597363 | 107 |
| 8 | 3300005437 | Ga0070710_10000637 | Ga0070710_100006375 | 107 |
| 9 | 3300007265 | Ga0099794_10078170 | Ga0099794_100781701 | 107 |
| 10 | 3300010159 | Ga0099796_10150366 | Ga0099796_101503662 | 107 |
| 11 | 3300025898 | Ga0207692_10007391 | Ga0207692_100073911 | 107 |
| 12 | 3300030736 | Ga0316180_1077143 | Ga0316180_10771431 | 107 |
| 13 | 3300030744 | Ga0316181_1239975 | Ga0316181_12399752 | 107 |
| 14 | 3300037853 | Ga0436364_0553599 | Ga0436364_0553599_104_436 | 107 |
| 15 | 3300041486 | Ga0451807_1548322 | Ga0451807_1548322_512_838 | 107 |
| 16 | 3300044658 | Ga0466972_0001875 | Ga0466972_0001875_2777_3103 | 107 |
| 17 | 3300044683 | Ga0466965_0010140 | Ga0466965_0010140_253_579 | 107 |
| 18 | 3300044683 | Ga0466965_0059543 | Ga0466965_0059543_1556_1882 | 107 |
| 19 | 3300044735 | Ga0466968_0055077 | Ga0466968_0055077_1112_1456 | 107 |
| 20 | 3300044735 | Ga0466968_0079267 | Ga0466968_0079267_520_846 | 107 |
| 21 | 3300044901 | Ga0466960_0092711 | Ga0466960_0092711_1049_1375 | 107 |
| 22 | 3300045049 | Ga0466959_0919861 | Ga0466959_0919861_36_380 | 107 |
| 23 | 3300048916 | Ga0496113_0661914 | Ga0496113_0661914_279_623 | 107 |
| 24 | 3300048926 | Ga0496123_0347679 | Ga0496123_0347679_207_551 | 107 |
| 25 | 3300048927 | Ga0496124_0022257 | Ga0496124_0022257_5003_5347 | 107 |
| 26 | 3300048927 | Ga0496124_0079906 | Ga0496124_0079906_1944_2285 | 107 |
| 27 | 3300048929 | Ga0496126_0023915 | Ga0496126_0023915_5395_5739 | 107 |
| 28 | 3300049586 | Ga0501070_0635381 | Ga0501070_0635381_508_834 | 107 |
| 29 | 3300050516 | nmdc:mga0sz30_6224_c1 | nmdc:mga0sz30_6224_c1_2449_2790 | 107 |
| 30 | iso_pu_bacteria | 2643221634 | 2644192138 | 107 |
| 31 | iso_pu_bacteria | 2837268691 | 2837269636 | 107 |
| 32 | 3300005366 | Ga0070659_100260035 | Ga0070659_1002600352 | 108 |
| 33 | 3300005457 | Ga0070662_101075723 | Ga0070662_1010757232 | 108 |
| 34 | 3300005981 | Ga0081538_10011744 | Ga0081538_100117443 | 108 |
| 35 | 3300005981 | Ga0081538_10011744 | Ga0081538_100117444 | 108 |
| 36 | 3300006353 | Ga0075370_10207399 | Ga0075370_102073992 | 108 |
| 37 | 3300025899 | Ga0207642_10725109 | Ga0207642_107251091 | 108 |
| 38 | 3300025901 | Ga0207688_10470267 | Ga0207688_104702671 | 108 |
| 39 | 3300025929 | Ga0207664_11673462 | Ga0207664_116734621 | 108 |
| 40 | 3300025932 | Ga0207690_10544264 | Ga0207690_105442642 | 108 |
| 41 | 3300025942 | Ga0207689_10055494 | Ga0207689_100554944 | 108 |
| 42 | 3300025945 | Ga0207679_10728764 | Ga0207679_107287641 | 108 |
| 43 | 3300025961 | Ga0207712_11615373 | Ga0207712_116153731 | 108 |
| 44 | 3300026023 | Ga0207677_10411061 | Ga0207677_104110612 | 108 |
| 45 | 3300026067 | Ga0207678_10110030 | Ga0207678_101100302 | 108 |
| 46 | 3300026088 | Ga0207641_10627798 | Ga0207641_106277982 | 108 |
| 47 | 3300026095 | Ga0207676_10796787 | Ga0207676_107967872 | 108 |
| 48 | 3300026121 | Ga0207683_10840029 | Ga0207683_108400291 | 108 |
| 49 | 3300028379 | Ga0268266_10915628 | Ga0268266_109156282 | 108 |
| 50 | 3300048903 | Ga0496100_1238815 | Ga0496100_1238815_66_398 | 108 |
| 51 | 3300048911 | Ga0496108_0713067 | Ga0496108_0713067_400_732 | 108 |
| 52 | 3300048912 | Ga0496109_0300970 | Ga0496109_0300970_1153_1485 | 108 |
| 53 | 3300048913 | Ga0496110_0516348 | Ga0496110_0516348_157_489 | 108 |
| 54 | 3300050496 | nmdc:mga07m45_350178_c1 | nmdc:mga07m45_350178_c1_14_370 | 108 |
| 55 | 3300003373 | JGI25407J50210_10004489 | JGI25407J50210_100044895 | 109 |
| 56 | 3300005981 | Ga0081538_10000034 | Ga0081538_10000034100 | 109 |
| 57 | 3300006038 | Ga0075365_10671542 | Ga0075365_106715421 | 109 |
| 58 | 3300041408 | Ga0439453_0095850 | Ga0439453_0095850_133_495 | 109 |
| 59 | 3300005436 | Ga0070713_100229546 | Ga0070713_1002295461 | 110 |
| 60 | 3300005843 | Ga0068860_100214248 | Ga0068860_1002142482 | 110 |
| 61 | 3300006175 | Ga0070712_101296487 | Ga0070712_1012964871 | 110 |
| 62 | 3300006871 | Ga0075434_101115762 | Ga0075434_1011157621 | 110 |
| 63 | 3300007076 | Ga0075435_101283134 | Ga0075435_1012831342 | 110 |
| 64 | 3300009176 | Ga0105242_12146585 | Ga0105242_121465851 | 110 |
| 65 | 3300028381 | Ga0268264_10119337 | Ga0268264_101193374 | 110 |
| 66 | 3300035113 | Ga0373936_0344154 | Ga0373936_0344154_275_619 | 110 |
| 67 | 3300035170 | Ga0373943_0168757 | Ga0373943_0168757_712_1056 | 110 |
| 68 | 3300039437 | Ga0436365_1914496 | Ga0436365_1914496_106_474 | 110 |
| 69 | 3300041408 | Ga0439453_0006580 | Ga0439453_0006580_448_846 | 110 |
| 70 | 3300041451 | Ga0451791_0565443 | Ga0451791_0565443_50_394 | 110 |
| 71 | 3300044901 | Ga0466960_0045464 | Ga0466960_0045464_990_1328 | 110 |
| 72 | 3300046459 | Ga0495629_0213948 | Ga0495629_0213948_385_729 | 110 |
| 73 | 3300046517 | Ga0495630_0246904 | Ga0495630_0246904_137_496 | 110 |
| 74 | 3300046663 | Ga0495635_0713362 | Ga0495635_0713362_186_530 | 110 |
| 75 | 3300047673 | Ga0495593_0265034 | Ga0495593_0265034_469_813 | 110 |
| 76 | 3300049577 | Ga0501041_0228166 | Ga0501041_0228166_651_989 | 110 |
| 77 | 3300049578 | Ga0501042_0226410 | Ga0501042_0226410_802_1140 | 110 |
| 78 | 3300049582 | Ga0501048_1331615 | Ga0501048_1331615_66_404 | 110 |
| 79 | 3300049588 | Ga0501072_0150884 | Ga0501072_0150884_360_701 | 110 |
| 80 | 3300049591 | Ga0501075_0330395 | Ga0501075_0330395_271_609 | 110 |
| 81 | 3300049741 | Ga0501079_0602159 | Ga0501079_0602159_386_724 | 110 |
| 82 | 3300049743 | Ga0501081_0940443 | Ga0501081_0940443_96_434 | 110 |
| 83 | 3300049824 | Ga0501045_0168141 | Ga0501045_0168141_518_856 | 110 |
| 84 | 3300050509 | nmdc:mga0qj67_543747_c1 | nmdc:mga0qj67_543747_c1_167_505 | 110 |
| 85 | 3300050512 | nmdc:mga0n895_972655_c1 | nmdc:mga0n895_972655_c1_406_765 | 110 |
| 86 | 3300060353 | Ga0501082_0670471 | Ga0501082_0670471_530_868 | 110 |
| 87 | 3300003781 | Ga0055536_1006685 | Ga0055536_10066854 | 111 |
| 88 | 3300003781 | Ga0055536_1007630 | Ga0055536_10076304 | 111 |
| 89 | 3300003791 | Ga0055530_10006349 | Ga0055530_100063494 | 111 |
| 90 | 3300003791 | Ga0055530_10016055 | Ga0055530_100160554 | 111 |
| 91 | 3300003794 | Ga0055531_10000915 | Ga0055531_1000091527 | 111 |
| 92 | 3300003794 | Ga0055531_10008113 | Ga0055531_100081134 | 111 |
| 93 | 3300003794 | Ga0055531_10098863 | Ga0055531_100988632 | 111 |
| 94 | 3300025292 | Ga0209676_1000119 | Ga0209676_100011964 | 111 |
| 95 | 3300025292 | Ga0209676_1000282 | Ga0209676_100028285 | 111 |
| 96 | 3300025298 | Ga0209050_1000745 | Ga0209050_100074527 | 111 |
| 97 | 3300025298 | Ga0209050_1001911 | Ga0209050_10019118 | 111 |
| 98 | 3300025303 | Ga0209051_1003490 | Ga0209051_10034907 | 111 |
| 99 | 3300025304 | Ga0209257_1000332 | Ga0209257_100033279 | 111 |
| 100 | 3300025304 | Ga0209257_1008733 | Ga0209257_10087333 | 111 |
| 101 | 3300045976 | Ga0466967_1408663 | Ga0466967_1408663_104_451 | 111 |
| 102 | 3300046492 | Ga0495585_0044718 | Ga0495585_0044718_1549_1887 | 111 |
| 103 | 3300046665 | Ga0495661_0140749 | Ga0495661_0140749_885_1223 | 111 |
| 104 | 3300047472 | Ga0495686_0409061 | Ga0495686_0409061_350_688 | 111 |
| 105 | 3300013296 | Ga0157374_10672603 | Ga0157374_106726031 | 112 |
| 106 | 3300025256 | Ga0209759_1023286 | Ga0209759_10232862 | 112 |
| 107 | 3300031548 | Ga0307408_101609057 | Ga0307408_1016090571 | 112 |
| 108 | 3300046472 | Ga0495580_0298523 | Ga0495580_0298523_698_1063 | 112 |
| 109 | 3300046543 | Ga0495645_0106334 | Ga0495645_0106334_1241_1591 | 112 |
| 110 | 3300048904 | Ga0496101_0878432 | Ga0496101_0878432_28_378 | 112 |
| 111 | 3300048906 | Ga0496103_0463668 | Ga0496103_0463668_157_507 | 112 |
| 112 | 3300048915 | Ga0496112_0104192 | Ga0496112_0104192_2287_2637 | 112 |
| 113 | 3300005262 | Ga0065165_1123369 | Ga0065165_11233692 | 113 |
| 114 | 3300005328 | Ga0070676_10001329 | Ga0070676_100013295 | 113 |
| 115 | 3300005330 | Ga0070690_100037545 | Ga0070690_1000375451 | 113 |
| 116 | 3300005334 | Ga0068869_100013645 | Ga0068869_1000136452 | 113 |
| 117 | 3300005336 | Ga0070680_100412306 | Ga0070680_1004123062 | 113 |
| 118 | 3300005338 | Ga0068868_101218889 | Ga0068868_1012188892 | 113 |
| 119 | 3300005341 | Ga0070691_10017847 | Ga0070691_100178472 | 113 |
| 120 | 3300005345 | Ga0070692_10197120 | Ga0070692_101971201 | 113 |
| 121 | 3300005347 | Ga0070668_100038810 | Ga0070668_1000388104 | 113 |
| 122 | 3300005353 | Ga0070669_100102357 | Ga0070669_1001023573 | 113 |
| 123 | 3300005356 | Ga0070674_100000979 | Ga0070674_10000097923 | 113 |
| 124 | 3300005364 | Ga0070673_101220826 | Ga0070673_1012208262 | 113 |
| 125 | 3300005367 | Ga0070667_100012333 | Ga0070667_1000123332 | 113 |
| 126 | 3300005438 | Ga0070701_10236940 | Ga0070701_102369401 | 113 |
| 127 | 3300005440 | Ga0070705_100005859 | Ga0070705_1000058593 | 113 |
| 128 | 3300005441 | Ga0070700_100196290 | Ga0070700_1001962902 | 113 |
| 129 | 3300005441 | Ga0070700_100210801 | Ga0070700_1002108013 | 113 |
| 130 | 3300005444 | Ga0070694_100011899 | Ga0070694_1000118997 | 113 |
| 131 | 3300005455 | Ga0070663_100175943 | Ga0070663_1001759433 | 113 |
| 132 | 3300005456 | Ga0070678_100003011 | Ga0070678_10000301114 | 113 |
| 133 | 3300005457 | Ga0070662_100001633 | Ga0070662_1000016333 | 113 |
| 134 | 3300005459 | Ga0068867_100005547 | Ga0068867_10000554710 | 113 |
| 135 | 3300005467 | Ga0070706_100539465 | Ga0070706_1005394652 | 113 |
| 136 | 3300005468 | Ga0070707_100707104 | Ga0070707_1007071042 | 113 |
| 137 | 3300005518 | Ga0070699_100153130 | Ga0070699_1001531303 | 113 |
| 138 | 3300005530 | Ga0070679_100383032 | Ga0070679_1003830321 | 113 |
| 139 | 3300005539 | Ga0068853_100172611 | Ga0068853_1001726112 | 113 |
| 140 | 3300005543 | Ga0070672_100255596 | Ga0070672_1002555961 | 113 |
| 141 | 3300005545 | Ga0070695_100003158 | Ga0070695_10000315813 | 113 |
| 142 | 3300005546 | Ga0070696_100004172 | Ga0070696_10000417213 | 113 |
| 143 | 3300005547 | Ga0070693_100026465 | Ga0070693_1000264652 | 113 |
| 144 | 3300005563 | Ga0068855_100301587 | Ga0068855_1003015873 | 113 |
| 145 | 3300005577 | Ga0068857_100086927 | Ga0068857_1000869273 | 113 |
| 146 | 3300005578 | Ga0068854_100001781 | Ga0068854_1000017816 | 113 |
| 147 | 3300005614 | Ga0068856_100422258 | Ga0068856_1004222583 | 113 |
| 148 | 3300005615 | Ga0070702_100008694 | Ga0070702_1000086947 | 113 |
| 149 | 3300005617 | Ga0068859_100194245 | Ga0068859_1001942453 | 113 |
| 150 | 3300005618 | Ga0068864_100109884 | Ga0068864_1001098842 | 113 |
| 151 | 3300005718 | Ga0068866_10008575 | Ga0068866_100085758 | 113 |
| 152 | 3300005719 | Ga0068861_100035098 | Ga0068861_1000350983 | 113 |
| 153 | 3300005840 | Ga0068870_10022965 | Ga0068870_100229654 | 113 |
| 154 | 3300005842 | Ga0068858_100272227 | Ga0068858_1002722273 | 113 |
| 155 | 3300005843 | Ga0068860_100007967 | Ga0068860_1000079679 | 113 |
| 156 | 3300005844 | Ga0068862_101858966 | Ga0068862_1018589661 | 113 |
| 157 | 3300006042 | Ga0075368_10193602 | Ga0075368_101936022 | 113 |
| 158 | 3300006048 | Ga0075363_100391142 | Ga0075363_1003911422 | 113 |
| 159 | 3300006177 | Ga0075362_10029175 | Ga0075362_100291752 | 113 |
| 160 | 3300006178 | Ga0075367_10149000 | Ga0075367_101490003 | 113 |
| 161 | 3300006195 | Ga0075366_10043818 | Ga0075366_100438182 | 113 |
| 162 | 3300006237 | Ga0097621_100122735 | Ga0097621_1001227353 | 113 |
| 163 | 3300006358 | Ga0068871_100033152 | Ga0068871_1000331528 | 113 |
| 164 | 3300006881 | Ga0068865_100009821 | Ga0068865_1000098215 | 113 |
| 165 | 3300006931 | Ga0097620_100194242 | Ga0097620_1001942423 | 113 |
| 166 | 3300009093 | Ga0105240_10057796 | Ga0105240_100577969 | 113 |
| 167 | 3300009094 | Ga0111539_10492952 | Ga0111539_104929522 | 113 |
| 168 | 3300009148 | Ga0105243_10007844 | Ga0105243_1000784413 | 113 |
| 169 | 3300009148 | Ga0105243_10417747 | Ga0105243_104177472 | 113 |
| 170 | 3300009176 | Ga0105242_10001753 | Ga0105242_100017533 | 113 |
| 171 | 3300009177 | Ga0105248_10032276 | Ga0105248_100322761 | 113 |
| 172 | 3300009553 | Ga0105249_10024782 | Ga0105249_100247824 | 113 |
| 173 | 3300009553 | Ga0105249_10156669 | Ga0105249_101566693 | 113 |
| 174 | 3300010375 | Ga0105239_10242108 | Ga0105239_102421082 | 113 |
| 175 | 3300011119 | Ga0105246_10162133 | Ga0105246_101621332 | 113 |
| 176 | 3300013102 | Ga0157371_10912441 | Ga0157371_109124411 | 113 |
| 177 | 3300013297 | Ga0157378_10007186 | Ga0157378_1000718610 | 113 |
| 178 | 3300013306 | Ga0163162_10240519 | Ga0163162_102405192 | 113 |
| 179 | 3300013306 | Ga0163162_10267484 | Ga0163162_102674841 | 113 |
| 180 | 3300013306 | Ga0163162_11199371 | Ga0163162_111993712 | 113 |
| 181 | 3300013307 | Ga0157372_10155899 | Ga0157372_101558993 | 113 |
| 182 | 3300013308 | Ga0157375_11633769 | Ga0157375_116337692 | 113 |
| 183 | 3300014326 | Ga0157380_10080246 | Ga0157380_100802462 | 113 |
| 184 | 3300014968 | Ga0157379_11054440 | Ga0157379_110544401 | 113 |
| 185 | 3300014969 | Ga0157376_10304290 | Ga0157376_103042901 | 113 |
| 186 | 3300017792 | Ga0163161_10011012 | Ga0163161_100110127 | 113 |
| 187 | 3300025885 | Ga0207653_10003682 | Ga0207653_100036828 | 113 |
| 188 | 3300025899 | Ga0207642_10001257 | Ga0207642_100012571 | 113 |
| 189 | 3300025903 | Ga0207680_10017388 | Ga0207680_100173881 | 113 |
| 190 | 3300025907 | Ga0207645_10000208 | Ga0207645_1000020851 | 113 |
| 191 | 3300025908 | Ga0207643_10022858 | Ga0207643_100228582 | 113 |
| 192 | 3300025910 | Ga0207684_10748416 | Ga0207684_107484162 | 113 |
| 193 | 3300025913 | Ga0207695_10256786 | Ga0207695_102567863 | 113 |
| 194 | 3300025917 | Ga0207660_10766426 | Ga0207660_107664262 | 113 |
| 195 | 3300025922 | Ga0207646_10393937 | Ga0207646_103939372 | 113 |
| 196 | 3300025933 | Ga0207706_10000168 | Ga0207706_100001683 | 113 |
| 197 | 3300025934 | Ga0207686_10002310 | Ga0207686_1000231016 | 113 |
| 198 | 3300025935 | Ga0207709_10015706 | Ga0207709_100157062 | 113 |
| 199 | 3300025935 | Ga0207709_10466834 | Ga0207709_104668342 | 113 |
| 200 | 3300025937 | Ga0207669_10074546 | Ga0207669_100745462 | 113 |
| 201 | 3300025938 | Ga0207704_10001076 | Ga0207704_100010764 | 113 |
| 202 | 3300025940 | Ga0207691_10344754 | Ga0207691_103447541 | 113 |
| 203 | 3300025941 | Ga0207711_10005304 | Ga0207711_1000530414 | 113 |
| 204 | 3300025942 | Ga0207689_10007132 | Ga0207689_1000713214 | 113 |
| 205 | 3300025949 | Ga0207667_10546784 | Ga0207667_105467841 | 113 |
| 206 | 3300025960 | Ga0207651_10024393 | Ga0207651_100243937 | 113 |
| 207 | 3300025961 | Ga0207712_10009780 | Ga0207712_100097807 | 113 |
| 208 | 3300025972 | Ga0207668_10012061 | Ga0207668_100120614 | 113 |
| 209 | 3300025981 | Ga0207640_10032702 | Ga0207640_100327026 | 113 |
| 210 | 3300025986 | Ga0207658_10020268 | Ga0207658_100202682 | 113 |
| 211 | 3300026023 | Ga0207677_12252723 | Ga0207677_122527232 | 113 |
| 212 | 3300026035 | Ga0207703_10030221 | Ga0207703_100302218 | 113 |
| 213 | 3300026041 | Ga0207639_12090679 | Ga0207639_120906792 | 113 |
| 214 | 3300026067 | Ga0207678_10210789 | Ga0207678_102107893 | 113 |
| 215 | 3300026075 | Ga0207708_10014226 | Ga0207708_100142269 | 113 |
| 216 | 3300026075 | Ga0207708_10252040 | Ga0207708_102520402 | 113 |
| 217 | 3300026078 | Ga0207702_10379212 | Ga0207702_103792121 | 113 |
| 218 | 3300026089 | Ga0207648_10005607 | Ga0207648_1000560714 | 113 |
| 219 | 3300026095 | Ga0207676_11120163 | Ga0207676_111201632 | 113 |
| 220 | 3300026116 | Ga0207674_10013242 | Ga0207674_100132423 | 113 |
| 221 | 3300026118 | Ga0207675_100031506 | Ga0207675_1000315063 | 113 |
| 222 | 3300026118 | Ga0207675_100231471 | Ga0207675_1002314713 | 113 |
| 223 | 3300028380 | Ga0268265_10402604 | Ga0268265_104026042 | 113 |
| 224 | 3300028380 | Ga0268265_10625474 | Ga0268265_106254742 | 113 |
| 225 | 3300028381 | Ga0268264_10015925 | Ga0268264_100159253 | 113 |
| 226 | 3300034818 | Ga0373950_0041535 | Ga0373950_0041535_409_765 | 113 |
| 227 | 3300035084 | Ga0373928_0194786 | Ga0373928_0194786_214_570 | 113 |
| 228 | 3300035121 | Ga0373960_0056618 | Ga0373960_0056618_29_385 | 113 |
| 229 | 3300044673 | Ga0453683_0484287 | Ga0453683_0484287_49_405 | 113 |
| 230 | 3300047318 | Ga0495636_0030633 | Ga0495636_0030633_611_967 | 113 |
| 231 | 3300047318 | Ga0495636_0290362 | Ga0495636_0290362_391_747 | 113 |
| 232 | 3300047472 | Ga0495686_0009291 | Ga0495686_0009291_942_1310 | 113 |
| 233 | 3300048904 | Ga0496101_0178884 | Ga0496101_0178884_851_1207 | 113 |
| 234 | 3300048909 | Ga0496106_1527156 | Ga0496106_1527156_119_475 | 113 |
| 235 | 3300048917 | Ga0496114_1577684 | Ga0496114_1577684_125_481 | 113 |
| 236 | 3300049577 | Ga0501041_0653660 | Ga0501041_0653660_227_580 | 113 |
| 237 | 3300050490 | nmdc:mga03n38_928440_c1 | nmdc:mga03n38_928440_c1_137_481 | 113 |
| 238 | 3300050491 | nmdc:mga00v17_269277_c1 | nmdc:mga00v17_269277_c1_317_661 | 113 |
| 239 | 3300050493 | nmdc:mga0k408_104346_c1 | nmdc:mga0k408_104346_c1_641_985 | 113 |
| 240 | 3300050494 | nmdc:mga06z11_77715_c1 | nmdc:mga06z11_77715_c1_365_709 | 113 |
| 241 | 3300050496 | nmdc:mga07m45_147279_c1 | nmdc:mga07m45_147279_c1_970_1314 | 113 |
| 242 | 3300050511 | nmdc:mga08y16_376693_c1 | nmdc:mga08y16_376693_c1_477_824 | 113 |
| 243 | 3300050515 | nmdc:mga0a205_336482_c1 | nmdc:mga0a205_336482_c1_26_382 | 113 |
| 244 | 3300003320 | rootH2_10001360 | rootH2_1000136011 | 114 |
| 245 | 3300005288 | Ga0065714_10248691 | Ga0065714_102486911 | 114 |
| 246 | 3300005340 | Ga0070689_100004728 | Ga0070689_1000047287 | 114 |
| 247 | 3300005353 | Ga0070669_101381150 | Ga0070669_1013811501 | 114 |
| 248 | 3300005456 | Ga0070678_102130848 | Ga0070678_1021308481 | 114 |
| 249 | 3300005467 | Ga0070706_100599685 | Ga0070706_1005996851 | 114 |
| 250 | 3300005518 | Ga0070699_100139080 | Ga0070699_1001390802 | 114 |
| 251 | 3300005543 | Ga0070672_101141166 | Ga0070672_1011411662 | 114 |
| 252 | 3300005544 | Ga0070686_100095194 | Ga0070686_1000951942 | 114 |
| 253 | 3300005563 | Ga0068855_100037629 | Ga0068855_1000376292 | 114 |
| 254 | 3300005616 | Ga0068852_100923399 | Ga0068852_1009233992 | 114 |
| 255 | 3300005617 | Ga0068859_101767242 | Ga0068859_1017672422 | 114 |
| 256 | 3300005618 | Ga0068864_100026994 | Ga0068864_1000269944 | 114 |
| 257 | 3300005618 | Ga0068864_100099620 | Ga0068864_1000996201 | 114 |
| 258 | 3300005841 | Ga0068863_100100100 | Ga0068863_1001001002 | 114 |
| 259 | 3300005843 | Ga0068860_102251030 | Ga0068860_1022510301 | 114 |
| 260 | 3300005844 | Ga0068862_100288810 | Ga0068862_1002888102 | 114 |
| 261 | 3300005937 | Ga0081455_10261932 | Ga0081455_102619322 | 114 |
| 262 | 3300005981 | Ga0081538_10001209 | Ga0081538_1000120925 | 114 |
| 263 | 3300006178 | Ga0075367_10332738 | Ga0075367_103327382 | 114 |
| 264 | 3300006844 | Ga0075428_100363629 | Ga0075428_1003636292 | 114 |
| 265 | 3300006847 | Ga0075431_100019201 | Ga0075431_1000192017 | 114 |
| 266 | 3300006852 | Ga0075433_10700155 | Ga0075433_107001551 | 114 |
| 267 | 3300006852 | Ga0075433_10819205 | Ga0075433_108192052 | 114 |
| 268 | 3300006880 | Ga0075429_100676573 | Ga0075429_1006765732 | 114 |
| 269 | 3300006931 | Ga0097620_101767209 | Ga0097620_1017672091 | 114 |
| 270 | 3300009036 | Ga0105244_10024294 | Ga0105244_100242943 | 114 |
| 271 | 3300009147 | Ga0114129_10033766 | Ga0114129_100337662 | 114 |
| 272 | 3300009177 | Ga0105248_11247650 | Ga0105248_112476501 | 114 |
| 273 | 3300009177 | Ga0105248_12900032 | Ga0105248_129000321 | 114 |
| 274 | 3300009545 | Ga0105237_10437864 | Ga0105237_104378642 | 114 |
| 275 | 3300009553 | Ga0105249_10065000 | Ga0105249_100650003 | 114 |
| 276 | 3300010159 | Ga0099796_10074244 | Ga0099796_100742442 | 114 |
| 277 | 3300010375 | Ga0105239_11764452 | Ga0105239_117644522 | 114 |
| 278 | 3300013105 | Ga0157369_10002781 | Ga0157369_1000278111 | 114 |
| 279 | 3300013306 | Ga0163162_10015277 | Ga0163162_100152779 | 114 |
| 280 | 3300013307 | Ga0157372_10059597 | Ga0157372_100595975 | 114 |
| 281 | 3300013308 | Ga0157375_10185949 | Ga0157375_101859492 | 114 |
| 282 | 3300014325 | Ga0163163_10117496 | Ga0163163_101174964 | 114 |
| 283 | 3300014326 | Ga0157380_13008508 | Ga0157380_130085081 | 114 |
| 284 | 3300014968 | Ga0157379_10767556 | Ga0157379_107675562 | 114 |
| 285 | 3300020070 | Ga0206356_10201895 | Ga0206356_102018952 | 114 |
| 286 | 3300025728 | Ga0207655_1094825 | Ga0207655_10948251 | 114 |
| 287 | 3300025903 | Ga0207680_11345075 | Ga0207680_113450751 | 114 |
| 288 | 3300025905 | Ga0207685_10487989 | Ga0207685_104879892 | 114 |
| 289 | 3300025913 | Ga0207695_10039721 | Ga0207695_100397212 | 114 |
| 290 | 3300025933 | Ga0207706_11463924 | Ga0207706_114639241 | 114 |
| 291 | 3300025936 | Ga0207670_10012965 | Ga0207670_100129653 | 114 |
| 292 | 3300025941 | Ga0207711_11180606 | Ga0207711_111806061 | 114 |
| 293 | 3300026088 | Ga0207641_10686899 | Ga0207641_106868992 | 114 |
| 294 | 3300026088 | Ga0207641_11187427 | Ga0207641_111874272 | 114 |
| 295 | 3300026121 | Ga0207683_11139352 | Ga0207683_111393522 | 114 |
| 296 | 3300027682 | Ga0209971_1075069 | Ga0209971_10750692 | 114 |
| 297 | 3300028380 | Ga0268265_11190160 | Ga0268265_111901601 | 114 |
| 298 | 3300032002 | Ga0307416_101112082 | Ga0307416_1011120822 | 114 |
| 299 | 3300035084 | Ga0373928_0113768 | Ga0373928_0113768_204_560 | 114 |
| 300 | 3300035088 | Ga0373940_0037472 | Ga0373940_0037472_725_1081 | 114 |
| 301 | 3300035091 | Ga0373951_0025428 | Ga0373951_0025428_976_1332 | 114 |
| 302 | 3300035114 | Ga0373939_0518995 | Ga0373939_0518995_62_418 | 114 |
| 303 | 3300035691 | Ga0373931_0157027 | Ga0373931_0157027_624_980 | 114 |
| 304 | 3300037418 | Ga0395900_0734069 | Ga0395900_0734069_82_438 | 114 |
| 305 | 3300037471 | Ga0395905_0102941 | Ga0395905_0102941_864_1220 | 114 |
| 306 | 3300037471 | Ga0395905_0222405 | Ga0395905_0222405_969_1322 | 114 |
| 307 | 3300038443 | Ga0395901_0931566 | Ga0395901_0931566_404_760 | 114 |
| 308 | 3300042011 | Ga0439454_028038 | Ga0439454_028038_260_682 | 114 |
| 309 | 3300042876 | Ga0451577_0274690 | Ga0451577_0274690_234_593 | 114 |
| 310 | 3300044673 | Ga0453683_0472652 | Ga0453683_0472652_122_481 | 114 |
| 311 | 3300044712 | Ga0453684_0127050 | Ga0453684_0127050_1932_2291 | 114 |
| 312 | 3300045051 | Ga0451576_0448368 | Ga0451576_0448368_486_845 | 114 |
| 313 | 3300046457 | Ga0495590_0263265 | Ga0495590_0263265_17_388 | 114 |
| 314 | 3300046499 | Ga0495594_0458932 | Ga0495594_0458932_228_587 | 114 |
| 315 | 3300046501 | Ga0495607_0469873 | Ga0495607_0469873_12_383 | 114 |
| 316 | 3300046518 | Ga0495631_0067286 | Ga0495631_0067286_689_1060 | 114 |
| 317 | 3300046528 | Ga0495642_0018924 | Ga0495642_0018924_2021_2392 | 114 |
| 318 | 3300046528 | Ga0495642_0289764 | Ga0495642_0289764_148_519 | 114 |
| 319 | 3300046530 | Ga0495654_0185220 | Ga0495654_0185220_197_568 | 114 |
| 320 | 3300046557 | Ga0495622_0079333 | Ga0495622_0079333_66_425 | 114 |
| 321 | 3300046558 | Ga0495633_0142504 | Ga0495633_0142504_64_435 | 114 |
| 322 | 3300046615 | Ga0495656_0066459 | Ga0495656_0066459_987_1358 | 114 |
| 323 | 3300046664 | Ga0495659_0005064 | Ga0495659_0005064_1824_2195 | 114 |
| 324 | 3300046691 | Ga0495670_0001126 | Ga0495670_0001126_12561_12932 | 114 |
| 325 | 3300046691 | Ga0495670_0024247 | Ga0495670_0024247_2165_2536 | 114 |
| 326 | 3300046691 | Ga0495670_0127136 | Ga0495670_0127136_35_406 | 114 |
| 327 | 3300046691 | Ga0495670_0408162 | Ga0495670_0408162_234_605 | 114 |
| 328 | 3300047315 | Ga0495581_0354032 | Ga0495581_0354032_200_571 | 114 |
| 329 | 3300047445 | Ga0495677_0033265 | Ga0495677_0033265_1040_1411 | 114 |
| 330 | 3300047470 | Ga0495681_0076699 | Ga0495681_0076699_237_608 | 114 |
| 331 | 3300048090 | Ga0495615_0158504 | Ga0495615_0158504_230_601 | 114 |
| 332 | 3300048903 | Ga0496100_0003306 | Ga0496100_0003306_4726_5097 | 114 |
| 333 | 3300048904 | Ga0496101_0003726 | Ga0496101_0003726_4301_4672 | 114 |
| 334 | 3300048905 | Ga0496102_0031762 | Ga0496102_0031762_902_1273 | 114 |
| 335 | 3300048905 | Ga0496102_0349288 | Ga0496102_0349288_759_1130 | 114 |
| 336 | 3300048905 | Ga0496102_1029977 | Ga0496102_1029977_210_614 | 114 |
| 337 | 3300048906 | Ga0496103_0008762 | Ga0496103_0008762_3027_3398 | 114 |
| 338 | 3300048907 | Ga0496104_0082181 | Ga0496104_0082181_1211_1567 | 114 |
| 339 | 3300048908 | Ga0496105_0099554 | Ga0496105_0099554_1257_1613 | 114 |
| 340 | 3300048909 | Ga0496106_0005978 | Ga0496106_0005978_4582_4953 | 114 |
| 341 | 3300048909 | Ga0496106_0282648 | Ga0496106_0282648_316_672 | 114 |
| 342 | 3300048909 | Ga0496106_0504072 | Ga0496106_0504072_593_949 | 114 |
| 343 | 3300048910 | Ga0496107_0002897 | Ga0496107_0002897_4492_4863 | 114 |
| 344 | 3300048911 | Ga0496108_0004920 | Ga0496108_0004920_1368_1724 | 114 |
| 345 | 3300048911 | Ga0496108_0007211 | Ga0496108_0007211_7377_7733 | 114 |
| 346 | 3300048911 | Ga0496108_0157890 | Ga0496108_0157890_637_1008 | 114 |
| 347 | 3300048911 | Ga0496108_0776785 | Ga0496108_0776785_420_773 | 114 |
| 348 | 3300048912 | Ga0496109_0066845 | Ga0496109_0066845_1603_1959 | 114 |
| 349 | 3300048912 | Ga0496109_0069430 | Ga0496109_0069430_2554_2925 | 114 |
| 350 | 3300048912 | Ga0496109_0088582 | Ga0496109_0088582_1167_1523 | 114 |
| 351 | 3300048912 | Ga0496109_0261422 | Ga0496109_0261422_163_534 | 114 |
| 352 | 3300048913 | Ga0496110_0045729 | Ga0496110_0045729_2604_2975 | 114 |
| 353 | 3300048913 | Ga0496110_0129231 | Ga0496110_0129231_1149_1505 | 114 |
| 354 | 3300048913 | Ga0496110_0175915 | Ga0496110_0175915_1451_1807 | 114 |
| 355 | 3300048913 | Ga0496110_0201053 | Ga0496110_0201053_1057_1428 | 114 |
| 356 | 3300048914 | Ga0496111_0018760 | Ga0496111_0018760_992_1363 | 114 |
| 357 | 3300048914 | Ga0496111_0096623 | Ga0496111_0096623_1514_1870 | 114 |
| 358 | 3300048914 | Ga0496111_0133695 | Ga0496111_0133695_223_594 | 114 |
| 359 | 3300048915 | Ga0496112_0043320 | Ga0496112_0043320_2705_3061 | 114 |
| 360 | 3300048915 | Ga0496112_0081632 | Ga0496112_0081632_1603_1959 | 114 |
| 361 | 3300048915 | Ga0496112_0555958 | Ga0496112_0555958_345_701 | 114 |
| 362 | 3300048916 | Ga0496113_0013030 | Ga0496113_0013030_4121_4477 | 114 |
| 363 | 3300048916 | Ga0496113_0226417 | Ga0496113_0226417_740_1093 | 114 |
| 364 | 3300048928 | Ga0496125_0218374 | Ga0496125_0218374_168_539 | 114 |
| 365 | 3300049522 | Ga0501299_016953 | Ga0501299_016953_338_703 | 114 |
| 366 | 3300049583 | Ga0501067_0214537 | Ga0501067_0214537_27_389 | 114 |
| 367 | 3300049584 | Ga0501068_1131710 | Ga0501068_1131710_32_394 | 114 |
| 368 | 3300049660 | Ga0501216_026168 | Ga0501216_026168_330_695 | 114 |
| 369 | 3300050507 | nmdc:mga05p37_21195_c1 | nmdc:mga05p37_21195_c1_1117_1470 | 114 |
| 370 | 3300050508 | nmdc:mga09592_705442_c1 | nmdc:mga09592_705442_c1_421_786 | 114 |
| 371 | 3300050508 | nmdc:mga09592_7995_c1 | nmdc:mga09592_7995_c1_6831_7184 | 114 |
| 372 | 3300050510 | nmdc:mga06r32_77232_c1 | nmdc:mga06r32_77232_c1_800_1153 | 114 |
| 373 | 3300050511 | nmdc:mga08y16_519723_c1 | nmdc:mga08y16_519723_c1_232_591 | 114 |
| 374 | 3300050515 | nmdc:mga0a205_1214601_c1 | nmdc:mga0a205_1214601_c1_66_422 | 114 |
| 375 | 3300053098 | Ga0500650_0123873 | Ga0500650_0123873_674_1018 | 114 |
| 376 | 3300053103 | Ga0500555_100809 | Ga0500555_100809_117_461 | 114 |
| 377 | 3300053156 | Ga0500622_0028536 | Ga0500622_0028536_1448_1822 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9557 | 3 | 86 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9474 | 3 | 88 |
| 6j0e-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9163 | 8 | 84 |
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9111 | 3 | 91 |
| 3f6o-assembly1.cif.gz_A | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9052 | 4 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71941_17_120_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9387 | 4 | 81 | 1.10.10.10 |
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9371 | 16 | 71 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9278 | 14 | 70 | 1.10.10.10 |
| af_I1J7S3_149_266_1.10.10.1890 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ska1 microtubule binding domain-like | 0.9267 | 44 | 71 | 1.10.10.1890 |
| af_A0A1D6HDX3_114_200_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9216 | 14 | 63 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7WQW8-F1-model_v4 | DNA-binding transcriptional ArsR family regulator | 0.9795 | 5 | 83 |
GO:0003677
GO:0003700 |
| AF-H1S4V4-F1-model_v4 | ArsR family transcriptional regulator | 0.9751 | 2 | 83 |
GO:0003700
|
| AF-A0A1S2J3F8-F1-model_v4 | deleted | 0.9728 | 3 | 87 |
|
| AF-A0A2M8HG34-F1-model_v4 | Transcriptional regulator | 0.9694 | 4 | 88 |
GO:0003700
|
| AF-A0A2D7C7C1-F1-model_v4 | Transcriptional regulator | 0.9685 | 6 | 88 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar