F427575

General Info

Members Datasets Scaffolds Average Seq Length
377 203 355 260

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10093101|Ga0065714_100931012
Length 318
Sequence MVSFSGACIFCFYRNGSRSLKRSKNDILIFKAVEAVLMDCCSDTRKTLLILQLLEGEYMSLVRAKKHLGQHFLTDKKIAAKIVNGLVHTDQYKQVLEVGPGMGILSDLLLERADLETFMIDIDVESYHFLKEKYPQLGDRLINGDFLALDLSSIFKEKYAIIGNFPYNISSQILFKILENRTQVVEMVGMFQKEVAERCASKEGTKDYGILSVLIQAYYDIEYLFTVKPGTFNPPPKVNSGVIRLSRNDVETLPCDEKLFWRTVKAGFNQRRKTLRNALSGVVPKEKMDDHIFFDKRAEQLSVAQFIELTQHLTQLSQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
10 2818991437 Pedobacter terrae 518 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
18 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
19 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
20 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
21 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
22 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
23 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
132 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
133 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
134 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 0
Isolates 5.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 0
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1336827 2162886007 Bacteria 2709
2 SwRhRL2b_contig_2255685 2162886007 Bacteria 19658
3 JGI24735J21928_10000011 3300002067 Bacteria 217841
4 JGI24744J21845_10001519 3300002077 Bacteria 4616
5 JGI25157J39369_1003397 3300002741 Bacteria 3275
6 JGI25152J39213_1000007 3300002773 Bacteria 156012
7 JGI25150J39212_1000013 3300002774 Bacteria 182307
8 JGI25151J46595_10000004 3300003187 Bacteria 494006
9 JGI25165J46597_1002399 3300003214 Bacteria 6175
10 JGI25165J46597_1010571 3300003214 Bacteria 1341
11 JGI25153J46596_10000004 3300003215 Bacteria 494006
12 rootH1_10037104 3300003316 Bacteria 8750
13 rootH1_10075619 3300003316 Bacteria 1782
14 rootH2_10021444 3300003320 Bacteria 14118
15 rootH2_10057796 3300003320 Bacteria 14763
16 rootH1_10058344 3300003323 Bacteria 3034
17 Ga0055530_10006790 3300003791 Bacteria 4985
18 Ga0065714_10003722 3300005288 Bacteria 22816
19 Ga0065714_10005274 3300005288 Bacteria 4753
20 Ga0065714_10006151 3300005288 Bacteria 6883
21 Ga0065714_10064539 3300005288 Bacteria 39775
22 Ga0065714_10081094 3300005288 Bacteria 2374
23 Ga0065714_10093101 3300005288 Bacteria 1857
24 Ga0065704_10000425 3300005289 Bacteria 76756
25 Ga0065715_10102504 3300005293 Bacteria 3108
26 Ga0070658_10000058 3300005327 Bacteria 113042
27 Ga0070658_10122897 3300005327 Unclassified 2158
28 Ga0070658_10403921 3300005327 Bacteria 1174
29 Ga0070683_100047480 3300005329 Bacteria 3967
30 Ga0068868_100139701 3300005338 Bacteria 1988
31 Ga0070660_100107348 3300005339 Unclassified 2218
32 Ga0070689_100086497 3300005340 Bacteria 2465
33 Ga0070671_100017668 3300005355 Bacteria 5780
34 Ga0070659_100000120 3300005366 Bacteria 59172
35 Ga0070659_100002519 3300005366 Bacteria 13010
36 Ga0070714_100237548 3300005435 Bacteria 1681
37 Ga0070662_100000043 3300005457 Bacteria 70660
38 Ga0070681_10006021 3300005458 Bacteria 11752
39 Ga0070679_100011061 3300005530 Bacteria 8584
40 Ga0070684_100054219 3300005535 Bacteria 3493
41 Ga0068853_100026336 3300005539 Bacteria 4882
42 Ga0068853_100312235 3300005539 Bacteria 1456
43 Ga0068853_100342855 3300005539 Bacteria 1389
44 Ga0070665_100000017 3300005548 Bacteria 448013
45 Ga0070665_100533748 3300005548 Bacteria 1185
46 Ga0068855_100003512 3300005563 Bacteria 19184
47 Ga0068855_100005005 3300005563 Bacteria 16170
48 Ga0068855_100018195 3300005563 Bacteria 8441
49 Ga0068855_100250651 3300005563 Bacteria 1975
50 Ga0068857_100009507 3300005577 Bacteria 8442
51 Ga0068854_100115173 3300005578 Bacteria 2033
52 Ga0068856_100000533 3300005614 Bacteria 41989
53 Ga0068856_100006135 3300005614 Bacteria 11797
54 Ga0068856_100040345 3300005614 Bacteria 4585
55 Ga0068856_100262493 3300005614 Bacteria 1742
56 Ga0068852_100083913 3300005616 Bacteria 2834
57 Ga0068852_100135385 3300005616 Bacteria 2274
58 Ga0068852_101027641 3300005616 Bacteria 843
59 Ga0068858_100111225 3300005842 Bacteria 2558
60 Ga0068860_100080038 3300005843 Bacteria 3107
61 Ga0070716_100088275 3300006173 Bacteria 1870
62 Ga0075366_10000867 3300006195 Bacteria 14594
63 Ga0075366_10003163 3300006195 Bacteria 8624
64 Ga0097621_100000099 3300006237 Bacteria 48404
65 Ga0068871_100000290 3300006358 Bacteria 35074
66 Ga0068865_100005903 3300006881 Bacteria 7448
67 Ga0105244_10017072 3300009036 Bacteria 4114
68 Ga0105240_10000185 3300009093 Bacteria 126364
69 Ga0105240_10034592 3300009093 Bacteria 6516
70 Ga0105240_10145438 3300009093 Bacteria 2829
71 Ga0105240_10171479 3300009093 Bacteria 2569
72 Ga0105240_10184210 3300009093 Bacteria 2461
73 Ga0105240_10368025 3300009093 Bacteria 1626
74 Ga0105240_10480891 3300009093 Bacteria 1384
75 Ga0105243_10000003 3300009148 Bacteria 712931
76 Ga0105241_10043527 3300009174 Bacteria 3401
77 Ga0105241_10165927 3300009174 Bacteria 1820
78 Ga0105242_10167514 3300009176 Bacteria 1928
79 Ga0105237_10000753 3300009545 Bacteria 44372
80 Ga0105237_10000805 3300009545 Bacteria 42788
81 Ga0105237_10000887 3300009545 Bacteria 40325
82 Ga0105237_10002200 3300009545 Bacteria 24430
83 Ga0105237_10038594 3300009545 Bacteria 4823
84 Ga0105237_10042910 3300009545 Bacteria 4558
85 Ga0105238_10022537 3300009551 Bacteria 6419
86 Ga0105238_10324157 3300009551 Bacteria 1527
87 Ga0105238_10790286 3300009551 Bacteria 964
88 Ga0105239_10000008 3300010375 Bacteria 376925
89 Ga0105239_10000069 3300010375 Bacteria 144493
90 Ga0105239_10001468 3300010375 Bacteria 31351
91 Ga0105239_10001852 3300010375 Bacteria 27676
92 Ga0105239_10020482 3300010375 Bacteria 7295
93 Ga0105239_10030608 3300010375 Bacteria 5919
94 Ga0105239_10050545 3300010375 Bacteria 4559
95 Ga0105239_10191996 3300010375 Bacteria 2286
96 Ga0105239_10480436 3300010375 Bacteria 1411
97 Ga0105239_10514020 3300010375 Bacteria 1362
98 Ga0105239_10725053 3300010375 Bacteria 1137
99 Ga0105246_10025065 3300011119 Bacteria 3885
100 Ga0157373_10000303 3300013100 Bacteria 39933
101 Ga0157373_10001836 3300013100 Bacteria 16168
102 Ga0157373_10001855 3300013100 Bacteria 16047
103 Ga0157373_10002835 3300013100 Bacteria 13111
104 Ga0157373_10006316 3300013100 Bacteria 8850
105 Ga0157373_10044418 3300013100 Bacteria 3172
106 Ga0157373_10167013 3300013100 Bacteria 1549
107 Ga0157371_10000046 3300013102 Bacteria 187304
108 Ga0157371_10000836 3300013102 Bacteria 35185
109 Ga0157371_10003113 3300013102 Bacteria 15341
110 Ga0157371_10008918 3300013102 Bacteria 7943
111 Ga0157371_10010708 3300013102 Bacteria 7120
112 Ga0157371_10018254 3300013102 Bacteria 5189
113 Ga0157371_10182114 3300013102 Bacteria 1503
114 Ga0157370_10000083 3300013104 Bacteria 104313
115 Ga0157370_10004450 3300013104 Bacteria 16062
116 Ga0157370_10026527 3300013104 Bacteria 5719
117 Ga0157370_10065192 3300013104 Bacteria 3446
118 Ga0157370_10098060 3300013104 Bacteria 2749
119 Ga0157370_10173301 3300013104 Bacteria 2005
120 Ga0157369_10000046 3300013105 Bacteria 172851
121 Ga0157369_10008223 3300013105 Bacteria 11962
122 Ga0157369_10010084 3300013105 Bacteria 10789
123 Ga0157369_10052338 3300013105 Bacteria 4418
124 Ga0157369_10174579 3300013105 Bacteria 2263
125 Ga0157374_10000360 3300013296 Bacteria 42177
126 Ga0157374_10001750 3300013296 Bacteria 18236
127 Ga0157374_10393902 3300013296 Unclassified 1381
128 Ga0163162_10000037 3300013306 Bacteria 138420
129 Ga0163162_10000051 3300013306 Bacteria 117695
130 Ga0163162_10005366 3300013306 Bacteria 12374
131 Ga0163162_10006307 3300013306 Bacteria 11483
132 Ga0157372_10000009 3300013307 Bacteria 302051
133 Ga0157372_10000158 3300013307 Bacteria 73709
134 Ga0157372_10000472 3300013307 Bacteria 44394
135 Ga0157372_10057291 3300013307 Bacteria 4355
136 Ga0157372_10076018 3300013307 Bacteria 3791
137 Ga0157372_10436655 3300013307 Bacteria 1526
138 Ga0157375_10005633 3300013308 Bacteria 10905
139 Ga0157375_10079288 3300013308 Bacteria 3319
140 Ga0157375_10221088 3300013308 Bacteria 2052
141 Ga0182008_10000022 3300014497 Bacteria 207052
142 Ga0182008_10000104 3300014497 Bacteria 65446
143 Ga0182008_10009955 3300014497 Bacteria 5110
144 Ga0182008_10030340 3300014497 Bacteria 2725
145 Ga0182008_10126983 3300014497 Bacteria 1270
146 Ga0157377_10056462 3300014745 Bacteria 2230
147 Ga0182006_1000279 3300015261 Bacteria 45379
148 Ga0182006_1000532 3300015261 Bacteria 28917
149 Ga0182006_1002331 3300015261 Bacteria 10444
150 Ga0182006_1021721 3300015261 Bacteria 2673
151 Ga0182006_1026578 3300015261 Bacteria 2368
152 Ga0182007_10000009 3300015262 Bacteria 316298
153 Ga0182007_10012501 3300015262 Bacteria 3263
154 Ga0182007_10024246 3300015262 Bacteria 2124
155 Ga0182007_10029515 3300015262 Bacteria 1878
156 Ga0182007_10114313 3300015262 Bacteria 900
157 Ga0183373_1008 3300015682 Bacteria 255339
158 Ga0163161_10000537 3300017792 Bacteria 30944
159 Ga0163161_10000828 3300017792 Bacteria 24173
160 Ga0163161_10000991 3300017792 Bacteria 21691
161 Ga0163161_10025538 3300017792 Bacteria 4181
162 Ga0163161_10096230 3300017792 Bacteria 2198
163 Ga0163161_10178090 3300017792 Bacteria 1629
164 Ga0213872_10068194 3300021361 Bacteria 1605
165 Ga0207427_100091 3300025231 Bacteria 133410
166 Ga0209437_100026 3300025233 Bacteria 542698
167 Ga0209437_100144 3300025233 Bacteria 164794
168 Ga0207425_1000008 3300025245 Bacteria 618024
169 Ga0209026_1000251 3300025250 Bacteria 67956
170 Ga0209026_1003403 3300025250 Bacteria 5243
171 Ga0209026_1004318 3300025250 Bacteria 4268
172 Ga0209129_1000042 3300025258 Bacteria 305537
173 Ga0209233_1000111 3300025261 Bacteria 260262
174 Ga0209233_1000524 3300025261 Bacteria 22083
175 Ga0209676_1000009 3300025292 Bacteria 981719
176 Ga0209025_1000020 3300025294 Bacteria 618024
177 Ga0209758_1000022 3300025297 Bacteria 618024
178 Ga0209050_1000103 3300025298 Bacteria 229225
179 Ga0207647_10000036 3300025904 Bacteria 98204
180 Ga0207647_10000135 3300025904 Bacteria 58247
181 Ga0207645_10000312 3300025907 Bacteria 40968
182 Ga0207705_10000090 3300025909 Bacteria 113233
183 Ga0207705_10091268 3300025909 Bacteria 2231
184 Ga0207705_10299342 3300025909 Bacteria 1233
185 Ga0207654_10115669 3300025911 Bacteria 1676
186 Ga0207654_10336643 3300025911 Bacteria 1036
187 Ga0207654_10384336 3300025911 Bacteria 973
188 Ga0207707_10049181 3300025912 Bacteria 3673
189 Ga0207695_10000117 3300025913 Bacteria 237982
190 Ga0207695_10060894 3300025913 Bacteria 3904
191 Ga0207695_10122461 3300025913 Bacteria 2567
192 Ga0207695_10240343 3300025913 Bacteria 1712
193 Ga0207671_10000466 3300025914 Bacteria 55435
194 Ga0207671_10000514 3300025914 Bacteria 52449
195 Ga0207671_10000831 3300025914 Bacteria 39212
196 Ga0207671_10002974 3300025914 Bacteria 17406
197 Ga0207671_10046326 3300025914 Bacteria 3216
198 Ga0207660_10082329 3300025917 Bacteria 2367
199 Ga0207657_10064148 3300025919 Bacteria 3137
200 Ga0207657_10179976 3300025919 Bacteria 1709
201 Ga0207657_10184135 3300025919 Unclassified 1687
202 Ga0207652_10124549 3300025921 Unclassified 2295
203 Ga0207694_10033809 3300025924 Bacteria 3918
204 Ga0207694_10083325 3300025924 Bacteria 2514
205 Ga0207644_10004264 3300025931 Bacteria 9279
206 Ga0207690_10000133 3300025932 Bacteria 60426
207 Ga0207690_10038705 3300025932 Bacteria 3106
208 Ga0207706_10000466 3300025933 Bacteria 43209
209 Ga0207686_10019426 3300025934 Bacteria 3865
210 Ga0207709_10000008 3300025935 Bacteria 713099
211 Ga0207709_10020749 3300025935 Bacteria 3710
212 Ga0207704_10000335 3300025938 Bacteria 21770
213 Ga0207689_10147630 3300025942 Bacteria 1937
214 Ga0207661_10032479 3300025944 Bacteria 4044
215 Ga0207667_10000030 3300025949 Bacteria 327226
216 Ga0207667_10009562 3300025949 Bacteria 11409
217 Ga0207667_10048781 3300025949 Bacteria 4476
218 Ga0207640_10108947 3300025981 Bacteria 1959
219 Ga0207677_10827896 3300026023 Bacteria 830
220 Ga0207703_10086334 3300026035 Bacteria 2628
221 Ga0207639_10008486 3300026041 Bacteria 7043
222 Ga0207639_10047912 3300026041 Bacteria 3232
223 Ga0207639_10283093 3300026041 Bacteria 1459
224 Ga0207702_10000042 3300026078 Bacteria 150673
225 Ga0207702_10029162 3300026078 Bacteria 4590
226 Ga0207702_10182702 3300026078 Bacteria 1932
227 Ga0207674_10406942 3300026116 Bacteria 1315
228 Ga0207683_10201873 3300026121 Bacteria 1808
229 Ga0207698_10003948 3300026142 Bacteria 8985
230 Ga0207698_10067253 3300026142 Bacteria 2825
231 Ga0268266_10000037 3300028379 Bacteria 342368
232 Ga0268266_10213159 3300028379 Bacteria 1772
233 Ga0307517_10008846 3300028786 Bacteria 14389
234 Ga0307515_10000712 3300028794 Bacteria 76634
235 Ga0307515_10027268 3300028794 Bacteria 9776
236 Ga0307515_10032476 3300028794 Bacteria 8647
237 Ga0307515_10049134 3300028794 Bacteria 6358
238 Ga0265338_10263726 3300028800 Bacteria 1265
239 Ga0316177_1146378 3300030731 Bacteria 6323
240 Ga0316176_1026636 3300030732 Bacteria 9686
241 Ga0316183_1109674 3300030742 Bacteria 36502
242 Ga0316181_1061633 3300030744 Bacteria 1363
243 Ga0316181_1231880 3300030744 Bacteria 4483
244 Ga0265327_10072938 3300031251 Unclassified 1714
245 Ga0307509_10159311 3300031507 Bacteria 2158
246 Ga0307408_100000349 3300031548 Bacteria 43324
247 Ga0307516_10373686 3300031730 Bacteria 1088
248 Ga0307405_10000016 3300031731 Bacteria 197180
249 Ga0307407_10000006 3300031903 Bacteria 218714
250 Ga0307412_10000001 3300031911 Bacteria 822691
251 Ga0307412_10089132 3300031911 Bacteria 2153
252 Ga0307412_10092728 3300031911 Bacteria 2117
253 Ga0307412_10103544 3300031911 Bacteria 2018
254 Ga0307412_10325902 3300031911 Bacteria 1224
255 Ga0307409_100022266 3300031995 Bacteria 4365
256 Ga0307416_100000032 3300032002 Bacteria 156777
257 Ga0307414_10000268 3300032004 Bacteria 32688
258 Ga0307414_10005701 3300032004 Bacteria 6877
259 Ga0307414_10014725 3300032004 Bacteria 4699
260 Ga0307414_10020240 3300032004 Bacteria 4144
261 Ga0307414_10057588 3300032004 Bacteria 2733
262 Ga0307414_10083992 3300032004 Bacteria 2340
263 Ga0307414_10216361 3300032004 Bacteria 1570
264 Ga0307414_10447134 3300032004 Unclassified 1132
265 Ga0307507_10000097 3300033179 Bacteria 139761
266 Ga0307510_10001091 3300033180 Bacteria 28923
267 Ga0395899_0000011 3300037312 Bacteria 521331
268 Ga0395899_0000780 3300037312 Bacteria 31338
269 Ga0395899_0003282 3300037312 Bacteria 12827
270 Ga0395899_0004206 3300037312 Bacteria 11292
271 Ga0395900_0000478 3300037418 Bacteria 56604
272 Ga0395900_0001720 3300037418 Bacteria 25283
273 Ga0395900_0345455 3300037418 Bacteria 1462
274 Ga0395898_0057445 3300037466 Bacteria 3792
275 Ga0395905_0002686 3300037471 Bacteria 19498
276 Ga0395905_0004170 3300037471 Bacteria 15118
277 Ga0395905_0567933 3300037471 Bacteria 1036
278 Ga0395901_0001267 3300038443 Bacteria 26781
279 Ga0395901_0049686 3300038443 Bacteria 4358
280 Ga0395901_0614967 3300038443 Bacteria 1094
281 Ga0436361_1136992 3300039447 Bacteria 2475
282 Ga0439455_0049886 3300042012 Bacteria 1091
283 Ga0466969_0010264 3300044656 Bacteria 4966
284 Ga0466961_0035332 3300044693 Bacteria 3210
285 Ga0466959_0027729 3300045049 Bacteria 4200
286 Ga0451576_0000002 3300045051 Bacteria 1670975
287 Ga0466958_0029480 3300045836 Bacteria 3256
288 Ga0495638_0067582 3300046460 Bacteria 2194
289 Ga0495650_0000081 3300046471 Bacteria 240957
290 Ga0495639_0132850 3300046475 Bacteria 1193
291 Ga0495585_0006975 3300046492 Bacteria 6954
292 Ga0495585_0105673 3300046492 Bacteria 1502
293 Ga0495596_0018308 3300046500 Bacteria 2888
294 Ga0495583_0013604 3300046506 Bacteria 4527
295 Ga0495583_0053620 3300046506 Bacteria 1829
296 Ga0495606_0002949 3300046507 Bacteria 18762
297 Ga0495606_0003930 3300046507 Bacteria 15289
298 Ga0495606_0038711 3300046507 Bacteria 3223
299 Ga0495610_0000231 3300046512 Bacteria 59540
300 Ga0495610_0000237 3300046512 Bacteria 57952
301 Ga0495616_0000433 3300046513 Bacteria 31968
302 Ga0495616_0000921 3300046513 Bacteria 21150
303 Ga0495631_0011938 3300046518 Bacteria 4259
304 Ga0495632_0058719 3300046519 Bacteria 1874
305 Ga0495637_0031795 3300046520 Bacteria 2331
306 Ga0495644_0076685 3300046523 Bacteria 1259
307 Ga0495648_0004911 3300046524 Bacteria 11246
308 Ga0495648_0005907 3300046524 Bacteria 10071
309 Ga0495652_0099161 3300046529 Bacteria 2366
310 Ga0495652_0425968 3300046529 Bacteria 934
311 Ga0495654_0027329 3300046530 Bacteria 2927
312 Ga0495609_0003063 3300046538 Bacteria 9815
313 Ga0495609_0030753 3300046538 Bacteria 2444
314 Ga0495609_0056572 3300046538 Bacteria 1737
315 Ga0495633_0000361 3300046558 Bacteria 48960
316 Ga0495668_0000058 3300046616 Bacteria 195501
317 Ga0495625_0000049 3300046660 Bacteria 197646
318 Ga0495625_0005499 3300046660 Bacteria 11525
319 Ga0495625_0015634 3300046660 Bacteria 6002
320 Ga0495625_0048121 3300046660 Bacteria 3072
321 Ga0495625_0048854 3300046660 Bacteria 3043
322 Ga0495625_0219166 3300046660 Bacteria 1247
323 Ga0495661_0003749 3300046665 Bacteria 11126
324 Ga0495661_0029402 3300046665 Bacteria 3508
325 Ga0495670_0257083 3300046691 Bacteria 932
326 Ga0495649_0000014 3300046694 Bacteria 287408
327 Ga0495649_0016193 3300046694 Bacteria 4229
328 Ga0495683_0043190 3300047323 Bacteria 2271
329 Ga0495687_000556 3300047443 Bacteria 44028
330 Ga0495687_006566 3300047443 Bacteria 7095
331 Ga0495686_0000306 3300047472 Bacteria 83341
332 Ga0495686_0006170 3300047472 Bacteria 9265
333 Ga0495686_0006773 3300047472 Bacteria 8702
334 Ga0495686_0030432 3300047472 Bacteria 3505
335 Ga0496116_0168678 3300048919 Bacteria 1189
336 Ga0496117_0002287 3300048920 Bacteria 24713
337 Ga0496118_0083821 3300048921 Bacteria 2227
338 Ga0496122_0002421 3300048925 Bacteria 26557
339 Ga0496123_0008155 3300048926 Bacteria 9665
340 Ga0496124_0065418 3300048927 Bacteria 3032
341 Ga0496126_0147439 3300048929 Bacteria 2020
342 Ga0496126_0296635 3300048929 Bacteria 1335
343 Ga0495678_004962 3300049459 Bacteria 7501
344 Ga0501240_011586 3300049673 Unclassified 1191
345 Ga0501249_034433 3300049679 Bacteria 1136
346 Ga0501280_006596 3300049776 Bacteria 1633
347 nmdc:mga0k408_49_c2 3300050493 Bacteria 55012
348 nmdc:mga0k408_66_c1 3300050493 Bacteria 33479
349 Ga0500635_0000412 3300053080 Bacteria 12782
350 Ga0500647_0028606 3300053091 Bacteria 2639
351 Ga0500651_0001193 3300053093 Bacteria 12892
352 Ga0500608_000596 3300053122 Bacteria 13310
353 Ga0500618_000027 3300053125 Bacteria 142903
354 Ga0500622_0001136 3300053156 Bacteria 22218
355 Ga0500624_000721 3300053157 Bacteria 8255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427687 2586206364 255
2 iso_pu_bacteria 2738541283 2738758312 255
3 iso_pu_bacteria 2738541284 2738763149 255
4 iso_pu_bacteria 2738541302 2738854183 255
5 iso_pu_bacteria 2738543023 2739303830 255
6 iso_pu_bacteria 2739367651 2739587660 255
7 iso_pu_bacteria 2739367656 2739614625 255
8 iso_pu_bacteria 2775506987 2776616314 255
9 iso_pu_bacteria 2818991437 2819545565 255
10 iso_pu_bacteria 2842722452 2842724550 255
11 iso_pu_bacteria 2842903701 2842907714 255
12 iso_pu_bacteria 2842909656 2842911957 255
13 iso_pu_bacteria 2849281842 2849283593 255
14 iso_pu_bacteria 2852627209 2852629659 255
15 iso_pu_bacteria 2857627736 2857630474 255
16 iso_pu_bacteria 2896317667 2896321117 255
17 iso_pu_bacteria 2904445276 2904448064 255
18 iso_pu_bacteria 2919186247 2919191066 255
19 iso_pu_bacteria 2919437846 2919439416 255
20 iso_pu_bacteria 2939664404 2939669346 255
21 iso_pu_bacteria 2945997725 2945998596 255
22 iso_pu_bacteria 2954016120 2954021051 255
23 3300006173 Ga0070716_100088275 Ga0070716_1000882752 257
24 3300045051 Ga0451576_0000002 Ga0451576_0000002_893706_894479 257
25 3300003214 JGI25165J46597_1002399 JGI25165J46597_10023993 258
26 3300005293 Ga0065715_10102504 Ga0065715_101025042 258
27 3300005614 Ga0068856_100000533 Ga0068856_10000053324 258
28 3300025231 Ga0207427_100091 Ga0207427_10009137 258
29 3300025233 Ga0209437_100026 Ga0209437_100026144 258
30 3300025261 Ga0209233_1000111 Ga0209233_100011138 258
31 3300026078 Ga0207702_10000042 Ga0207702_10000042108 258
32 2162886007 SwRhRL2b_contig_1336827 SwRhRL2b_0180.00006840 259
33 2162886007 SwRhRL2b_contig_2255685 SwRhRL2b_0652.00005710 259
34 3300002067 JGI24735J21928_10000011 JGI24735J21928_10000011191 259
35 3300002077 JGI24744J21845_10001519 JGI24744J21845_100015196 259
36 3300002741 JGI25157J39369_1003397 JGI25157J39369_10033973 259
37 3300002773 JGI25152J39213_1000007 JGI25152J39213_100000788 259
38 3300002774 JGI25150J39212_1000013 JGI25150J39212_1000013112 259
39 3300003187 JGI25151J46595_10000004 JGI25151J46595_1000000458 259
40 3300003214 JGI25165J46597_1010571 JGI25165J46597_10105712 259
41 3300003215 JGI25153J46596_10000004 JGI25153J46596_1000000458 259
42 3300003316 rootH1_10037104 rootH1_100371043 259
43 3300003316 rootH1_10075619 rootH1_100756191 259
44 3300003320 rootH2_10021444 rootH2_1002144416 259
45 3300003320 rootH2_10057796 rootH2_1005779610 259
46 3300003323 rootH1_10058344 rootH1_100583442 259
47 3300003791 Ga0055530_10006790 Ga0055530_100067902 259
48 3300005288 Ga0065714_10003722 Ga0065714_100037227 259
49 3300005288 Ga0065714_10005274 Ga0065714_100052744 259
50 3300005288 Ga0065714_10006151 Ga0065714_100061516 259
51 3300005288 Ga0065714_10064539 Ga0065714_1006453939 259
52 3300005288 Ga0065714_10081094 Ga0065714_100810943 259
53 3300005288 Ga0065714_10093101 Ga0065714_100931012 259
54 3300005289 Ga0065704_10000425 Ga0065704_1000042516 259
55 3300005327 Ga0070658_10000058 Ga0070658_100000582 259
56 3300005327 Ga0070658_10122897 Ga0070658_101228972 259
57 3300005327 Ga0070658_10403921 Ga0070658_104039211 259
58 3300005329 Ga0070683_100047480 Ga0070683_1000474802 259
59 3300005338 Ga0068868_100139701 Ga0068868_1001397012 259
60 3300005339 Ga0070660_100107348 Ga0070660_1001073482 259
61 3300005340 Ga0070689_100086497 Ga0070689_1000864973 259
62 3300005355 Ga0070671_100017668 Ga0070671_1000176686 259
63 3300005366 Ga0070659_100000120 Ga0070659_10000012045 259
64 3300005366 Ga0070659_100002519 Ga0070659_1000025199 259
65 3300005435 Ga0070714_100237548 Ga0070714_1002375481 259
66 3300005457 Ga0070662_100000043 Ga0070662_10000004338 259
67 3300005458 Ga0070681_10006021 Ga0070681_100060213 259
68 3300005530 Ga0070679_100011061 Ga0070679_1000110615 259
69 3300005535 Ga0070684_100054219 Ga0070684_1000542194 259
70 3300005539 Ga0068853_100026336 Ga0068853_1000263368 259
71 3300005539 Ga0068853_100312235 Ga0068853_1003122353 259
72 3300005539 Ga0068853_100342855 Ga0068853_1003428551 259
73 3300005548 Ga0070665_100000017 Ga0070665_100000017202 259
74 3300005548 Ga0070665_100533748 Ga0070665_1005337482 259
75 3300005563 Ga0068855_100003512 Ga0068855_1000035128 259
76 3300005563 Ga0068855_100005005 Ga0068855_1000050051 259
77 3300005563 Ga0068855_100018195 Ga0068855_1000181953 259
78 3300005563 Ga0068855_100250651 Ga0068855_1002506512 259
79 3300005577 Ga0068857_100009507 Ga0068857_1000095072 259
80 3300005578 Ga0068854_100115173 Ga0068854_1001151732 259
81 3300005614 Ga0068856_100006135 Ga0068856_10000613511 259
82 3300005614 Ga0068856_100040345 Ga0068856_1000403455 259
83 3300005614 Ga0068856_100262493 Ga0068856_1002624932 259
84 3300005616 Ga0068852_100083913 Ga0068852_1000839133 259
85 3300005616 Ga0068852_100135385 Ga0068852_1001353851 259
86 3300005616 Ga0068852_101027641 Ga0068852_1010276411 259
87 3300005842 Ga0068858_100111225 Ga0068858_1001112253 259
88 3300005843 Ga0068860_100080038 Ga0068860_1000800381 259
89 3300006195 Ga0075366_10000867 Ga0075366_1000086712 259
90 3300006195 Ga0075366_10003163 Ga0075366_100031633 259
91 3300006237 Ga0097621_100000099 Ga0097621_10000009915 259
92 3300006358 Ga0068871_100000290 Ga0068871_1000002909 259
93 3300006881 Ga0068865_100005903 Ga0068865_1000059038 259
94 3300009036 Ga0105244_10017072 Ga0105244_100170721 259
95 3300009093 Ga0105240_10000185 Ga0105240_1000018530 259
96 3300009093 Ga0105240_10034592 Ga0105240_100345921 259
97 3300009093 Ga0105240_10145438 Ga0105240_101454382 259
98 3300009093 Ga0105240_10171479 Ga0105240_101714793 259
99 3300009093 Ga0105240_10184210 Ga0105240_101842103 259
100 3300009093 Ga0105240_10368025 Ga0105240_103680252 259
101 3300009093 Ga0105240_10480891 Ga0105240_104808912 259
102 3300009148 Ga0105243_10000003 Ga0105243_10000003462 259
103 3300009174 Ga0105241_10043527 Ga0105241_100435272 259
104 3300009174 Ga0105241_10165927 Ga0105241_101659272 259
105 3300009176 Ga0105242_10167514 Ga0105242_101675143 259
106 3300009545 Ga0105237_10000753 Ga0105237_100007533 259
107 3300009545 Ga0105237_10000805 Ga0105237_1000080534 259
108 3300009545 Ga0105237_10000887 Ga0105237_100008878 259
109 3300009545 Ga0105237_10002200 Ga0105237_100022007 259
110 3300009545 Ga0105237_10038594 Ga0105237_100385942 259
111 3300009545 Ga0105237_10042910 Ga0105237_100429105 259
112 3300009551 Ga0105238_10022537 Ga0105238_100225373 259
113 3300009551 Ga0105238_10324157 Ga0105238_103241571 259
114 3300009551 Ga0105238_10790286 Ga0105238_107902861 259
115 3300010375 Ga0105239_10000008 Ga0105239_10000008139 259
116 3300010375 Ga0105239_10000069 Ga0105239_1000006973 259
117 3300010375 Ga0105239_10001468 Ga0105239_100014684 259
118 3300010375 Ga0105239_10001852 Ga0105239_100018527 259
119 3300010375 Ga0105239_10020482 Ga0105239_100204824 259
120 3300010375 Ga0105239_10030608 Ga0105239_100306085 259
121 3300010375 Ga0105239_10050545 Ga0105239_100505453 259
122 3300010375 Ga0105239_10191996 Ga0105239_101919962 259
123 3300010375 Ga0105239_10480436 Ga0105239_104804361 259
124 3300010375 Ga0105239_10514020 Ga0105239_105140201 259
125 3300010375 Ga0105239_10725053 Ga0105239_107250531 259
126 3300011119 Ga0105246_10025065 Ga0105246_100250652 259
127 3300013100 Ga0157373_10000303 Ga0157373_1000030315 259
128 3300013100 Ga0157373_10001836 Ga0157373_100018368 259
129 3300013100 Ga0157373_10001855 Ga0157373_1000185510 259
130 3300013100 Ga0157373_10002835 Ga0157373_100028353 259
131 3300013100 Ga0157373_10006316 Ga0157373_100063165 259
132 3300013100 Ga0157373_10044418 Ga0157373_100444182 259
133 3300013100 Ga0157373_10167013 Ga0157373_101670132 259
134 3300013102 Ga0157371_10000046 Ga0157371_1000004644 259
135 3300013102 Ga0157371_10000836 Ga0157371_1000083629 259
136 3300013102 Ga0157371_10003113 Ga0157371_100031139 259
137 3300013102 Ga0157371_10008918 Ga0157371_100089182 259
138 3300013102 Ga0157371_10010708 Ga0157371_100107082 259
139 3300013102 Ga0157371_10018254 Ga0157371_100182543 259
140 3300013102 Ga0157371_10182114 Ga0157371_101821142 259
141 3300013104 Ga0157370_10000083 Ga0157370_1000008353 259
142 3300013104 Ga0157370_10004450 Ga0157370_1000445013 259
143 3300013104 Ga0157370_10026527 Ga0157370_100265275 259
144 3300013104 Ga0157370_10065192 Ga0157370_100651922 259
145 3300013104 Ga0157370_10098060 Ga0157370_100980603 259
146 3300013104 Ga0157370_10173301 Ga0157370_101733012 259
147 3300013105 Ga0157369_10000046 Ga0157369_1000004648 259
148 3300013105 Ga0157369_10008223 Ga0157369_1000822310 259
149 3300013105 Ga0157369_10010084 Ga0157369_100100846 259
150 3300013105 Ga0157369_10052338 Ga0157369_100523382 259
151 3300013105 Ga0157369_10174579 Ga0157369_101745793 259
152 3300013296 Ga0157374_10000360 Ga0157374_1000036041 259
153 3300013296 Ga0157374_10001750 Ga0157374_100017508 259
154 3300013296 Ga0157374_10393902 Ga0157374_103939021 259
155 3300013306 Ga0163162_10000037 Ga0163162_1000003777 259
156 3300013306 Ga0163162_10000051 Ga0163162_1000005186 259
157 3300013306 Ga0163162_10005366 Ga0163162_100053668 259
158 3300013306 Ga0163162_10006307 Ga0163162_100063077 259
159 3300013307 Ga0157372_10000009 Ga0157372_1000000972 259
160 3300013307 Ga0157372_10000158 Ga0157372_1000015850 259
161 3300013307 Ga0157372_10000472 Ga0157372_1000047233 259
162 3300013307 Ga0157372_10057291 Ga0157372_100572912 259
163 3300013307 Ga0157372_10076018 Ga0157372_100760182 259
164 3300013307 Ga0157372_10436655 Ga0157372_104366551 259
165 3300013308 Ga0157375_10005633 Ga0157375_100056334 259
166 3300013308 Ga0157375_10079288 Ga0157375_100792884 259
167 3300013308 Ga0157375_10221088 Ga0157375_102210882 259
168 3300014497 Ga0182008_10000022 Ga0182008_1000002223 259
169 3300014497 Ga0182008_10000104 Ga0182008_1000010444 259
170 3300014497 Ga0182008_10009955 Ga0182008_100099553 259
171 3300014497 Ga0182008_10030340 Ga0182008_100303401 259
172 3300014497 Ga0182008_10126983 Ga0182008_101269832 259
173 3300014745 Ga0157377_10056462 Ga0157377_100564623 259
174 3300015261 Ga0182006_1000279 Ga0182006_10002794 259
175 3300015261 Ga0182006_1000532 Ga0182006_100053220 259
176 3300015261 Ga0182006_1002331 Ga0182006_100233110 259
177 3300015261 Ga0182006_1021721 Ga0182006_10217211 259
178 3300015261 Ga0182006_1026578 Ga0182006_10265782 259
179 3300015262 Ga0182007_10000009 Ga0182007_10000009161 259
180 3300015262 Ga0182007_10012501 Ga0182007_100125012 259
181 3300015262 Ga0182007_10024246 Ga0182007_100242461 259
182 3300015262 Ga0182007_10029515 Ga0182007_100295152 259
183 3300015262 Ga0182007_10114313 Ga0182007_101143131 259
184 3300015682 Ga0183373_1008 Ga0183373_1008198 259
185 3300017792 Ga0163161_10000537 Ga0163161_1000053723 259
186 3300017792 Ga0163161_10000828 Ga0163161_1000082812 259
187 3300017792 Ga0163161_10000991 Ga0163161_100009913 259
188 3300017792 Ga0163161_10025538 Ga0163161_100255382 259
189 3300017792 Ga0163161_10096230 Ga0163161_100962301 259
190 3300017792 Ga0163161_10178090 Ga0163161_101780902 259
191 3300021361 Ga0213872_10068194 Ga0213872_100681942 259
192 3300025233 Ga0209437_100144 Ga0209437_100144126 259
193 3300025245 Ga0207425_1000008 Ga0207425_1000008374 259
194 3300025250 Ga0209026_1000251 Ga0209026_100025121 259
195 3300025250 Ga0209026_1003403 Ga0209026_10034033 259
196 3300025250 Ga0209026_1004318 Ga0209026_10043184 259
197 3300025258 Ga0209129_1000042 Ga0209129_1000042109 259
198 3300025261 Ga0209233_1000524 Ga0209233_100052418 259
199 3300025292 Ga0209676_1000009 Ga0209676_1000009708 259
200 3300025294 Ga0209025_1000020 Ga0209025_1000020374 259
201 3300025297 Ga0209758_1000022 Ga0209758_1000022374 259
202 3300025298 Ga0209050_1000103 Ga0209050_1000103164 259
203 3300025904 Ga0207647_10000036 Ga0207647_1000003618 259
204 3300025904 Ga0207647_10000135 Ga0207647_1000013547 259
205 3300025907 Ga0207645_10000312 Ga0207645_1000031232 259
206 3300025909 Ga0207705_10000090 Ga0207705_10000090106 259
207 3300025909 Ga0207705_10091268 Ga0207705_100912682 259
208 3300025909 Ga0207705_10299342 Ga0207705_102993422 259
209 3300025911 Ga0207654_10115669 Ga0207654_101156691 259
210 3300025911 Ga0207654_10336643 Ga0207654_103366432 259
211 3300025911 Ga0207654_10384336 Ga0207654_103843361 259
212 3300025912 Ga0207707_10049181 Ga0207707_100491812 259
213 3300025913 Ga0207695_10000117 Ga0207695_10000117131 259
214 3300025913 Ga0207695_10060894 Ga0207695_100608946 259
215 3300025913 Ga0207695_10122461 Ga0207695_101224612 259
216 3300025913 Ga0207695_10240343 Ga0207695_102403433 259
217 3300025914 Ga0207671_10000466 Ga0207671_100004668 259
218 3300025914 Ga0207671_10000514 Ga0207671_1000051438 259
219 3300025914 Ga0207671_10000831 Ga0207671_1000083128 259
220 3300025914 Ga0207671_10002974 Ga0207671_1000297414 259
221 3300025914 Ga0207671_10046326 Ga0207671_100463262 259
222 3300025917 Ga0207660_10082329 Ga0207660_100823292 259
223 3300025919 Ga0207657_10064148 Ga0207657_100641483 259
224 3300025919 Ga0207657_10179976 Ga0207657_101799762 259
225 3300025919 Ga0207657_10184135 Ga0207657_101841352 259
226 3300025921 Ga0207652_10124549 Ga0207652_101245494 259
227 3300025924 Ga0207694_10033809 Ga0207694_100338091 259
228 3300025924 Ga0207694_10083325 Ga0207694_100833252 259
229 3300025931 Ga0207644_10004264 Ga0207644_100042641 259
230 3300025932 Ga0207690_10000133 Ga0207690_1000013336 259
231 3300025932 Ga0207690_10038705 Ga0207690_100387052 259
232 3300025933 Ga0207706_10000466 Ga0207706_1000046639 259
233 3300025934 Ga0207686_10019426 Ga0207686_100194262 259
234 3300025935 Ga0207709_10000008 Ga0207709_10000008111 259
235 3300025935 Ga0207709_10020749 Ga0207709_100207494 259
236 3300025938 Ga0207704_10000335 Ga0207704_100003352 259
237 3300025942 Ga0207689_10147630 Ga0207689_101476302 259
238 3300025944 Ga0207661_10032479 Ga0207661_100324796 259
239 3300025949 Ga0207667_10000030 Ga0207667_10000030265 259
240 3300025949 Ga0207667_10009562 Ga0207667_100095627 259
241 3300025949 Ga0207667_10048781 Ga0207667_100487815 259
242 3300025981 Ga0207640_10108947 Ga0207640_101089471 259
243 3300026023 Ga0207677_10827896 Ga0207677_108278961 259
244 3300026035 Ga0207703_10086334 Ga0207703_100863342 259
245 3300026041 Ga0207639_10008486 Ga0207639_100084869 259
246 3300026041 Ga0207639_10047912 Ga0207639_100479122 259
247 3300026041 Ga0207639_10283093 Ga0207639_102830931 259
248 3300026078 Ga0207702_10029162 Ga0207702_100291625 259
249 3300026078 Ga0207702_10182702 Ga0207702_101827021 259
250 3300026116 Ga0207674_10406942 Ga0207674_104069422 259
251 3300026121 Ga0207683_10201873 Ga0207683_102018731 259
252 3300026142 Ga0207698_10003948 Ga0207698_100039488 259
253 3300026142 Ga0207698_10067253 Ga0207698_100672531 259
254 3300028379 Ga0268266_10000037 Ga0268266_10000037115 259
255 3300028379 Ga0268266_10213159 Ga0268266_102131592 259
256 3300028786 Ga0307517_10008846 Ga0307517_1000884612 259
257 3300028794 Ga0307515_10000712 Ga0307515_1000071254 259
258 3300028794 Ga0307515_10027268 Ga0307515_100272684 259
259 3300028794 Ga0307515_10032476 Ga0307515_100324761 259
260 3300028794 Ga0307515_10049134 Ga0307515_100491345 259
261 3300028800 Ga0265338_10263726 Ga0265338_102637262 259
262 3300030731 Ga0316177_1146378 Ga0316177_11463782 259
263 3300030732 Ga0316176_1026636 Ga0316176_10266367 259
264 3300030742 Ga0316183_1109674 Ga0316183_110967427 259
265 3300030744 Ga0316181_1061633 Ga0316181_10616332 259
266 3300030744 Ga0316181_1231880 Ga0316181_12318803 259
267 3300031251 Ga0265327_10072938 Ga0265327_100729382 259
268 3300031507 Ga0307509_10159311 Ga0307509_101593112 259
269 3300031548 Ga0307408_100000349 Ga0307408_10000034923 259
270 3300031730 Ga0307516_10373686 Ga0307516_103736861 259
271 3300031731 Ga0307405_10000016 Ga0307405_10000016100 259
272 3300031903 Ga0307407_10000006 Ga0307407_10000006145 259
273 3300031911 Ga0307412_10000001 Ga0307412_1000000152 259
274 3300031911 Ga0307412_10089132 Ga0307412_100891322 259
275 3300031911 Ga0307412_10092728 Ga0307412_100927282 259
276 3300031911 Ga0307412_10103544 Ga0307412_101035442 259
277 3300031911 Ga0307412_10325902 Ga0307412_103259022 259
278 3300031995 Ga0307409_100022266 Ga0307409_1000222661 259
279 3300032002 Ga0307416_100000032 Ga0307416_10000003255 259
280 3300032004 Ga0307414_10000268 Ga0307414_100002689 259
281 3300032004 Ga0307414_10005701 Ga0307414_100057017 259
282 3300032004 Ga0307414_10014725 Ga0307414_100147252 259
283 3300032004 Ga0307414_10020240 Ga0307414_100202406 259
284 3300032004 Ga0307414_10057588 Ga0307414_100575883 259
285 3300032004 Ga0307414_10083992 Ga0307414_100839922 259
286 3300032004 Ga0307414_10216361 Ga0307414_102163612 259
287 3300032004 Ga0307414_10447134 Ga0307414_104471342 259
288 3300033179 Ga0307507_10000097 Ga0307507_100000977 259
289 3300033180 Ga0307510_10001091 Ga0307510_1000109122 259
290 3300037312 Ga0395899_0000011 Ga0395899_0000011_24908_25687 259
291 3300037312 Ga0395899_0000780 Ga0395899_0000780_6626_7405 259
292 3300037312 Ga0395899_0003282 Ga0395899_0003282_10552_11331 259
293 3300037312 Ga0395899_0004206 Ga0395899_0004206_5438_6217 259
294 3300037418 Ga0395900_0000478 Ga0395900_0000478_12010_12792 259
295 3300037418 Ga0395900_0001720 Ga0395900_0001720_15399_16178 259
296 3300037418 Ga0395900_0345455 Ga0395900_0345455_230_1009 259
297 3300037466 Ga0395898_0057445 Ga0395898_0057445_414_1193 259
298 3300037471 Ga0395905_0002686 Ga0395905_0002686_2292_3071 259
299 3300037471 Ga0395905_0004170 Ga0395905_0004170_10519_11298 259
300 3300037471 Ga0395905_0567933 Ga0395905_0567933_239_1021 259
301 3300038443 Ga0395901_0001267 Ga0395901_0001267_7683_8462 259
302 3300038443 Ga0395901_0049686 Ga0395901_0049686_1449_2228 259
303 3300038443 Ga0395901_0614967 Ga0395901_0614967_33_812 259
304 3300039447 Ga0436361_1136992 Ga0436361_1136992_483_1262 259
305 3300042012 Ga0439455_0049886 Ga0439455_0049886_90_869 259
306 3300044656 Ga0466969_0010264 Ga0466969_0010264_2604_3383 259
307 3300044693 Ga0466961_0035332 Ga0466961_0035332_63_842 259
308 3300045049 Ga0466959_0027729 Ga0466959_0027729_1692_2471 259
309 3300045836 Ga0466958_0029480 Ga0466958_0029480_751_1530 259
310 3300046460 Ga0495638_0067582 Ga0495638_0067582_822_1601 259
311 3300046471 Ga0495650_0000081 Ga0495650_0000081_235373_236152 259
312 3300046475 Ga0495639_0132850 Ga0495639_0132850_219_998 259
313 3300046492 Ga0495585_0006975 Ga0495585_0006975_910_1689 259
314 3300046492 Ga0495585_0105673 Ga0495585_0105673_253_1032 259
315 3300046500 Ga0495596_0018308 Ga0495596_0018308_326_1105 259
316 3300046506 Ga0495583_0013604 Ga0495583_0013604_1512_2291 259
317 3300046506 Ga0495583_0053620 Ga0495583_0053620_108_887 259
318 3300046507 Ga0495606_0002949 Ga0495606_0002949_11299_12078 259
319 3300046507 Ga0495606_0003930 Ga0495606_0003930_12431_13210 259
320 3300046507 Ga0495606_0038711 Ga0495606_0038711_81_866 259
321 3300046512 Ga0495610_0000231 Ga0495610_0000231_7557_8342 259
322 3300046512 Ga0495610_0000237 Ga0495610_0000237_23645_24430 259
323 3300046513 Ga0495616_0000433 Ga0495616_0000433_23613_24392 259
324 3300046513 Ga0495616_0000921 Ga0495616_0000921_16705_17484 259
325 3300046518 Ga0495631_0011938 Ga0495631_0011938_1476_2255 259
326 3300046519 Ga0495632_0058719 Ga0495632_0058719_273_1052 259
327 3300046520 Ga0495637_0031795 Ga0495637_0031795_647_1432 259
328 3300046523 Ga0495644_0076685 Ga0495644_0076685_102_881 259
329 3300046524 Ga0495648_0004911 Ga0495648_0004911_7531_8310 259
330 3300046524 Ga0495648_0005907 Ga0495648_0005907_1470_2249 259
331 3300046529 Ga0495652_0099161 Ga0495652_0099161_720_1499 259
332 3300046529 Ga0495652_0425968 Ga0495652_0425968_11_790 259
333 3300046530 Ga0495654_0027329 Ga0495654_0027329_728_1507 259
334 3300046538 Ga0495609_0003063 Ga0495609_0003063_962_1741 259
335 3300046538 Ga0495609_0030753 Ga0495609_0030753_1421_2200 259
336 3300046538 Ga0495609_0056572 Ga0495609_0056572_371_1177 259
337 3300046558 Ga0495633_0000361 Ga0495633_0000361_40099_40878 259
338 3300046616 Ga0495668_0000058 Ga0495668_0000058_62293_63072 259
339 3300046660 Ga0495625_0000049 Ga0495625_0000049_179904_180683 259
340 3300046660 Ga0495625_0005499 Ga0495625_0005499_72_851 259
341 3300046660 Ga0495625_0015634 Ga0495625_0015634_2862_3641 259
342 3300046660 Ga0495625_0048121 Ga0495625_0048121_601_1380 259
343 3300046660 Ga0495625_0048854 Ga0495625_0048854_72_851 259
344 3300046660 Ga0495625_0219166 Ga0495625_0219166_426_1205 259
345 3300046665 Ga0495661_0003749 Ga0495661_0003749_8396_9175 259
346 3300046665 Ga0495661_0029402 Ga0495661_0029402_1067_1846 259
347 3300046691 Ga0495670_0257083 Ga0495670_0257083_31_810 259
348 3300046694 Ga0495649_0000014 Ga0495649_0000014_16964_17743 259
349 3300046694 Ga0495649_0016193 Ga0495649_0016193_237_1016 259
350 3300047323 Ga0495683_0043190 Ga0495683_0043190_1269_2048 259
351 3300047443 Ga0495687_000556 Ga0495687_000556_39372_40151 259
352 3300047443 Ga0495687_006566 Ga0495687_006566_2201_2980 259
353 3300047472 Ga0495686_0000306 Ga0495686_0000306_55954_56733 259
354 3300047472 Ga0495686_0006170 Ga0495686_0006170_2257_3036 259
355 3300047472 Ga0495686_0006773 Ga0495686_0006773_5020_5799 259
356 3300047472 Ga0495686_0030432 Ga0495686_0030432_771_1550 259
357 3300048919 Ga0496116_0168678 Ga0496116_0168678_347_1168 259
358 3300048920 Ga0496117_0002287 Ga0496117_0002287_12973_13752 259
359 3300048921 Ga0496118_0083821 Ga0496118_0083821_851_1630 259
360 3300048925 Ga0496122_0002421 Ga0496122_0002421_4600_5391 259
361 3300048926 Ga0496123_0008155 Ga0496123_0008155_2779_3570 259
362 3300048927 Ga0496124_0065418 Ga0496124_0065418_1768_2547 259
363 3300048929 Ga0496126_0147439 Ga0496126_0147439_1054_1833 259
364 3300048929 Ga0496126_0296635 Ga0496126_0296635_212_991 259
365 3300049459 Ga0495678_004962 Ga0495678_004962_800_1579 259
366 3300049673 Ga0501240_011586 Ga0501240_011586_99_878 259
367 3300049679 Ga0501249_034433 Ga0501249_034433_34_819 259
368 3300049776 Ga0501280_006596 Ga0501280_006596_145_930 259
369 3300050493 nmdc:mga0k408_49_c2 nmdc:mga0k408_49_c2_3143_3922 259
370 3300050493 nmdc:mga0k408_66_c1 nmdc:mga0k408_66_c1_20584_21363 259
371 3300053080 Ga0500635_0000412 Ga0500635_0000412_5089_5871 259
372 3300053091 Ga0500647_0028606 Ga0500647_0028606_639_1418 259
373 3300053093 Ga0500651_0001193 Ga0500651_0001193_5748_6530 259
374 3300053122 Ga0500608_000596 Ga0500608_000596_2775_3554 259
375 3300053125 Ga0500618_000027 Ga0500618_000027_28177_28956 259
376 3300053156 Ga0500622_0001136 Ga0500622_0001136_8001_8780 259
377 3300053157 Ga0500624_000721 Ga0500624_000721_7007_7786 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

61

315

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fut-assembly2.cif.gz_B apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p21212 0.9007 11 255
3fuv-assembly1.cif.gz_A apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p43212 0.8922 11 259
3fuu-assembly1.cif.gz_A t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in complex with adenosine in space group p212121 0.8892 4 255
3fuv-assembly2.cif.gz_B apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p43212 0.8837 12 254
3fuv-assembly3.cif.gz_C apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p43212 0.8803 8 255
ID Description Score Start End Superfamily
3fuxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.936 4 190 3.40.50.150
af_Q58435_1_185_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9028 3 192 3.40.50.150
af_Q58435_1_185_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8981 3 192 3.40.50.150
4jxjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.885 14 192 3.40.50.150
af_O65090_67_269_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8749 2 190 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6M1Q4X5-F1-model_v4 deleted 0.9941 129 259
AF-A0A6M1Q4X5-F1-model_v4 deleted 0.9792 129 259
AF-A0A7Y1Z5J4-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) 0.9743 2 183 GO:0003723
GO:0005829
GO:0052908
AF-A0A3D5Q6L7-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9724 106 192 GO:0000179
GO:0003723
GO:0005829
AF-A0A519RVN4-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.972 1 126 GO:0000179
GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
92.3 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map