F427576

General Info

Members Datasets Scaffolds Average Seq Length
377 287 754 147

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10211964|Ga0070658_102119644
Length 156
Sequence MTTAALRHYDPPSLGNRLRNAQVMTQPLMLEIIDKACRRLPSLGRSERKARVMRLIDAEAWADAALALMELELPMWQVRRLAYDEGEWHCALSRERELPDWLDAAIEGCHGDLAIALLSAFVEVQALAAEASRPSVPSVRPVLDPLYEPLACDNFG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
49 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
50 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
51 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
82 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
172 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
180 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
183 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
184 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
185 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
186 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
192 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
193 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
194 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
195 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
196 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
197 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
198 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
199 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
200 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
201 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
202 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
203 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
204 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
205 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
206 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
207 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
208 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
209 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
210 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
211 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
212 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
213 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
214 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
215 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
216 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
217 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
218 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
219 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
220 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
221 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
222 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
223 2922368715
224 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
225 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
226 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
227 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
228 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
229 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
230 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
231 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
232 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
233 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
234 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
235 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
236 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
237 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
238 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
239 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
240 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
241 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
242 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
243 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
244 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
245 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
246 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
247 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
248 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
249 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
250 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
251 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
252 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
253 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
254 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
255 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
256 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
257 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
258 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
259 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
260 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
261 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
262 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
263 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
264 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
265 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
266 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
267 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
268 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
269 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
270 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
271 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
272 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
273 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
274 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
275 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
276 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
277 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
278 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
279 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
280 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
281 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
282 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
283 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
284 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
285 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
286 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
287 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.53
Metatranscriptomes 0
Isolates 24.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.71
Nodule 21.75
Rhizoplane 6.1
Rhizosphere 44.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10211964 3300005327 Bacteria 1637
2 JGI25165J46597_1007120 3300003214 Bacteria 1893
3 JGI25153J46596_10010230 3300003215 Bacteria 4262
4 JGI25153J46596_10017253 3300003215 Bacteria 2850
5 rootH1_10138224 3300003316 Bacteria 1606
6 rootL2_10313192 3300003322 Bacteria 1060
7 rootH1_10024258 3300003323 Bacteria 2881
8 Ga0055542_1004446 3300003762 Bacteria 3408
9 Ga0055543_1002407 3300004625 Bacteria 6215
10 Ga0065165_1000254 3300005262 Bacteria 92762
11 Ga0065165_1000376 3300005262 Bacteria 72908
12 Ga0070683_100521840 3300005329 Bacteria 1135
13 Ga0070682_100248757 3300005337 Bacteria 1280
14 Ga0070661_100013672 3300005344 Bacteria 5700
15 Ga0070668_100033011 3300005347 Bacteria 3940
16 Ga0070667_100381024 3300005367 Bacteria 1281
17 Ga0070663_100147091 3300005455 Bacteria 1803
18 Ga0070663_100363292 3300005455 Bacteria 1175
19 Ga0070662_100085830 3300005457 Bacteria 2353
20 Ga0068853_101550376 3300005539 Bacteria 642
21 Ga0068857_100349610 3300005577 Bacteria 1369
22 Ga0068854_100457658 3300005578 Bacteria 1067
23 Ga0068856_100257416 3300005614 Bacteria 1760
24 Ga0068852_100001808 3300005616 Bacteria 14531
25 Ga0068852_100377205 3300005616 Bacteria 1390
26 Ga0068852_101544985 3300005616 Bacteria 686
27 Ga0068861_100221398 3300005719 Bacteria 1600
28 Ga0068851_10678421 3300005834 Bacteria 633
29 Ga0068863_100702129 3300005841 Bacteria 1005
30 Ga0068860_102380828 3300005843 Bacteria 550
31 Ga0068862_100086005 3300005844 Bacteria 2733
32 Ga0075365_10052649 3300006038 Bacteria 2693
33 Ga0075365_10132310 3300006038 Bacteria 1727
34 Ga0075364_10124149 3300006051 Bacteria 1729
35 Ga0075367_10252612 3300006178 Bacteria 1106
36 Ga0075369_10046372 3300006186 Bacteria 1871
37 Ga0075369_10498512 3300006186 Bacteria 579
38 Ga0075370_10046769 3300006353 Bacteria 2449
39 Ga0105240_10002493 3300009093 Bacteria 29572
40 Ga0105245_10206943 3300009098 Bacteria 1887
41 Ga0105247_10204527 3300009101 Bacteria 1328
42 Ga0105243_10126739 3300009148 Bacteria 2161
43 Ga0105241_10013780 3300009174 Bacteria 5922
44 Ga0105241_10025497 3300009174 Bacteria 4393
45 Ga0105241_10781223 3300009174 Bacteria 878
46 Ga0105242_10716615 3300009176 Bacteria 981
47 Ga0105248_12964909 3300009177 Bacteria 541
48 Ga0105237_10003531 3300009545 Bacteria 18527
49 Ga0105237_10248044 3300009545 Bacteria 1782
50 Ga0105237_10838917 3300009545 Bacteria 926
51 Ga0105239_10039288 3300010375 Bacteria 5184
52 Ga0105239_10236160 3300010375 Bacteria 2052
53 Ga0105239_10255179 3300010375 Bacteria 1970
54 Ga0105239_10420007 3300010375 Bacteria 1515
55 Ga0105239_10426284 3300010375 Bacteria 1503
56 Ga0105239_11146969 3300010375 Bacteria 895
57 Ga0105246_10818830 3300011119 Bacteria 828
58 Ga0157374_12200461 3300013296 Bacteria 578
59 Ga0163162_10486454 3300013306 Bacteria 1365
60 Ga0157375_10024803 3300013308 Bacteria 5558
61 Ga0163163_10072062 3300014325 Bacteria 3443
62 Ga0182008_10191019 3300014497 Bacteria 1039
63 Ga0157376_10027864 3300014969 Bacteria 4484
64 Ga0157376_11532584 3300014969 Bacteria 700
65 Ga0214544_1030129 3300021320 Bacteria 1922
66 Ga0214542_1037198 3300021321 Bacteria 1399
67 Ga0214545_1033042 3300021324 Bacteria 1920
68 Ga0214543_1032861 3300021327 Bacteria 1920
69 Ga0209677_110190 3300025253 Bacteria 1592
70 Ga0209148_1000849 3300025254 Bacteria 21522
71 Ga0209233_1017482 3300025261 Bacteria 1951
72 Ga0209233_1018171 3300025261 Bacteria 1899
73 Ga0209233_1031112 3300025261 Bacteria 1250
74 Ga0209455_1001077 3300025272 Bacteria 13457
75 Ga0209673_1026991 3300025273 Bacteria 1875
76 Ga0209564_1013200 3300025295 Bacteria 3530
77 Ga0209758_1002770 3300025297 Bacteria 17161
78 Ga0209758_1004348 3300025297 Bacteria 11866
79 Ga0209758_1086786 3300025297 Bacteria 928
80 Ga0207426_1000213 3300025302 Bacteria 137311
81 Ga0207426_1001534 3300025302 Bacteria 18789
82 Ga0207426_1068623 3300025302 Bacteria 996
83 Ga0207654_10012121 3300025911 Bacteria 4412
84 Ga0207654_10013939 3300025911 Bacteria 4143
85 Ga0207654_10544011 3300025911 Bacteria 824
86 Ga0207695_10000006 3300025913 Bacteria 1135309
87 Ga0207671_10000774 3300025914 Bacteria 40531
88 Ga0207671_10642701 3300025914 Bacteria 845
89 Ga0207657_10127195 3300025919 Bacteria 2092
90 Ga0207649_10020094 3300025920 Bacteria 3825
91 Ga0207706_10120541 3300025933 Bacteria 2306
92 Ga0207665_10955371 3300025939 Bacteria 681
93 Ga0207668_10430697 3300025972 Bacteria 1121
94 Ga0207640_10271157 3300025981 Bacteria 1328
95 Ga0207639_10148730 3300026041 Bacteria 1959
96 Ga0207678_10201717 3300026067 Bacteria 1701
97 Ga0207678_10455710 3300026067 Bacteria 1112
98 Ga0207702_10512588 3300026078 Bacteria 1170
99 Ga0207698_10109765 3300026142 Bacteria 2309
100 Ga0207698_10395903 3300026142 Bacteria 1318
101 Ga0268265_10273798 3300028380 Bacteria 1507
102 Ga0268264_12494395 3300028381 Bacteria 522
103 Ga0307510_10210877 3300033180 Bacteria 1465
104 Ga0307510_10592625 3300033180 Bacteria 559
105 Ga0373925_0434502 3300037068 Bacteria 1074
106 Ga0436363_0168819 3300039450 Bacteria 552
107 Ga0451797_0008624 3300041453 Bacteria 691
108 Ga0451795_0361940 3300041456 Bacteria 983
109 Ga0451807_1276088 3300041486 Bacteria 786
110 Ga0451843_0530812 3300041509 Bacteria 643
111 Ga0451855_1460411 3300041511 Bacteria 705
112 Ga0466969_0022851 3300044656 Bacteria 3225
113 Ga0466966_0005071 3300044684 Bacteria 8650
114 Ga0466961_0000359 3300044693 Bacteria 29797
115 Ga0466963_0034178 3300044694 Bacteria 3307
116 Ga0466963_0051308 3300044694 Bacteria 2734
117 Ga0466957_1348211 3300044842 Bacteria 518
118 Ga0466960_0150877 3300044901 Bacteria 1241
119 Ga0466959_0003116 3300045049 Bacteria 10755
120 Ga0466958_0091970 3300045836 Bacteria 1878
121 Ga0466967_0282289 3300045976 Bacteria 1593
122 Ga0495592_0254252 3300046454 Bacteria 1160
123 Ga0495592_0389974 3300046454 Bacteria 884
124 Ga0495603_0201685 3300046455 Bacteria 1149
125 Ga0495590_0048592 3300046457 Bacteria 1480
126 Ga0495590_0262418 3300046457 Bacteria 644
127 Ga0495629_0002004 3300046459 Bacteria 15830
128 Ga0495629_0435610 3300046459 Bacteria 889
129 Ga0495651_0067954 3300046462 Bacteria 2717
130 Ga0495651_0375632 3300046462 Bacteria 933
131 Ga0495653_0111032 3300046463 Bacteria 1970
132 Ga0495653_0151609 3300046463 Bacteria 1619
133 Ga0495653_0506094 3300046463 Bacteria 752
134 Ga0495650_0087079 3300046471 Bacteria 1195
135 Ga0495664_0017425 3300046477 Bacteria 4106
136 Ga0495664_0272486 3300046477 Bacteria 1023
137 Ga0495585_0170633 3300046492 Bacteria 1124
138 Ga0495607_0233332 3300046501 Bacteria 894
139 Ga0495606_0090244 3300046507 Bacteria 1886
140 Ga0495606_0118951 3300046507 Bacteria 1583
141 Ga0495606_0280549 3300046507 Bacteria 911
142 Ga0495610_0407374 3300046512 Bacteria 500
143 Ga0495616_0127506 3300046513 Bacteria 1169
144 Ga0495618_0025246 3300046514 Bacteria 3687
145 Ga0495628_0746265 3300046516 Bacteria 688
146 Ga0495630_0091246 3300046517 Bacteria 2302
147 Ga0495630_0708791 3300046517 Bacteria 770
148 Ga0495643_0040191 3300046522 Bacteria 2555
149 Ga0495643_0105734 3300046522 Bacteria 1437
150 Ga0495643_0530856 3300046522 Bacteria 503
151 Ga0495648_0186080 3300046524 Bacteria 1051
152 Ga0495666_0374344 3300046526 Bacteria 641
153 Ga0495652_0031377 3300046529 Bacteria 4654
154 Ga0495652_0274351 3300046529 Bacteria 1238
155 Ga0495652_0661307 3300046529 Bacteria 706
156 Ga0495640_0012491 3300046533 Bacteria 6485
157 Ga0495640_0043979 3300046533 Bacteria 3107
158 Ga0495586_0145028 3300046535 Bacteria 1334
159 Ga0495587_0006206 3300046536 Bacteria 7799
160 Ga0495587_0495599 3300046536 Bacteria 676
161 Ga0495609_0054897 3300046538 Bacteria 1768
162 Ga0495597_0065499 3300046542 Bacteria 1576
163 Ga0495622_0005097 3300046557 Bacteria 6087
164 Ga0495622_0283241 3300046557 Bacteria 724
165 Ga0495667_0329463 3300046559 Bacteria 966
166 Ga0495667_0668428 3300046559 Bacteria 645
167 Ga0495634_0043633 3300046642 Bacteria 3039
168 Ga0495611_0077569 3300046648 Bacteria 1524
169 Ga0495611_0088953 3300046648 Bacteria 1426
170 Ga0495625_0037109 3300046660 Bacteria 3577
171 Ga0495625_0137953 3300046660 Bacteria 1647
172 Ga0495635_0013636 3300046663 Bacteria 5689
173 Ga0495661_0073213 3300046665 Bacteria 1997
174 Ga0495588_0081967 3300046674 Bacteria 1684
175 Ga0495588_0194209 3300046674 Bacteria 1072
176 Ga0495657_0019663 3300046675 Bacteria 4869
177 Ga0495657_0044794 3300046675 Bacteria 3007
178 Ga0495599_0009207 3300046678 Bacteria 6027
179 Ga0495646_0051658 3300046680 Bacteria 2487
180 Ga0495646_0157336 3300046680 Bacteria 1260
181 Ga0495613_0111758 3300046689 Bacteria 1968
182 Ga0495624_0103909 3300046690 Bacteria 1748
183 Ga0495624_0178572 3300046690 Bacteria 1294
184 Ga0495671_0411532 3300046692 Bacteria 647
185 Ga0495649_0013199 3300046694 Bacteria 4771
186 Ga0495600_0014837 3300046809 Bacteria 4914
187 Ga0495600_0015041 3300046809 Bacteria 4886
188 Ga0495604_0026783 3300047317 Bacteria 4588
189 Ga0495604_0038890 3300047317 Bacteria 3742
190 Ga0495674_0046939 3300047319 Bacteria 3832
191 Ga0495676_0078476 3300047321 Bacteria 2514
192 Ga0495680_0024593 3300047322 Bacteria 4995
193 Ga0495680_0029995 3300047322 Bacteria 4446
194 Ga0495683_0067968 3300047323 Bacteria 1754
195 Ga0495683_0077000 3300047323 Bacteria 1631
196 Ga0495687_167433 3300047443 Bacteria 732
197 Ga0495687_231496 3300047443 Bacteria 564
198 Ga0495675_0669455 3300047444 Bacteria 583
199 Ga0495673_0024211 3300047469 Bacteria 2939
200 Ga0495673_0187507 3300047469 Bacteria 780
201 Ga0495686_0095949 3300047472 Bacteria 1795
202 Ga0495686_0107807 3300047472 Bacteria 1674
203 Ga0495593_0048461 3300047673 Bacteria 2258
204 Ga0495602_0044567 3300048088 Bacteria 4023
205 Ga0495602_0851219 3300048088 Bacteria 609
206 Ga0496100_0079711 3300048903 Bacteria 2207
207 Ga0496100_1291665 3300048903 Bacteria 576
208 Ga0496102_0173118 3300048905 Bacteria 2032
209 Ga0496102_1477047 3300048905 Bacteria 598
210 Ga0496104_0017704 3300048907 Bacteria 6495
211 Ga0496104_0031886 3300048907 Bacteria 4903
212 Ga0496105_0044096 3300048908 Bacteria 3677
213 Ga0496105_0044461 3300048908 Bacteria 3663
214 Ga0496105_0994152 3300048908 Bacteria 628
215 Ga0496106_0194875 3300048909 Bacteria 1611
216 Ga0496108_0312654 3300048911 Bacteria 1369
217 Ga0496108_0353997 3300048911 Bacteria 1281
218 Ga0496112_0188987 3300048915 Bacteria 2022
219 Ga0496113_0055450 3300048916 Bacteria 2971
220 Ga0496113_0071027 3300048916 Bacteria 2648
221 Ga0496114_0051874 3300048917 Bacteria 3416
222 Ga0496114_0763795 3300048917 Bacteria 844
223 Ga0496115_0068467 3300048918 Bacteria 2874
224 Ga0496115_0103255 3300048918 Bacteria 2338
225 Ga0496115_1380123 3300048918 Bacteria 521
226 Ga0496116_0041357 3300048919 Bacteria 3163
227 Ga0496117_0091389 3300048920 Bacteria 1958
228 Ga0496118_0117386 3300048921 Bacteria 1746
229 Ga0496118_0195307 3300048921 Bacteria 1205
230 Ga0496119_0040100 3300048922 Bacteria 3000
231 Ga0496120_0005339 3300048923 Bacteria 10289
232 Ga0496120_0243282 3300048923 Bacteria 848
233 Ga0496121_0019434 3300048924 Bacteria 6792
234 Ga0496121_0316562 3300048924 Bacteria 1052
235 Ga0496122_0235504 3300048925 Bacteria 1037
236 Ga0496122_0427357 3300048925 Bacteria 664
237 Ga0496124_0258273 3300048927 Bacteria 1284
238 Ga0496124_0266141 3300048927 Bacteria 1258
239 Ga0496124_0853205 3300048927 Bacteria 558
240 Ga0496125_0075964 3300048928 Bacteria 2597
241 Ga0496126_0012315 3300048929 Bacteria 8775
242 Ga0496126_0114093 3300048929 Bacteria 2351
243 Ga0496126_0513394 3300048929 Bacteria 956
244 Ga0495682_0043164 3300049460 Bacteria 1651
245 nmdc:mga0yw44_112584_c1 3300050492 Bacteria 1745
246 nmdc:mga0yw44_392387_c1 3300050492 Bacteria 938
247 nmdc:mga0yw44_454609_c1 3300050492 Bacteria 868
248 nmdc:mga0k408_390772_c1 3300050493 Bacteria 828
249 nmdc:mga06z11_94509_c1 3300050494 Bacteria 1629
250 nmdc:mga06z11_955745_c1 3300050494 Bacteria 522
251 nmdc:mga07m45_273556_c1 3300050496 Bacteria 982
252 nmdc:mga07m45_70290_c1 3300050496 Bacteria 1991
253 nmdc:mga0sz30_150750_c1 3300050516 Bacteria 1029
254 nmdc:mga0sz30_22083_c1 3300050516 Bacteria 2580
255 nmdc:mga0sz30_233835_c1 3300050516 Bacteria 818
256 Ga0495601_0196728 3300053077 Bacteria 1318
257 Ga0495601_0304901 3300053077 Bacteria 1037
258 Ga0500610_0069302 3300053079 Bacteria 1840
259 Ga0495655_0046466 3300053083 Bacteria 1132
260 Ga0495655_0094119 3300053083 Bacteria 878
261 Ga0495619_0239264 3300053085 Bacteria 1258
262 Ga0500578_0051643 3300053086 Bacteria 2634
263 Ga0500578_0501903 3300053086 Bacteria 682
264 Ga0500583_0042702 3300053092 Bacteria 2067
265 Ga0500651_0280241 3300053093 Bacteria 962
266 Ga0500566_0002819 3300053094 Bacteria 10353
267 Ga0500641_0020768 3300053096 Bacteria 2495
268 Ga0500650_0096935 3300053098 Bacteria 1381
269 Ga0500555_012859 3300053103 Bacteria 2410
270 Ga0500595_005559 3300053119 Bacteria 5492
271 Ga0500595_086140 3300053119 Bacteria 914
272 Ga0500607_239586 3300053121 Bacteria 734
273 Ga0500608_325008 3300053122 Bacteria 558
274 Ga0500614_052530 3300053123 Bacteria 1074
275 Ga0500642_0042969 3300053130 Bacteria 1961
276 Ga0500655_097800 3300053133 Bacteria 613
277 Ga0500568_0030556 3300053139 Bacteria 2229
278 Ga0500577_0077468 3300053142 Bacteria 1318
279 Ga0500604_0055973 3300053151 Bacteria 1228
280 Ga0500627_0248988 3300053158 Bacteria 787
281 Ga0500634_0105813 3300053161 Bacteria 1399
282 Ga0500645_031105 3300053730 Bacteria 1604
283 Ga0500609_004602 3300053731 Bacteria 1902
284 Ga0500661_055983 3300055283 Bacteria 708
285 2513637288 2513237094 Bacteria 8789602
286 2513874825 2513237139 Bacteria 8737671
287 2517100773 2517093001 Bacteria 9002274
288 2617350556 2617270735 Bacteria 9163226
289 2805916826 2802429603 Bacteria 8777136
290 2824663313 2824661429 Bacteria 9877870
291 2824698643 2824696289 Bacteria 8335049
292 2824707124 2824704595 Bacteria 9667483
293 2824734764 2824732956 Bacteria 7810675
294 2824747662 2824746037 Bacteria 7911610
295 2824754560 2824753945 Bacteria 9787441
296 2824765394 2824763712 Bacteria 9792355
297 2841962067 2841957949 Bacteria 8652217
298 2842042522 2842038055 Bacteria 8002051
299 2842050565 2842045827 Bacteria 8006841
300 2844316728 2844315083 Bacteria 8138177
301 2847944059 2847939898 Bacteria 8606328
302 2874597936 2874590934 Bacteria 8299676
303 2874651464 2874645413 Bacteria 8214782
304 2876776536 2876771140 Bacteria 8287509
305 2876824874 2876818435 Bacteria 8274608
306 2879081601 2879074833 Bacteria 8279565
307 2879134224 2879127579 Bacteria 8294491
308 2879145862 2879142872 Bacteria 8267021
309 2885410552 2885409591 Bacteria 9235467
310 2903733783 2903727486 Bacteria 8281579
311 2904718802 2904711408 Bacteria 9771557
312 2906608033 2906602504 Bacteria 8295279
313 2922370985
314 2929619382 2929615660 Bacteria 9193770
315 2929628148 2929624759 Bacteria 9339455
316 2932785681 2932784394 Bacteria 9704911
317 2932799090 2932794094 Bacteria 7915132
318 2932808494 2932801729 Bacteria 7987968
319 2932830745 2932828146 Bacteria 9745859
320 2933581302 2933577622 Bacteria 9116884
321 2935612568 2935608549 Bacteria 8203142
322 2935639871 2935638405 Bacteria 10015038
323 2935653534 2935648319 Bacteria 8801166
324 2935662283 2935656913 Bacteria 8965014
325 2935667275 2935665750 Bacteria 9571747
326 2935677647 2935675223 Bacteria 9928132
327 2935690414 2935684952 Bacteria 9590419
328 2935697262 2935694250 Bacteria 9291695
329 2935705031 2935703347 Bacteria 10242284
330 2935717890 2935713505 Bacteria 9608509
331 2935726960 2935722832 Bacteria 9608746
332 2935735730 2935732158 Bacteria 9706831
333 2935744999 2935741537 Bacteria 9707219
334 2935755424 2935750917 Bacteria 9590372
335 2935803567 2935801545 Bacteria 9301974
336 2935811487 2935810662 Bacteria 9401221
337 2935824057 2935819856 Bacteria 8261050
338 2935829354 2935827899 Bacteria 10038562
339 2935842668 2935837841 Bacteria 9454360
340 2935852796 2935847175 Bacteria 8228321
341 2935884695 2935883170 Bacteria 7964738
342 2935912053 2935908558 Bacteria 8568796
343 2935922264 2935916978 Bacteria 9113783
344 2935929082 2935926038 Bacteria 8601059
345 2935935713 2935934488 Bacteria 8602579
346 2935947279 2935942939 Bacteria 8599779
347 2935953627 2935951376 Bacteria 8602333
348 2935961860 2935959822 Bacteria 7869783
349 2935968653 2935967501 Bacteria 8603075
350 2935976859 2935975950 Bacteria 8347125
351 2935986179 2935984226 Bacteria 8302647
352 2935995255 2935992306 Bacteria 9802711
353 2936004142 2936002035 Bacteria 9362176
354 2936016585 2936011229 Bacteria 8801034
355 2936025101 2936019824 Bacteria 8804134
356 2936034060 2936028420 Bacteria 8965941
357 2936052000 2936046547 Bacteria 8903709
358 2936059773 2936055302 Bacteria 8785755
359 2940561295 2940556831 Bacteria 9590747
360 2941533517 2941531003 Bacteria 7653939
361 2941544485 2941538514 Bacteria 9402094
362 3005596338 3005594810 Bacteria 8716512
363 3005712419 3005710791 Bacteria 7622528
364 3005719494 3005718088 Bacteria 8283608
365 8016516660 8016511872 Bacteria 9921665
366 8016637865 8016630954 Bacteria 9217207
367 8017059895 8017057580 Bacteria 10023680
368 8019579385 8019576017 Bacteria 10049540
369 8019604243 8019597564 Bacteria 10041141
370 8019614290 8019608314 Bacteria 10042931
371 8019624932 8019619141 Bacteria 9218857
372 8019650239 8019648815 Bacteria 10014479
373 8019674642 8019668869 Bacteria 8791617
374 8019681458 8019678201 Bacteria 8863603
375 8019694322 8019687851 Bacteria 8712826
376 8055749361 8055742211 Bacteria 9226248
377 8056973612 8056967851 Bacteria 9038162
378 Ga0070658_10211964
379 JGI25165J46597_1007120
380 JGI25153J46596_10010230
381 JGI25153J46596_10017253
382 rootH1_10138224
383 rootL2_10313192
384 rootH1_10024258
385 Ga0055542_1004446
386 Ga0055543_1002407
387 Ga0065165_1000254
388 Ga0065165_1000376
389 Ga0070683_100521840
390 Ga0070682_100248757
391 Ga0070661_100013672
392 Ga0070668_100033011
393 Ga0070667_100381024
394 Ga0070663_100147091
395 Ga0070663_100363292
396 Ga0070662_100085830
397 Ga0068853_101550376
398 Ga0068857_100349610
399 Ga0068854_100457658
400 Ga0068856_100257416
401 Ga0068852_100001808
402 Ga0068852_100377205
403 Ga0068852_101544985
404 Ga0068861_100221398
405 Ga0068851_10678421
406 Ga0068863_100702129
407 Ga0068860_102380828
408 Ga0068862_100086005
409 Ga0075365_10052649
410 Ga0075365_10132310
411 Ga0075364_10124149
412 Ga0075367_10252612
413 Ga0075369_10046372
414 Ga0075369_10498512
415 Ga0075370_10046769
416 Ga0105240_10002493
417 Ga0105245_10206943
418 Ga0105247_10204527
419 Ga0105243_10126739
420 Ga0105241_10013780
421 Ga0105241_10025497
422 Ga0105241_10781223
423 Ga0105242_10716615
424 Ga0105248_12964909
425 Ga0105237_10003531
426 Ga0105237_10248044
427 Ga0105237_10838917
428 Ga0105239_10039288
429 Ga0105239_10236160
430 Ga0105239_10255179
431 Ga0105239_10420007
432 Ga0105239_10426284
433 Ga0105239_11146969
434 Ga0105246_10818830
435 Ga0157374_12200461
436 Ga0163162_10486454
437 Ga0157375_10024803
438 Ga0163163_10072062
439 Ga0182008_10191019
440 Ga0157376_10027864
441 Ga0157376_11532584
442 Ga0214544_1030129
443 Ga0214542_1037198
444 Ga0214545_1033042
445 Ga0214543_1032861
446 Ga0209677_110190
447 Ga0209148_1000849
448 Ga0209233_1017482
449 Ga0209233_1018171
450 Ga0209233_1031112
451 Ga0209455_1001077
452 Ga0209673_1026991
453 Ga0209564_1013200
454 Ga0209758_1002770
455 Ga0209758_1004348
456 Ga0209758_1086786
457 Ga0207426_1000213
458 Ga0207426_1001534
459 Ga0207426_1068623
460 Ga0207654_10012121
461 Ga0207654_10013939
462 Ga0207654_10544011
463 Ga0207695_10000006
464 Ga0207671_10000774
465 Ga0207671_10642701
466 Ga0207657_10127195
467 Ga0207649_10020094
468 Ga0207706_10120541
469 Ga0207665_10955371
470 Ga0207668_10430697
471 Ga0207640_10271157
472 Ga0207639_10148730
473 Ga0207678_10201717
474 Ga0207678_10455710
475 Ga0207702_10512588
476 Ga0207698_10109765
477 Ga0207698_10395903
478 Ga0268265_10273798
479 Ga0268264_12494395
480 Ga0307510_10210877
481 Ga0307510_10592625
482 Ga0373925_0434502
483 Ga0436363_0168819
484 Ga0451797_0008624
485 Ga0451795_0361940
486 Ga0451807_1276088
487 Ga0451843_0530812
488 Ga0451855_1460411
489 Ga0466969_0022851
490 Ga0466966_0005071
491 Ga0466961_0000359
492 Ga0466963_0034178
493 Ga0466963_0051308
494 Ga0466957_1348211
495 Ga0466960_0150877
496 Ga0466959_0003116
497 Ga0466958_0091970
498 Ga0466967_0282289
499 Ga0495592_0254252
500 Ga0495592_0389974
501 Ga0495603_0201685
502 Ga0495590_0048592
503 Ga0495590_0262418
504 Ga0495629_0002004
505 Ga0495629_0435610
506 Ga0495651_0067954
507 Ga0495651_0375632
508 Ga0495653_0111032
509 Ga0495653_0151609
510 Ga0495653_0506094
511 Ga0495650_0087079
512 Ga0495664_0017425
513 Ga0495664_0272486
514 Ga0495585_0170633
515 Ga0495607_0233332
516 Ga0495606_0090244
517 Ga0495606_0118951
518 Ga0495606_0280549
519 Ga0495610_0407374
520 Ga0495616_0127506
521 Ga0495618_0025246
522 Ga0495628_0746265
523 Ga0495630_0091246
524 Ga0495630_0708791
525 Ga0495643_0040191
526 Ga0495643_0105734
527 Ga0495643_0530856
528 Ga0495648_0186080
529 Ga0495666_0374344
530 Ga0495652_0031377
531 Ga0495652_0274351
532 Ga0495652_0661307
533 Ga0495640_0012491
534 Ga0495640_0043979
535 Ga0495586_0145028
536 Ga0495587_0006206
537 Ga0495587_0495599
538 Ga0495609_0054897
539 Ga0495597_0065499
540 Ga0495622_0005097
541 Ga0495622_0283241
542 Ga0495667_0329463
543 Ga0495667_0668428
544 Ga0495634_0043633
545 Ga0495611_0077569
546 Ga0495611_0088953
547 Ga0495625_0037109
548 Ga0495625_0137953
549 Ga0495635_0013636
550 Ga0495661_0073213
551 Ga0495588_0081967
552 Ga0495588_0194209
553 Ga0495657_0019663
554 Ga0495657_0044794
555 Ga0495599_0009207
556 Ga0495646_0051658
557 Ga0495646_0157336
558 Ga0495613_0111758
559 Ga0495624_0103909
560 Ga0495624_0178572
561 Ga0495671_0411532
562 Ga0495649_0013199
563 Ga0495600_0014837
564 Ga0495600_0015041
565 Ga0495604_0026783
566 Ga0495604_0038890
567 Ga0495674_0046939
568 Ga0495676_0078476
569 Ga0495680_0024593
570 Ga0495680_0029995
571 Ga0495683_0067968
572 Ga0495683_0077000
573 Ga0495687_167433
574 Ga0495687_231496
575 Ga0495675_0669455
576 Ga0495673_0024211
577 Ga0495673_0187507
578 Ga0495686_0095949
579 Ga0495686_0107807
580 Ga0495593_0048461
581 Ga0495602_0044567
582 Ga0495602_0851219
583 Ga0496100_0079711
584 Ga0496100_1291665
585 Ga0496102_0173118
586 Ga0496102_1477047
587 Ga0496104_0017704
588 Ga0496104_0031886
589 Ga0496105_0044096
590 Ga0496105_0044461
591 Ga0496105_0994152
592 Ga0496106_0194875
593 Ga0496108_0312654
594 Ga0496108_0353997
595 Ga0496112_0188987
596 Ga0496113_0055450
597 Ga0496113_0071027
598 Ga0496114_0051874
599 Ga0496114_0763795
600 Ga0496115_0068467
601 Ga0496115_0103255
602 Ga0496115_1380123
603 Ga0496116_0041357
604 Ga0496117_0091389
605 Ga0496118_0117386
606 Ga0496118_0195307
607 Ga0496119_0040100
608 Ga0496120_0005339
609 Ga0496120_0243282
610 Ga0496121_0019434
611 Ga0496121_0316562
612 Ga0496122_0235504
613 Ga0496122_0427357
614 Ga0496124_0258273
615 Ga0496124_0266141
616 Ga0496124_0853205
617 Ga0496125_0075964
618 Ga0496126_0012315
619 Ga0496126_0114093
620 Ga0496126_0513394
621 Ga0495682_0043164
622 nmdc:mga0yw44_112584_c1
623 nmdc:mga0yw44_392387_c1
624 nmdc:mga0yw44_454609_c1
625 nmdc:mga0k408_390772_c1
626 nmdc:mga06z11_94509_c1
627 nmdc:mga06z11_955745_c1
628 nmdc:mga07m45_273556_c1
629 nmdc:mga07m45_70290_c1
630 nmdc:mga0sz30_150750_c1
631 nmdc:mga0sz30_22083_c1
632 nmdc:mga0sz30_233835_c1
633 Ga0495601_0196728
634 Ga0495601_0304901
635 Ga0500610_0069302
636 Ga0495655_0046466
637 Ga0495655_0094119
638 Ga0495619_0239264
639 Ga0500578_0051643
640 Ga0500578_0501903
641 Ga0500583_0042702
642 Ga0500651_0280241
643 Ga0500566_0002819
644 Ga0500641_0020768
645 Ga0500650_0096935
646 Ga0500555_012859
647 Ga0500595_005559
648 Ga0500595_086140
649 Ga0500607_239586
650 Ga0500608_325008
651 Ga0500614_052530
652 Ga0500642_0042969
653 Ga0500655_097800
654 Ga0500568_0030556
655 Ga0500577_0077468
656 Ga0500604_0055973
657 Ga0500627_0248988
658 Ga0500634_0105813
659 Ga0500645_031105
660 Ga0500609_004602
661 Ga0500661_055983
662 2513637288
663 2513874825
664 2517100773
665 2617350556
666 2805916826
667 2824663313
668 2824698643
669 2824707124
670 2824734764
671 2824747662
672 2824754560
673 2824765394
674 2841962067
675 2842042522
676 2842050565
677 2844316728
678 2847944059
679 2874597936
680 2874651464
681 2876776536
682 2876824874
683 2879081601
684 2879134224
685 2879145862
686 2885410552
687 2903733783
688 2904718802
689 2906608033
690 2922370985
691 2929619382
692 2929628148
693 2932785681
694 2932799090
695 2932808494
696 2932830745
697 2933581302
698 2935612568
699 2935639871
700 2935653534
701 2935662283
702 2935667275
703 2935677647
704 2935690414
705 2935697262
706 2935705031
707 2935717890
708 2935726960
709 2935735730
710 2935744999
711 2935755424
712 2935803567
713 2935811487
714 2935824057
715 2935829354
716 2935842668
717 2935852796
718 2935884695
719 2935912053
720 2935922264
721 2935929082
722 2935935713
723 2935947279
724 2935953627
725 2935961860
726 2935968653
727 2935976859
728 2935986179
729 2935995255
730 2936004142
731 2936016585
732 2936025101
733 2936034060
734 2936052000
735 2936059773
736 2940561295
737 2941533517
738 2941544485
739 3005596338
740 3005712419
741 3005719494
742 8016516660
743 8016637865
744 8017059895
745 8019579385
746 8019604243
747 8019614290
748 8019624932
749 8019650239
750 8019674642
751 8019681458
752 8019694322
753 8055749361
754 8056973612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rpx-assembly1.cif.gz_A cytokine receptor-like factor 3 c-terminus residues 174-442: native 0.7515 73 95
4bjz-assembly1.cif.gz_A crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data 0.7199 74 90
7d9g-assembly1.cif.gz_A spdh spermidine dehydrogenase native structure 0.679 74 109
8egn-assembly1.cif.gz_A crystal structure of udp-n-acetylmuramate-l-alanine ligase (udp-n-acetylmuramoyl-l-alanine synthetase, murc) pseudomonas aeruginosa in complex with ligand az-13643701 0.667 73 128
8egn-assembly1.cif.gz_B crystal structure of udp-n-acetylmuramate-l-alanine ligase (udp-n-acetylmuramoyl-l-alanine synthetase, murc) pseudomonas aeruginosa in complex with ligand az-13643701 0.664 73 127
ID Description Score Start End Superfamily
af_P84634_652_752_3.30.160.380 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Dicer dimerisation domain 0.7011 74 122 3.30.160.380
2a8xB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6756 74 110 3.50.50.60
af_A0A0R4IIG9_553_737_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6578 74 102 2.60.40.10
af_G5EGQ6_1569_2607_2.180.10.10 Mainly Beta;Shell;RHS repeat-associated core;RHS repeat-associated core 0.6539 74 90 2.180.10.10
af_Q8BI58_82_466_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6517 72 96 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2T7U1H7-F1-model_v4 DUF3806 domain-containing protein 0.8638 4 140
AF-A0A1B3MJJ0-F1-model_v4 deleted 0.8621 10 125
AF-A0A7W6DAZ9-F1-model_v4 Uncharacterized protein 0.8479 10 123
AF-A0A7Y6UPL2-F1-model_v4 Uncharacterized protein 0.8469 7 128
AF-A0A6M7UTQ3-F1-model_v4 Uncharacterized protein 0.8132 7 134

Map