F427617

General Info

Members Datasets Scaffolds Average Seq Length
377 191 754 277

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100057695|Ga0070707_1000576952
Length 304
Sequence MLGSGSAGNSALIATDHCKILIDGGLSARQLMLRLEQCGVTPHQLDGVLLTHEHGDHICGLEVLCRKFALPIYCNALTAEAIRGGGSLNGHRNWRIFHTGAEFAICDIVVQTFPVPHDAVDPVGFAFHAGTRALGFITDLGYATKMLTQRLREVHTLVIETNHDEKLLQNDPHRPWPVKQRIQSRHGHLSNAAAAMVIGELLAGKIERVVLGHLSRDCNTPELALGTVRLLLEKCDKADMEVHCATQFEVSPRFCIGETRPGPFQPTFDSIFFKVPTVASDKLGSDFSNRFRSATLPRDQSRDE

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.63
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 32.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100057695 3300005468 Unclassified 3724
2 CNXas_1000023 3300000545 Bacteria 31795
3 JGI25406J46586_10000005 3300003203 Bacteria 118289
4 Ga0065703_1019243 3300005272 Bacteria 3421
5 Ga0065704_10021230 3300005289 Unclassified 1705
6 Ga0065704_10024137 3300005289 Unclassified 2240
7 Ga0065712_10108401 3300005290 Unclassified 1876
8 Ga0065715_10007604 3300005293 Unclassified 2631
9 Ga0065715_10013222 3300005293 Unclassified 3319
10 Ga0065715_10108734 3300005293 Bacteria 2689
11 Ga0065715_10127693 3300005293 Bacteria 2081
12 Ga0065707_10041610 3300005295 Bacteria 1570
13 Ga0070676_10025458 3300005328 Bacteria 3345
14 Ga0070683_100007909 3300005329 Bacteria 9014
15 Ga0070683_100016380 3300005329 Bacteria 6536
16 Ga0070683_100122216 3300005329 Unclassified 2460
17 Ga0070683_100255567 3300005329 Bacteria 1667
18 Ga0070683_100407542 3300005329 Bacteria 1297
19 Ga0070690_100150009 3300005330 Bacteria 1590
20 Ga0070670_100202719 3300005331 Unclassified 1724
21 Ga0070666_10018397 3300005335 Bacteria 4491
22 Ga0068868_100163837 3300005338 Bacteria 1838
23 Ga0068868_100286815 3300005338 Bacteria 1395
24 Ga0070660_100146218 3300005339 Bacteria 1899
25 Ga0070660_100223752 3300005339 Bacteria 1530
26 Ga0070689_100000849 3300005340 Bacteria 18996
27 Ga0070689_100042034 3300005340 Unclassified 3510
28 Ga0070689_100189526 3300005340 Unclassified 1674
29 Ga0070687_100001087 3300005343 Bacteria 9333
30 Ga0070661_100203412 3300005344 Unclassified 1514
31 Ga0070661_100244643 3300005344 Bacteria 1382
32 Ga0070668_100053718 3300005347 Bacteria 3106
33 Ga0070669_100014507 3300005353 Bacteria 5604
34 Ga0070669_100355424 3300005353 Unclassified 1190
35 Ga0070675_100011861 3300005354 Bacteria 6828
36 Ga0070675_100049638 3300005354 Unclassified 3445
37 Ga0070675_100082749 3300005354 Bacteria 2678
38 Ga0070671_100176495 3300005355 Unclassified 1808
39 Ga0070671_100571695 3300005355 Bacteria 975
40 Ga0070674_100022527 3300005356 Bacteria 4064
41 Ga0070673_100026721 3300005364 Bacteria 4267
42 Ga0070688_100027043 3300005365 Bacteria 3414
43 Ga0070659_100005065 3300005366 Bacteria 9446
44 Ga0070659_100008038 3300005366 Bacteria 7689
45 Ga0070667_100013866 3300005367 Bacteria 6662
46 Ga0070667_100131058 3300005367 Bacteria 2188
47 Ga0070714_100063014 3300005435 Bacteria 3187
48 Ga0070714_100085711 3300005435 Bacteria 2752
49 Ga0070714_100126002 3300005435 Bacteria 2283
50 Ga0070710_10129532 3300005437 Unclassified 1537
51 Ga0070710_10160305 3300005437 Unclassified 1394
52 Ga0070711_100037261 3300005439 Unclassified 3262
53 Ga0070711_100195507 3300005439 Bacteria 1557
54 Ga0070711_100413440 3300005439 Bacteria 1097
55 Ga0070708_100002808 3300005445 Bacteria 13528
56 Ga0070708_100023950 3300005445 Bacteria 5196
57 Ga0070708_100071514 3300005445 Bacteria 3123
58 Ga0070708_100101512 3300005445 Bacteria 2635
59 Ga0070708_100111916 3300005445 Unclassified 2510
60 Ga0070708_100163697 3300005445 Bacteria 2074
61 Ga0070708_100237070 3300005445 Bacteria 1712
62 Ga0070708_100299911 3300005445 Bacteria 1513
63 Ga0070708_100366119 3300005445 Bacteria 1359
64 Ga0070663_100169433 3300005455 Bacteria 1687
65 Ga0070663_100197074 3300005455 Bacteria 1570
66 Ga0070678_100496891 3300005456 Bacteria 1076
67 Ga0070662_100015888 3300005457 Bacteria 5048
68 Ga0070662_100337688 3300005457 Unclassified 1232
69 Ga0070681_10094983 3300005458 Bacteria 2930
70 Ga0070685_10174058 3300005466 Unclassified 1381
71 Ga0070706_100001307 3300005467 Bacteria 26565
72 Ga0070706_100042168 3300005467 Bacteria 4214
73 Ga0070706_100072710 3300005467 Bacteria 3182
74 Ga0070706_100451127 3300005467 Unclassified 1197
75 Ga0070706_100644055 3300005467 Bacteria 984
76 Ga0070707_100005170 3300005468 Bacteria 12228
77 Ga0070707_100006283 3300005468 Bacteria 11052
78 Ga0070707_100013538 3300005468 Bacteria 7633
79 Ga0070707_100014183 3300005468 Bacteria 7468
80 Ga0070707_100023306 3300005468 Bacteria 5856
81 Ga0070707_100036794 3300005468 Bacteria 4672
82 Ga0070707_100039620 3300005468 Bacteria 4504
83 Ga0070707_100103475 3300005468 Bacteria 2759
84 Ga0070707_100111285 3300005468 Bacteria 2656
85 Ga0070707_100290791 3300005468 Bacteria 1588
86 Ga0070707_100340114 3300005468 Unclassified 1458
87 Ga0070707_100404253 3300005468 Bacteria 1326
88 Ga0070698_100007937 3300005471 Bacteria 11486
89 Ga0070698_100040117 3300005471 Bacteria 4814
90 Ga0070698_100045179 3300005471 Bacteria 4509
91 Ga0070698_100253874 3300005471 Bacteria 1691
92 Ga0070699_100138131 3300005518 Unclassified 2150
93 Ga0070679_100005772 3300005530 Bacteria 11478
94 Ga0070684_100053925 3300005535 Unclassified 3502
95 Ga0070684_100187507 3300005535 Bacteria 1881
96 Ga0070697_100000897 3300005536 Bacteria 22408
97 Ga0070697_100002854 3300005536 Bacteria 13291
98 Ga0070697_100007131 3300005536 Bacteria 8692
99 Ga0070697_100012623 3300005536 Bacteria 6617
100 Ga0070697_100012771 3300005536 Bacteria 6579
101 Ga0070697_100013304 3300005536 Bacteria 6454
102 Ga0070697_100017098 3300005536 Bacteria 5705
103 Ga0070697_100033404 3300005536 Bacteria 4144
104 Ga0070697_100061913 3300005536 Bacteria 3052
105 Ga0070697_100062059 3300005536 Bacteria 3049
106 Ga0070697_100237904 3300005536 Bacteria 1554
107 Ga0070697_100391109 3300005536 Bacteria 1205
108 Ga0070697_100551097 3300005536 Bacteria 1011
109 Ga0070686_100242191 3300005544 Bacteria 1314
110 Ga0070686_100498061 3300005544 Bacteria 945
111 Ga0070695_100379810 3300005545 Bacteria 1066
112 Ga0070665_100089743 3300005548 Unclassified 3079
113 Ga0070665_100193911 3300005548 Unclassified 2032
114 Ga0070665_100237449 3300005548 Bacteria 1823
115 Ga0070665_100325280 3300005548 Bacteria 1542
116 Ga0070704_100060417 3300005549 Bacteria 2708
117 Ga0070664_100028179 3300005564 Bacteria 4671
118 Ga0068856_100016086 3300005614 Bacteria 7231
119 Ga0068861_100035377 3300005719 Bacteria 3699
120 Ga0068863_100002953 3300005841 Bacteria 16797
121 Ga0068863_100478658 3300005841 Unclassified 1224
122 Ga0068863_100562618 3300005841 Bacteria 1126
123 Ga0068858_100108078 3300005842 Bacteria 2597
124 Ga0068858_100400222 3300005842 Bacteria 1319
125 Ga0068858_100851911 3300005842 Unclassified 890
126 Ga0068860_100041076 3300005843 Bacteria 4419
127 Ga0068860_100058829 3300005843 Bacteria 3654
128 Ga0068860_100106685 3300005843 Bacteria 2676
129 Ga0068862_100056746 3300005844 Unclassified 3356
130 Ga0081455_10004607 3300005937 Bacteria 15398
131 Ga0081455_10005191 3300005937 Bacteria 14329
132 Ga0081455_10006370 3300005937 Bacteria 12671
133 Ga0081455_10015926 3300005937 Bacteria 7279
134 Ga0081455_10038453 3300005937 Bacteria 4238
135 Ga0081455_10068550 3300005937 Bacteria 2952
136 Ga0081455_10099214 3300005937 Bacteria 2343
137 Ga0081455_10116242 3300005937 Bacteria 2116
138 Ga0081540_1022315 3300005983 Unclassified 3740
139 Ga0081539_10000026 3300005985 Bacteria 330830
140 Ga0081539_10033473 3300005985 Bacteria 3128
141 Ga0081539_10126481 3300005985 Unclassified 1262
142 Ga0070717_10000051 3300006028 Bacteria 100477
143 Ga0070717_10009498 3300006028 Bacteria 7313
144 Ga0070717_10017689 3300006028 Bacteria 5551
145 Ga0070717_10076307 3300006028 Bacteria 2805
146 Ga0070717_10120133 3300006028 Unclassified 2251
147 Ga0070717_10350018 3300006028 Bacteria 1321
148 Ga0070717_10379270 3300006028 Unclassified 1268
149 Ga0070717_10431101 3300006028 Unclassified 1186
150 Ga0070715_10046969 3300006163 Unclassified 1838
151 Ga0070716_100010164 3300006173 Bacteria 4713
152 Ga0070716_100053729 3300006173 Unclassified 2298
153 Ga0070716_100129698 3300006173 Unclassified 1592
154 Ga0070712_100021271 3300006175 Bacteria 4258
155 Ga0070712_100034523 3300006175 Unclassified 3429
156 Ga0070712_100082041 3300006175 Bacteria 2338
157 Ga0070712_100371676 3300006175 Viruses 1175
158 Ga0068871_100204040 3300006358 Bacteria 1708
159 Ga0075434_100169873 3300006871 Unclassified 2201
160 Ga0068865_100137308 3300006881 Bacteria 1839
161 Ga0075436_100066690 3300006914 Unclassified 2488
162 Ga0075436_100074322 3300006914 Unclassified 2353
163 Ga0099794_10137273 3300007265 Bacteria 1237
164 Ga0099794_10255248 3300007265 Unclassified 904
165 Ga0105250_10068247 3300009092 Bacteria 1435
166 Ga0111539_10111798 3300009094 Bacteria 3205
167 Ga0105245_10010117 3300009098 Bacteria 8214
168 Ga0105245_10269723 3300009098 Bacteria 1659
169 Ga0105245_10710118 3300009098 Unclassified 1039
170 Ga0105245_10787037 3300009098 Unclassified 989
171 Ga0114129_10274717 3300009147 Bacteria 2253
172 Ga0105243_10021568 3300009148 Bacteria 4891
173 Ga0105241_10497834 3300009174 Unclassified 1086
174 Ga0105242_10007342 3300009176 Bacteria 8483
175 Ga0105242_10611051 3300009176 Bacteria 1054
176 Ga0105248_10745948 3300009177 Unclassified 1105
177 Ga0105249_10007900 3300009553 Bacteria 9270
178 Ga0105249_10349345 3300009553 Bacteria 1498
179 Ga0105239_10082816 3300010375 Bacteria 3533
180 Ga0157371_10246843 3300013102 Unclassified 1285
181 Ga0157370_10098182 3300013104 Unclassified 2747
182 Ga0157374_10042589 3300013296 Bacteria 4188
183 Ga0157374_10051939 3300013296 Unclassified 3816
184 Ga0157374_10062782 3300013296 Unclassified 3483
185 Ga0157374_10208759 3300013296 Unclassified 1914
186 Ga0157378_10049259 3300013297 Unclassified 3747
187 Ga0157378_10101167 3300013297 Bacteria 2632
188 Ga0157378_10117765 3300013297 Bacteria 2444
189 Ga0157378_10151086 3300013297 Bacteria 2164
190 Ga0157378_10189395 3300013297 Bacteria 1939
191 Ga0157378_10274653 3300013297 Unclassified 1622
192 Ga0163162_10097046 3300013306 Bacteria 3036
193 Ga0163162_10705660 3300013306 Unclassified 1130
194 Ga0157372_10018246 3300013307 Bacteria 7543
195 Ga0157372_10358523 3300013307 Unclassified 1699
196 Ga0157372_10474093 3300013307 Unclassified 1459
197 Ga0157375_10054390 3300013308 Bacteria 3942
198 Ga0163163_10083812 3300014325 Bacteria 3193
199 Ga0182008_10093776 3300014497 Bacteria 1481
200 Ga0157379_10014803 3300014968 Bacteria 6840
201 Ga0157379_10402149 3300014968 Bacteria 1259
202 Ga0157376_10024813 3300014969 Bacteria 4714
203 Ga0157376_10101580 3300014969 Bacteria 2514
204 Ga0163161_10049716 3300017792 Bacteria 3031
205 Ga0207697_10000150 3300025315 Bacteria 34215
206 Ga0207697_10001296 3300025315 Bacteria 13733
207 Ga0207697_10003261 3300025315 Bacteria 8066
208 Ga0207697_10006313 3300025315 Bacteria 5383
209 Ga0207653_10046370 3300025885 Unclassified 1437
210 Ga0207653_10051698 3300025885 Bacteria 1369
211 Ga0207692_10066325 3300025898 Unclassified 1886
212 Ga0207688_10158857 3300025901 Bacteria 1339
213 Ga0207647_10003279 3300025904 Bacteria 12161
214 Ga0207685_10063623 3300025905 Unclassified 1470
215 Ga0207645_10010974 3300025907 Bacteria 6198
216 Ga0207645_10013217 3300025907 Bacteria 5570
217 Ga0207684_10001372 3300025910 Bacteria 26550
218 Ga0207684_10039506 3300025910 Bacteria 4002
219 Ga0207684_10042778 3300025910 Bacteria 3841
220 Ga0207684_10057845 3300025910 Bacteria 3290
221 Ga0207684_10099207 3300025910 Bacteria 2487
222 Ga0207693_10027406 3300025915 Bacteria 4505
223 Ga0207693_10150913 3300025915 Bacteria 1828
224 Ga0207663_10024543 3300025916 Bacteria 3472
225 Ga0207663_10054836 3300025916 Unclassified 2498
226 Ga0207663_10430508 3300025916 Bacteria 1014
227 Ga0207660_10037268 3300025917 Unclassified 3387
228 Ga0207662_10000246 3300025918 Bacteria 25081
229 Ga0207657_10016118 3300025919 Bacteria 7216
230 Ga0207649_10319977 3300025920 Bacteria 1139
231 Ga0207646_10001268 3300025922 Bacteria 31646
232 Ga0207646_10013332 3300025922 Bacteria 7863
233 Ga0207646_10030930 3300025922 Bacteria 4849
234 Ga0207646_10049729 3300025922 Bacteria 3754
235 Ga0207646_10069676 3300025922 Bacteria 3141
236 Ga0207646_10086948 3300025922 Unclassified 2797
237 Ga0207646_10138266 3300025922 Bacteria 2194
238 Ga0207646_10153406 3300025922 Bacteria 2077
239 Ga0207646_10154537 3300025922 Bacteria 2069
240 Ga0207646_10292952 3300025922 Bacteria 1470
241 Ga0207646_10499319 3300025922 Unclassified 1096
242 Ga0207681_10021726 3300025923 Bacteria 4083
243 Ga0207650_10174136 3300025925 Bacteria 1712
244 Ga0207659_10014338 3300025926 Bacteria 5107
245 Ga0207659_10095126 3300025926 Bacteria 2234
246 Ga0207659_10197562 3300025926 Bacteria 1604
247 Ga0207659_10693421 3300025926 Unclassified 872
248 Ga0207687_10101724 3300025927 Bacteria 2116
249 Ga0207700_10454967 3300025928 Bacteria 1129
250 Ga0207700_10641310 3300025928 Unclassified 947
251 Ga0207664_10087968 3300025929 Unclassified 2541
252 Ga0207644_10089536 3300025931 Bacteria 2291
253 Ga0207644_10256040 3300025931 Unclassified 1398
254 Ga0207644_10584717 3300025931 Bacteria 926
255 Ga0207690_10005805 3300025932 Bacteria 7302
256 Ga0207706_10004464 3300025933 Bacteria 13140
257 Ga0207706_10048282 3300025933 Bacteria 3765
258 Ga0207686_10030456 3300025934 Bacteria 3194
259 Ga0207670_10000799 3300025936 Bacteria 16417
260 Ga0207670_10016744 3300025936 Unclassified 4414
261 Ga0207670_10120507 3300025936 Unclassified 1906
262 Ga0207669_10207736 3300025937 Bacteria 1427
263 Ga0207704_10138567 3300025938 Bacteria 1698
264 Ga0207665_10020771 3300025939 Bacteria 4318
265 Ga0207665_10177952 3300025939 Bacteria 1539
266 Ga0207691_10011249 3300025940 Bacteria 8586
267 Ga0207691_10087779 3300025940 Bacteria 2790
268 Ga0207691_10129726 3300025940 Unclassified 2228
269 Ga0207661_10044338 3300025944 Unclassified 3515
270 Ga0207661_10364595 3300025944 Unclassified 1305
271 Ga0207679_10195776 3300025945 Bacteria 1684
272 Ga0207651_10048434 3300025960 Unclassified 2873
273 Ga0207668_10125912 3300025972 Unclassified 1948
274 Ga0207658_10015120 3300025986 Bacteria 5293
275 Ga0207658_10127268 3300025986 Bacteria 2041
276 Ga0207658_10249591 3300025986 Bacteria 1507
277 Ga0207703_10257565 3300026035 Bacteria 1576
278 Ga0207703_10755891 3300026035 Unclassified 926
279 Ga0207678_10005827 3300026067 Bacteria 10979
280 Ga0207678_10101326 3300026067 Unclassified 2459
281 Ga0207708_10206640 3300026075 Bacteria 1568
282 Ga0207641_10014157 3300026088 Bacteria 6538
283 Ga0207641_10309731 3300026088 Bacteria 1494
284 Ga0207648_10288837 3300026089 Unclassified 1468
285 Ga0207676_10416642 3300026095 Bacteria 1259
286 Ga0207675_100042757 3300026118 Unclassified 4231
287 Ga0207683_10151907 3300026121 Bacteria 2090
288 Ga0207683_10222595 3300026121 Bacteria 1719
289 Ga0268266_10075337 3300028379 Unclassified 2931
290 Ga0268266_10189058 3300028379 Unclassified 1879
291 Ga0268264_10019615 3300028381 Bacteria 5524
292 Ga0307513_10135408 3300031456 Bacteria 2400
293 Ga0373934_0112499 3300035086 Bacteria 1105
294 Ga0373953_0137569 3300035117 Bacteria 1044
295 Ga0373943_0103410 3300035170 Bacteria 1493
296 Ga0373961_0038827 3300035241 Bacteria 1366
297 Ga0373935_0022101 3300035692 Unclassified 3897
298 Ga0373927_0224904 3300035695 Unclassified 1233
299 Ga0373933_0234297 3300035724 Unclassified 1180
300 Ga0373947_0016676 3300035725 Bacteria 4221
301 Ga0373947_0205772 3300035725 Unclassified 1289
302 Ga0373937_0009626 3300036401 Bacteria 8415
303 Ga0373937_0042941 3300036401 Bacteria 4127
304 Ga0373925_0126993 3300037068 Unclassified 1985
305 Ga0373925_0186363 3300037068 Unclassified 1645
306 Ga0395899_0026246 3300037312 Unclassified 4396
307 Ga0395900_0022181 3300037418 Bacteria 6495
308 Ga0395900_0132888 3300037418 Bacteria 2550
309 Ga0395898_0006638 3300037466 Bacteria 12338
310 Ga0395898_0349548 3300037466 Bacteria 1410
311 Ga0395905_0385925 3300037471 Unclassified 1295
312 Ga0395901_0003778 3300038443 Bacteria 15252
313 Ga0395901_0339135 3300038443 Bacteria 1553
314 Ga0395901_0361791 3300038443 Unclassified 1496
315 Ga0439455_0059729 3300042012 Unclassified 1009
316 Ga0495592_0082457 3300046454 Unclassified 2324
317 Ga0495592_0346516 3300046454 Unclassified 953
318 Ga0495651_0012015 3300046462 Bacteria 6665
319 Ga0495651_0129068 3300046462 Bacteria 1848
320 Ga0495594_0127788 3300046499 Unclassified 1439
321 Ga0495630_0139598 3300046517 Unclassified 1842
322 Ga0495652_0030472 3300046529 Unclassified 4731
323 Ga0495652_0146853 3300046529 Unclassified 1847
324 Ga0495652_0273217 3300046529 Unclassified 1241
325 Ga0495665_0104182 3300046531 Bacteria 1489
326 Ga0495587_0033283 3300046536 Unclassified 3112
327 Ga0495598_0080762 3300046537 Bacteria 1043
328 Ga0495645_0009247 3300046543 Bacteria 6888
329 Ga0495645_0149219 3300046543 Unclassified 1626
330 Ga0495659_0214781 3300046664 Unclassified 793
331 Ga0495599_0017501 3300046678 Unclassified 4455
332 Ga0495623_0076083 3300046679 Bacteria 2083
333 Ga0495646_0042895 3300046680 Unclassified 2774
334 Ga0495613_0097074 3300046689 Bacteria 2131
335 Ga0495613_0381324 3300046689 Unclassified 964
336 Ga0495604_0210501 3300047317 Unclassified 1344
337 Ga0495674_0030064 3300047319 Bacteria 4942
338 Ga0495680_0386839 3300047322 Unclassified 968
339 Ga0495684_0016110 3300047471 Bacteria 5755
340 Ga0495684_0038995 3300047471 Bacteria 3641
341 Ga0496100_0123491 3300048903 Unclassified 1815
342 Ga0496102_0032042 3300048905 Bacteria 4721
343 Ga0496102_0048050 3300048905 Unclassified 3880
344 Ga0496102_0329632 3300048905 Bacteria 1438
345 Ga0496102_0442337 3300048905 Unclassified 1220
346 Ga0496103_0231993 3300048906 Unclassified 1187
347 Ga0496104_0279565 3300048907 Bacteria 1582
348 Ga0496104_0297154 3300048907 Bacteria 1527
349 Ga0496105_0077535 3300048908 Bacteria 2744
350 Ga0496106_0103642 3300048909 Viruses 2208
351 Ga0496107_0074656 3300048910 Bacteria 2467
352 Ga0496107_0203246 3300048910 Unclassified 1473
353 Ga0496108_0164208 3300048911 Bacteria 1920
354 Ga0496108_0257275 3300048911 Unclassified 1519
355 Ga0496109_0006080 3300048912 Bacteria 10142
356 Ga0496109_0262226 3300048912 Unclassified 1628
357 Ga0496110_0165680 3300048913 Bacteria 2004
358 Ga0496111_0187720 3300048914 Viruses 1537
359 Ga0496112_0045259 3300048915 Unclassified 4314
360 Ga0496112_0220366 3300048915 Unclassified 1853
361 Ga0496113_0379156 3300048916 Unclassified 1135
362 Ga0496114_0012500 3300048917 Bacteria 6798
363 Ga0496115_0139154 3300048918 Bacteria 2002
364 Ga0496115_0177928 3300048918 Unclassified 1759
365 Ga0496115_0190216 3300048918 Viruses 1696
366 nmdc:mga05p37_18075_c1 3300050507 Bacteria 8516
367 nmdc:mga08y16_314249_c1 3300050511 Bacteria 1613
368 nmdc:mga08y16_831361_c1 3300050511 Bacteria 914
369 nmdc:mga0n895_516709_c1 3300050512 Unclassified 1202
370 nmdc:mga08x19_102016_c1 3300050514 Unclassified 1905
371 nmdc:mga08x19_71040_c1 3300050514 Bacteria 2269
372 nmdc:mga0a205_177866_c1 3300050515 Bacteria 2022
373 Ga0495601_0010525 3300053077 Bacteria 5508
374 Ga0495601_0022305 3300053077 Unclassified 3885
375 Ga0495612_0047469 3300053078 Unclassified 1760
376 Ga0495595_0185503 3300053084 Unclassified 1033
377 Ga0495619_0079186 3300053085 Unclassified 2210
378 Ga0070707_100057695
379 CNXas_1000023
380 JGI25406J46586_10000005
381 Ga0065703_1019243
382 Ga0065704_10021230
383 Ga0065704_10024137
384 Ga0065712_10108401
385 Ga0065715_10007604
386 Ga0065715_10013222
387 Ga0065715_10108734
388 Ga0065715_10127693
389 Ga0065707_10041610
390 Ga0070676_10025458
391 Ga0070683_100007909
392 Ga0070683_100016380
393 Ga0070683_100122216
394 Ga0070683_100255567
395 Ga0070683_100407542
396 Ga0070690_100150009
397 Ga0070670_100202719
398 Ga0070666_10018397
399 Ga0068868_100163837
400 Ga0068868_100286815
401 Ga0070660_100146218
402 Ga0070660_100223752
403 Ga0070689_100000849
404 Ga0070689_100042034
405 Ga0070689_100189526
406 Ga0070687_100001087
407 Ga0070661_100203412
408 Ga0070661_100244643
409 Ga0070668_100053718
410 Ga0070669_100014507
411 Ga0070669_100355424
412 Ga0070675_100011861
413 Ga0070675_100049638
414 Ga0070675_100082749
415 Ga0070671_100176495
416 Ga0070671_100571695
417 Ga0070674_100022527
418 Ga0070673_100026721
419 Ga0070688_100027043
420 Ga0070659_100005065
421 Ga0070659_100008038
422 Ga0070667_100013866
423 Ga0070667_100131058
424 Ga0070714_100063014
425 Ga0070714_100085711
426 Ga0070714_100126002
427 Ga0070710_10129532
428 Ga0070710_10160305
429 Ga0070711_100037261
430 Ga0070711_100195507
431 Ga0070711_100413440
432 Ga0070708_100002808
433 Ga0070708_100023950
434 Ga0070708_100071514
435 Ga0070708_100101512
436 Ga0070708_100111916
437 Ga0070708_100163697
438 Ga0070708_100237070
439 Ga0070708_100299911
440 Ga0070708_100366119
441 Ga0070663_100169433
442 Ga0070663_100197074
443 Ga0070678_100496891
444 Ga0070662_100015888
445 Ga0070662_100337688
446 Ga0070681_10094983
447 Ga0070685_10174058
448 Ga0070706_100001307
449 Ga0070706_100042168
450 Ga0070706_100072710
451 Ga0070706_100451127
452 Ga0070706_100644055
453 Ga0070707_100005170
454 Ga0070707_100006283
455 Ga0070707_100013538
456 Ga0070707_100014183
457 Ga0070707_100023306
458 Ga0070707_100036794
459 Ga0070707_100039620
460 Ga0070707_100103475
461 Ga0070707_100111285
462 Ga0070707_100290791
463 Ga0070707_100340114
464 Ga0070707_100404253
465 Ga0070698_100007937
466 Ga0070698_100040117
467 Ga0070698_100045179
468 Ga0070698_100253874
469 Ga0070699_100138131
470 Ga0070679_100005772
471 Ga0070684_100053925
472 Ga0070684_100187507
473 Ga0070697_100000897
474 Ga0070697_100002854
475 Ga0070697_100007131
476 Ga0070697_100012623
477 Ga0070697_100012771
478 Ga0070697_100013304
479 Ga0070697_100017098
480 Ga0070697_100033404
481 Ga0070697_100061913
482 Ga0070697_100062059
483 Ga0070697_100237904
484 Ga0070697_100391109
485 Ga0070697_100551097
486 Ga0070686_100242191
487 Ga0070686_100498061
488 Ga0070695_100379810
489 Ga0070665_100089743
490 Ga0070665_100193911
491 Ga0070665_100237449
492 Ga0070665_100325280
493 Ga0070704_100060417
494 Ga0070664_100028179
495 Ga0068856_100016086
496 Ga0068861_100035377
497 Ga0068863_100002953
498 Ga0068863_100478658
499 Ga0068863_100562618
500 Ga0068858_100108078
501 Ga0068858_100400222
502 Ga0068858_100851911
503 Ga0068860_100041076
504 Ga0068860_100058829
505 Ga0068860_100106685
506 Ga0068862_100056746
507 Ga0081455_10004607
508 Ga0081455_10005191
509 Ga0081455_10006370
510 Ga0081455_10015926
511 Ga0081455_10038453
512 Ga0081455_10068550
513 Ga0081455_10099214
514 Ga0081455_10116242
515 Ga0081540_1022315
516 Ga0081539_10000026
517 Ga0081539_10033473
518 Ga0081539_10126481
519 Ga0070717_10000051
520 Ga0070717_10009498
521 Ga0070717_10017689
522 Ga0070717_10076307
523 Ga0070717_10120133
524 Ga0070717_10350018
525 Ga0070717_10379270
526 Ga0070717_10431101
527 Ga0070715_10046969
528 Ga0070716_100010164
529 Ga0070716_100053729
530 Ga0070716_100129698
531 Ga0070712_100021271
532 Ga0070712_100034523
533 Ga0070712_100082041
534 Ga0070712_100371676
535 Ga0068871_100204040
536 Ga0075434_100169873
537 Ga0068865_100137308
538 Ga0075436_100066690
539 Ga0075436_100074322
540 Ga0099794_10137273
541 Ga0099794_10255248
542 Ga0105250_10068247
543 Ga0111539_10111798
544 Ga0105245_10010117
545 Ga0105245_10269723
546 Ga0105245_10710118
547 Ga0105245_10787037
548 Ga0114129_10274717
549 Ga0105243_10021568
550 Ga0105241_10497834
551 Ga0105242_10007342
552 Ga0105242_10611051
553 Ga0105248_10745948
554 Ga0105249_10007900
555 Ga0105249_10349345
556 Ga0105239_10082816
557 Ga0157371_10246843
558 Ga0157370_10098182
559 Ga0157374_10042589
560 Ga0157374_10051939
561 Ga0157374_10062782
562 Ga0157374_10208759
563 Ga0157378_10049259
564 Ga0157378_10101167
565 Ga0157378_10117765
566 Ga0157378_10151086
567 Ga0157378_10189395
568 Ga0157378_10274653
569 Ga0163162_10097046
570 Ga0163162_10705660
571 Ga0157372_10018246
572 Ga0157372_10358523
573 Ga0157372_10474093
574 Ga0157375_10054390
575 Ga0163163_10083812
576 Ga0182008_10093776
577 Ga0157379_10014803
578 Ga0157379_10402149
579 Ga0157376_10024813
580 Ga0157376_10101580
581 Ga0163161_10049716
582 Ga0207697_10000150
583 Ga0207697_10001296
584 Ga0207697_10003261
585 Ga0207697_10006313
586 Ga0207653_10046370
587 Ga0207653_10051698
588 Ga0207692_10066325
589 Ga0207688_10158857
590 Ga0207647_10003279
591 Ga0207685_10063623
592 Ga0207645_10010974
593 Ga0207645_10013217
594 Ga0207684_10001372
595 Ga0207684_10039506
596 Ga0207684_10042778
597 Ga0207684_10057845
598 Ga0207684_10099207
599 Ga0207693_10027406
600 Ga0207693_10150913
601 Ga0207663_10024543
602 Ga0207663_10054836
603 Ga0207663_10430508
604 Ga0207660_10037268
605 Ga0207662_10000246
606 Ga0207657_10016118
607 Ga0207649_10319977
608 Ga0207646_10001268
609 Ga0207646_10013332
610 Ga0207646_10030930
611 Ga0207646_10049729
612 Ga0207646_10069676
613 Ga0207646_10086948
614 Ga0207646_10138266
615 Ga0207646_10153406
616 Ga0207646_10154537
617 Ga0207646_10292952
618 Ga0207646_10499319
619 Ga0207681_10021726
620 Ga0207650_10174136
621 Ga0207659_10014338
622 Ga0207659_10095126
623 Ga0207659_10197562
624 Ga0207659_10693421
625 Ga0207687_10101724
626 Ga0207700_10454967
627 Ga0207700_10641310
628 Ga0207664_10087968
629 Ga0207644_10089536
630 Ga0207644_10256040
631 Ga0207644_10584717
632 Ga0207690_10005805
633 Ga0207706_10004464
634 Ga0207706_10048282
635 Ga0207686_10030456
636 Ga0207670_10000799
637 Ga0207670_10016744
638 Ga0207670_10120507
639 Ga0207669_10207736
640 Ga0207704_10138567
641 Ga0207665_10020771
642 Ga0207665_10177952
643 Ga0207691_10011249
644 Ga0207691_10087779
645 Ga0207691_10129726
646 Ga0207661_10044338
647 Ga0207661_10364595
648 Ga0207679_10195776
649 Ga0207651_10048434
650 Ga0207668_10125912
651 Ga0207658_10015120
652 Ga0207658_10127268
653 Ga0207658_10249591
654 Ga0207703_10257565
655 Ga0207703_10755891
656 Ga0207678_10005827
657 Ga0207678_10101326
658 Ga0207708_10206640
659 Ga0207641_10014157
660 Ga0207641_10309731
661 Ga0207648_10288837
662 Ga0207676_10416642
663 Ga0207675_100042757
664 Ga0207683_10151907
665 Ga0207683_10222595
666 Ga0268266_10075337
667 Ga0268266_10189058
668 Ga0268264_10019615
669 Ga0307513_10135408
670 Ga0373934_0112499
671 Ga0373953_0137569
672 Ga0373943_0103410
673 Ga0373961_0038827
674 Ga0373935_0022101
675 Ga0373927_0224904
676 Ga0373933_0234297
677 Ga0373947_0016676
678 Ga0373947_0205772
679 Ga0373937_0009626
680 Ga0373937_0042941
681 Ga0373925_0126993
682 Ga0373925_0186363
683 Ga0395899_0026246
684 Ga0395900_0022181
685 Ga0395900_0132888
686 Ga0395898_0006638
687 Ga0395898_0349548
688 Ga0395905_0385925
689 Ga0395901_0003778
690 Ga0395901_0339135
691 Ga0395901_0361791
692 Ga0439455_0059729
693 Ga0495592_0082457
694 Ga0495592_0346516
695 Ga0495651_0012015
696 Ga0495651_0129068
697 Ga0495594_0127788
698 Ga0495630_0139598
699 Ga0495652_0030472
700 Ga0495652_0146853
701 Ga0495652_0273217
702 Ga0495665_0104182
703 Ga0495587_0033283
704 Ga0495598_0080762
705 Ga0495645_0009247
706 Ga0495645_0149219
707 Ga0495659_0214781
708 Ga0495599_0017501
709 Ga0495623_0076083
710 Ga0495646_0042895
711 Ga0495613_0097074
712 Ga0495613_0381324
713 Ga0495604_0210501
714 Ga0495674_0030064
715 Ga0495680_0386839
716 Ga0495684_0016110
717 Ga0495684_0038995
718 Ga0496100_0123491
719 Ga0496102_0032042
720 Ga0496102_0048050
721 Ga0496102_0329632
722 Ga0496102_0442337
723 Ga0496103_0231993
724 Ga0496104_0279565
725 Ga0496104_0297154
726 Ga0496105_0077535
727 Ga0496106_0103642
728 Ga0496107_0074656
729 Ga0496107_0203246
730 Ga0496108_0164208
731 Ga0496108_0257275
732 Ga0496109_0006080
733 Ga0496109_0262226
734 Ga0496110_0165680
735 Ga0496111_0187720
736 Ga0496112_0045259
737 Ga0496112_0220366
738 Ga0496113_0379156
739 Ga0496114_0012500
740 Ga0496115_0139154
741 Ga0496115_0177928
742 Ga0496115_0190216
743 nmdc:mga05p37_18075_c1
744 nmdc:mga08y16_314249_c1
745 nmdc:mga08y16_831361_c1
746 nmdc:mga0n895_516709_c1
747 nmdc:mga08x19_102016_c1
748 nmdc:mga08x19_71040_c1
749 nmdc:mga0a205_177866_c1
750 Ga0495601_0010525
751 Ga0495601_0022305
752 Ga0495612_0047469
753 Ga0495595_0185503
754 Ga0495619_0079186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

3

161

0.87

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

19

214

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kns-assembly3.cif.gz_C-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.805 3 246
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.7977 3 246
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.7951 3 246
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.7827 10 255
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.7715 10 246
ID Description Score Start End Superfamily
af_Q2G2U5_10_248_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9245 4 235 3.60.15.10
af_Q2G2U5_10_248_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8951 4 235 3.60.15.10
af_A4HTH3_270_494_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8131 43 72 3.40.50.720
af_Q8IK95_37_136_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8115 47 127 3.60.15.10
af_P30620_225_397_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8076 43 152 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A6N6PL09-F1-model_v4 MBL fold metallo-hydrolase 0.9557 26 258 GO:0016787
AF-A0A6N6PL09-F1-model_v4 MBL fold metallo-hydrolase 0.9518 26 258 GO:0016787
AF-A0A4Q3AGS8-F1-model_v4 MBL fold metallo-hydrolase 0.9434 2 248 GO:0016787
AF-A0A2A2QYN1-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9429 2 248
AF-A0A2V5YYW5-F1-model_v4 Metal-dependent hydrolase 0.9424 1 229 GO:0016787

Map