F427574

General Info

Members Datasets Scaffolds Average Seq Length
377 230 754 136

Family's Representative Sequence

Representative Sequence 3300004803|Ga0058862_12773115|Ga0058862_127731151
Length 150
Sequence MYTGSENNRHEAFKNMNLIDGIGGVFLFSNNPKRLAEWYRENLGITYEESPDCSSIYKSFVYRDLQDASVKRTTTWAILPSDDDISHKPRTGQINYRVRSMAETLSHVRSRGVAIDKTEDCEYGKFAWVTDPDGNKIELWEPVEERIEKP

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.51
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 33.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_12773115 3300004803 Bacteria 1076
2 MBSR1b_contig_2170430 2162886012 Unclassified 1324
3 MBSR1b_contig_890778 2162886012 Bacteria 940
4 2214936887 2209111006 Unclassified 541
5 JGI25406J46586_10039828 3300003203 Unclassified 1671
6 Ga0058863_11979021 3300004799 Unclassified 1645
7 Ga0065712_10084450 3300005290 Unclassified 2757
8 Ga0065715_10089831 3300005293 Bacteria 8382
9 Ga0065715_10117963 3300005293 Bacteria 2331
10 Ga0065715_10458150 3300005293 Unclassified 819
11 Ga0065715_10591011 3300005293 Unclassified 714
12 Ga0070676_11203036 3300005328 Unclassified 576
13 Ga0070683_100000514 3300005329 Bacteria 27185
14 Ga0070690_100365310 3300005330 Bacteria 1051
15 Ga0068869_100851797 3300005334 Bacteria 786
16 Ga0070680_100002673 3300005336 Bacteria 13209
17 Ga0070680_100041088 3300005336 Bacteria 3749
18 Ga0070680_100099340 3300005336 Bacteria 2415
19 Ga0070682_100015886 3300005337 Bacteria 4370
20 Ga0070682_100187286 3300005337 Bacteria 1451
21 Ga0070682_100435076 3300005337 Bacteria 1001
22 Ga0070682_100979812 3300005337 Unclassified 700
23 Ga0070682_101119862 3300005337 Unclassified 660
24 Ga0070682_101157446 3300005337 Unclassified 650
25 Ga0068868_100139312 3300005338 Bacteria 1990
26 Ga0068868_101663259 3300005338 Bacteria 601
27 Ga0070687_100396305 3300005343 Unclassified 904
28 Ga0070661_100128986 3300005344 Unclassified 1898
29 Ga0070661_100541325 3300005344 Unclassified 936
30 Ga0070692_10004843 3300005345 Bacteria 5661
31 Ga0070692_10813215 3300005345 Unclassified 639
32 Ga0070668_100661813 3300005347 Bacteria 918
33 Ga0070669_100214873 3300005353 Bacteria 1518
34 Ga0070675_100558056 3300005354 Bacteria 1036
35 Ga0070671_101043446 3300005355 Unclassified 717
36 Ga0070674_100101896 3300005356 Bacteria 2093
37 Ga0070673_100724869 3300005364 Unclassified 914
38 Ga0070688_100415489 3300005365 Unclassified 999
39 Ga0070659_100664879 3300005366 Unclassified 899
40 Ga0070709_10107756 3300005434 Bacteria 1868
41 Ga0070714_100000051 3300005435 Bacteria 110289
42 Ga0070713_100044629 3300005436 Bacteria 3629
43 Ga0070713_101117774 3300005436 Unclassified 762
44 Ga0070711_100004654 3300005439 Bacteria 8124
45 Ga0070711_100538026 3300005439 Unclassified 968
46 Ga0070705_100469504 3300005440 Unclassified 948
47 Ga0070700_100202850 3300005441 Bacteria 1394
48 Ga0070700_100321822 3300005441 Bacteria 1136
49 Ga0070694_100004037 3300005444 Bacteria 8798
50 Ga0070694_100086856 3300005444 Bacteria 2186
51 Ga0070694_100213919 3300005444 Bacteria 1443
52 Ga0070708_100000308 3300005445 Bacteria 36695
53 Ga0070708_100081753 3300005445 Bacteria 2925
54 Ga0070708_100092617 3300005445 Bacteria 2753
55 Ga0070708_100394649 3300005445 Bacteria 1305
56 Ga0070663_100136087 3300005455 Unclassified 1871
57 Ga0070678_100403208 3300005456 Bacteria 1188
58 Ga0070662_100012561 3300005457 Bacteria 5617
59 Ga0070662_100339867 3300005457 Bacteria 1228
60 Ga0070681_10000487 3300005458 Bacteria 32364
61 Ga0070681_10001575 3300005458 Bacteria 20246
62 Ga0070681_10059952 3300005458 Bacteria 3784
63 Ga0070681_10145738 3300005458 Bacteria 2297
64 Ga0068867_100035566 3300005459 Bacteria 3614
65 Ga0068867_100441682 3300005459 Bacteria 1106
66 Ga0070706_100423767 3300005467 Bacteria 1238
67 Ga0070706_100486725 3300005467 Unclassified 1148
68 Ga0070706_101480580 3300005467 Unclassified 621
69 Ga0070707_100001652 3300005468 Bacteria 21586
70 Ga0070707_100425814 3300005468 Unclassified 1288
71 Ga0070698_100014088 3300005471 Bacteria 8455
72 Ga0070698_100748306 3300005471 Bacteria 920
73 Ga0070699_100065319 3300005518 Bacteria 3158
74 Ga0070699_100687415 3300005518 Unclassified 934
75 Ga0070699_100801665 3300005518 Unclassified 862
76 Ga0070679_100000208 3300005530 Bacteria 47947
77 Ga0070679_100051815 3300005530 Bacteria 4089
78 Ga0070679_100107927 3300005530 Bacteria 2770
79 Ga0070684_100007396 3300005535 Bacteria 8537
80 Ga0070697_100039857 3300005536 Bacteria 3799
81 Ga0070697_100228790 3300005536 Bacteria 1586
82 Ga0070697_100360609 3300005536 Bacteria 1256
83 Ga0070697_100481525 3300005536 Bacteria 1084
84 Ga0070697_100628261 3300005536 Bacteria 945
85 Ga0070697_101627276 3300005536 Unclassified 577
86 Ga0068853_100045838 3300005539 Bacteria 3747
87 Ga0070672_100804476 3300005543 Unclassified 827
88 Ga0070686_100111466 3300005544 Bacteria 1865
89 Ga0070686_100164662 3300005544 Unclassified 1564
90 Ga0070686_100481547 3300005544 Unclassified 960
91 Ga0070695_100005117 3300005545 Bacteria 7732
92 Ga0070696_100232090 3300005546 Bacteria 1388
93 Ga0070696_101006157 3300005546 Unclassified 697
94 Ga0070693_100101509 3300005547 Bacteria 1753
95 Ga0070693_100314155 3300005547 Bacteria 1061
96 Ga0070693_100329858 3300005547 Unclassified 1038
97 Ga0070693_100355243 3300005547 Bacteria 1004
98 Ga0070665_100103598 3300005548 Bacteria 2848
99 Ga0070704_100151633 3300005549 Bacteria 1823
100 Ga0070704_100463592 3300005549 Bacteria 1093
101 Ga0068855_100028746 3300005563 Bacteria 6651
102 Ga0070664_100002711 3300005564 Bacteria 14296
103 Ga0068857_100420845 3300005577 Bacteria 1245
104 Ga0068857_100831113 3300005577 Unclassified 883
105 Ga0068854_100075017 3300005578 Bacteria 2482
106 Ga0068854_100662100 3300005578 Bacteria 897
107 Ga0068854_101342151 3300005578 Bacteria 645
108 Ga0068856_100017514 3300005614 Bacteria 6941
109 Ga0068856_100243464 3300005614 Bacteria 1813
110 Ga0070702_100237306 3300005615 Bacteria 1229
111 Ga0070702_100901480 3300005615 Unclassified 692
112 Ga0068852_100871306 3300005616 Unclassified 917
113 Ga0068866_10040968 3300005718 Bacteria 2295
114 Ga0068866_10221346 3300005718 Unclassified 1142
115 Ga0068861_100154261 3300005719 Bacteria 1887
116 Ga0068861_101866983 3300005719 Bacteria 597
117 Ga0068858_100376054 3300005842 Unclassified 1363
118 Ga0068860_102248800 3300005843 Unclassified 566
119 Ga0081539_10013035 3300005985 Bacteria 6307
120 Ga0070717_10124064 3300006028 Unclassified 2215
121 Ga0070717_10998982 3300006028 Unclassified 762
122 Ga0070717_11274867 3300006028 Unclassified 668
123 Ga0070717_11613630 3300006028 Unclassified 588
124 Ga0070715_10000043 3300006163 Bacteria 60239
125 Ga0070715_10023075 3300006163 Unclassified 2433
126 Ga0070715_10473300 3300006163 Unclassified 712
127 Ga0070716_100010084 3300006173 Bacteria 4727
128 Ga0070716_100201304 3300006173 Unclassified 1324
129 Ga0070712_100012370 3300006175 Bacteria 5424
130 Ga0070712_101790004 3300006175 Unclassified 538
131 Ga0097621_100197787 3300006237 Unclassified 1743
132 Ga0068871_100022359 3300006358 Bacteria 4874
133 Ga0068871_100902191 3300006358 Bacteria 819
134 Ga0075428_102191088 3300006844 Unclassified 570
135 Ga0075431_100055230 3300006847 Bacteria 4096
136 Ga0075433_10048232 3300006852 Bacteria 3703
137 Ga0075434_100003975 3300006871 Bacteria 13242
138 Ga0075434_100010466 3300006871 Bacteria 8696
139 Ga0075434_100043728 3300006871 Bacteria 4443
140 Ga0075429_100565034 3300006880 Unclassified 997
141 Ga0068865_100131120 3300006881 Bacteria 1878
142 Ga0075436_100451731 3300006914 Unclassified 936
143 Ga0075436_100501661 3300006914 Bacteria 888
144 Ga0075435_100152652 3300007076 Unclassified 1942
145 Ga0075435_100204277 3300007076 Unclassified 1675
146 Ga0075435_101551711 3300007076 Unclassified 581
147 Ga0099794_10009305 3300007265 Bacteria 4124
148 Ga0099795_10046904 3300007788 Bacteria 1559
149 Ga0099795_10205945 3300007788 Unclassified 832
150 Ga0099795_10310181 3300007788 Bacteria 696
151 Ga0105240_10111802 3300009093 Bacteria 3303
152 Ga0111539_12623162 3300009094 Bacteria 584
153 Ga0105245_10072050 3300009098 Bacteria 3138
154 Ga0105245_10102112 3300009098 Bacteria 2655
155 Ga0105245_10152190 3300009098 Bacteria 2188
156 Ga0105245_10157372 3300009098 Bacteria 2153
157 Ga0105245_10549878 3300009098 Bacteria 1176
158 Ga0114129_10047707 3300009147 Bacteria 6017
159 Ga0114129_10536549 3300009147 Bacteria 1523
160 Ga0114129_11002634 3300009147 Bacteria 1052
161 Ga0114129_11360666 3300009147 Bacteria 877
162 Ga0114129_11560863 3300009147 Unclassified 809
163 Ga0114129_12649766 3300009147 Unclassified 598
164 Ga0105243_10412772 3300009148 Bacteria 1257
165 Ga0105243_10712970 3300009148 Bacteria 979
166 Ga0105243_11963207 3300009148 Unclassified 619
167 Ga0105241_10305184 3300009174 Unclassified 1367
168 Ga0105242_10195790 3300009176 Bacteria 1792
169 Ga0105248_10909607 3300009177 Unclassified 994
170 Ga0105237_10171392 3300009545 Bacteria 2170
171 Ga0105237_11141344 3300009545 Unclassified 786
172 Ga0105249_10012963 3300009553 Bacteria 7357
173 Ga0099796_10033212 3300010159 Bacteria 1696
174 Ga0105239_10088081 3300010375 Bacteria 3423
175 Ga0105239_10244714 3300010375 Bacteria 2013
176 Ga0157373_10194164 3300013100 Bacteria 1431
177 Ga0157373_10330424 3300013100 Bacteria 1085
178 Ga0157373_11017761 3300013100 Unclassified 619
179 Ga0157371_10482651 3300013102 Unclassified 914
180 Ga0157378_10054803 3300013297 Bacteria 3551
181 Ga0157378_10099051 3300013297 Bacteria 2659
182 Ga0157378_10118713 3300013297 Bacteria 2435
183 Ga0157378_10305948 3300013297 Bacteria 1540
184 Ga0157378_10533584 3300013297 Bacteria 1177
185 Ga0157378_10616611 3300013297 Bacteria 1098
186 Ga0157372_10006243 3300013307 Bacteria 12673
187 Ga0157372_13240771 3300013307 Unclassified 519
188 Ga0157375_11525185 3300013308 Bacteria 789
189 Ga0157380_11552472 3300014326 Unclassified 716
190 Ga0157379_10981310 3300014968 Archaea 805
191 Ga0157376_10000037 3300014969 Bacteria 138129
192 Ga0163161_10270638 3300017792 Bacteria 1329
193 Ga0213873_10024808 3300021358 Bacteria 1442
194 Ga0224572_1012931 3300024225 Unclassified 1591
195 Ga0207692_10081582 3300025898 Unclassified 1731
196 Ga0207642_10015472 3300025899 Bacteria 2843
197 Ga0207642_10267133 3300025899 Unclassified 978
198 Ga0207685_10000038 3300025905 Bacteria 61306
199 Ga0207699_10064486 3300025906 Bacteria 2216
200 Ga0207645_10008567 3300025907 Bacteria 7125
201 Ga0207684_10292862 3300025910 Bacteria 1403
202 Ga0207684_10460699 3300025910 Bacteria 1091
203 Ga0207707_10000044 3300025912 Bacteria 122847
204 Ga0207707_10005095 3300025912 Bacteria 11524
205 Ga0207707_10349784 3300025912 Bacteria 1273
206 Ga0207707_10401839 3300025912 Unclassified 1176
207 Ga0207695_10935526 3300025913 Unclassified 746
208 Ga0207671_10133754 3300025914 Bacteria 1905
209 Ga0207671_10740002 3300025914 Unclassified 781
210 Ga0207693_10018956 3300025915 Bacteria 5477
211 Ga0207693_10177174 3300025915 Bacteria 1678
212 Ga0207663_10022861 3300025916 Bacteria 3580
213 Ga0207663_10035915 3300025916 Bacteria 2977
214 Ga0207660_10002794 3300025917 Bacteria 11438
215 Ga0207660_10023820 3300025917 Bacteria 4138
216 Ga0207660_11095633 3300025917 Unclassified 649
217 Ga0207660_11169681 3300025917 Unclassified 626
218 Ga0207660_11460106 3300025917 Unclassified 553
219 Ga0207662_10003812 3300025918 Bacteria 7829
220 Ga0207652_10000179 3300025921 Bacteria 67330
221 Ga0207652_10032586 3300025921 Bacteria 4383
222 Ga0207652_10142083 3300025921 Bacteria 2147
223 Ga0207646_10010452 3300025922 Bacteria 9065
224 Ga0207646_10130086 3300025922 Bacteria 2265
225 Ga0207646_10286397 3300025922 Bacteria 1489
226 Ga0207646_11217367 3300025922 Unclassified 660
227 Ga0207687_10185685 3300025927 Bacteria 1614
228 Ga0207687_10503562 3300025927 Bacteria 1011
229 Ga0207687_10549259 3300025927 Unclassified 969
230 Ga0207687_11122786 3300025927 Eukaryota 675
231 Ga0207700_10090951 3300025928 Bacteria 2410
232 Ga0207700_10440750 3300025928 Bacteria 1147
233 Ga0207664_10000762 3300025929 Bacteria 21869
234 Ga0207664_10465123 3300025929 Bacteria 1130
235 Ga0207644_10359254 3300025931 Bacteria 1184
236 Ga0207644_10471182 3300025931 Bacteria 1033
237 Ga0207690_10644810 3300025932 Unclassified 867
238 Ga0207706_10031835 3300025933 Bacteria 4698
239 Ga0207706_11526576 3300025933 Unclassified 544
240 Ga0207686_10204147 3300025934 Bacteria 1417
241 Ga0207709_10155115 3300025935 Bacteria 1590
242 Ga0207709_10792223 3300025935 Unclassified 764
243 Ga0207669_10661670 3300025937 Unclassified 855
244 Ga0207669_11802540 3300025937 Unclassified 523
245 Ga0207704_10035272 3300025938 Bacteria 2865
246 Ga0207665_10053358 3300025939 Bacteria 2725
247 Ga0207665_10200122 3300025939 Unclassified 1455
248 Ga0207665_10209665 3300025939 Unclassified 1423
249 Ga0207665_11450318 3300025939 Unclassified 546
250 Ga0207661_10013533 3300025944 Bacteria 5958
251 Ga0207679_10674944 3300025945 Unclassified 936
252 Ga0207667_10061469 3300025949 Bacteria 3929
253 Ga0207667_10968635 3300025949 Bacteria 839
254 Ga0207712_10020698 3300025961 Unclassified 4311
255 Ga0207712_10699590 3300025961 Bacteria 884
256 Ga0207668_10791121 3300025972 Bacteria 839
257 Ga0207640_10374496 3300025981 Bacteria 1152
258 Ga0207677_10217369 3300026023 Bacteria 1530
259 Ga0207639_10179164 3300026041 Bacteria 1801
260 Ga0207639_11271922 3300026041 Unclassified 690
261 Ga0207678_10928863 3300026067 Unclassified 770
262 Ga0207702_10244514 3300026078 Bacteria 1682
263 Ga0207641_10235159 3300026088 Bacteria 1705
264 Ga0207648_10050789 3300026089 Bacteria 3625
265 Ga0207648_10197322 3300026089 Bacteria 1785
266 Ga0207676_10645555 3300026095 Bacteria 1021
267 Ga0207674_10614976 3300026116 Bacteria 1049
268 Ga0207675_100420108 3300026118 Bacteria 1320
269 Ga0207683_10076845 3300026121 Bacteria 2956
270 Ga0207698_10568526 3300026142 Bacteria 1114
271 Ga0209973_1022243 3300027252 Bacteria 850
272 Ga0209179_1003208 3300027512 Bacteria 2326
273 Ga0209968_1017071 3300027526 Bacteria 1156
274 Ga0209588_1022325 3300027671 Unclassified 1991
275 Ga0209974_10126243 3300027876 Unclassified 910
276 Ga0268266_10049099 3300028379 Bacteria 3618
277 Ga0268265_10317727 3300028380 Bacteria 1409
278 Ga0268264_11135143 3300028381 Bacteria 790
279 Ga0268264_11814042 3300028381 Unclassified 620
280 Ga0265760_10011240 3300031090 Unclassified 2560
281 Ga0373928_0021316 3300035084 Bacteria 1366
282 Ga0373934_0081283 3300035086 Bacteria 1302
283 Ga0373923_0020946 3300035111 Bacteria 2547
284 Ga0373936_0044775 3300035113 Bacteria 1781
285 Ga0373941_0004088 3300035115 Bacteria 3346
286 Ga0373945_0010022 3300035116 Bacteria 3114
287 Ga0373953_0052626 3300035117 Viruses 1648
288 Ga0373943_0002941 3300035170 Bacteria 7733
289 Ga0373946_0019828 3300035171 Bacteria 2594
290 Ga0373955_0143518 3300035172 Viruses 1401
291 Ga0373955_0436345 3300035172 Unclassified 798
292 Ga0373924_0235062 3300035410 Bacteria 810
293 Ga0373935_0003420 3300035692 Bacteria 9218
294 Ga0373935_0135371 3300035692 Bacteria 1659
295 Ga0373927_0000274 3300035695 Bacteria 40519
296 Ga0373933_0027487 3300035724 Bacteria 3276
297 Ga0373947_0066227 3300035725 Bacteria 2204
298 Ga0373947_0071215 3300035725 Bacteria 2132
299 Ga0373925_0002915 3300037068 Bacteria 13489
300 Ga0373925_0306104 3300037068 Unclassified 1284
301 Ga0373925_1335481 3300037068 Unclassified 588
302 Ga0395905_0877743 3300037471 Unclassified 800
303 Ga0436364_0959599 3300037853 Bacteria 2217
304 Ga0242420_002022 3300038996 Bacteria 2831
305 Ga0436362_0372255 3300039453 Bacteria 1658
306 Ga0451787_056263 3300041441 Bacteria 1969
307 Ga0451789_0308968 3300041443 Bacteria 2088
308 Ga0451791_1768605 3300041451 Bacteria 1692
309 Ga0451793_1069359 3300041452 Bacteria 908
310 Ga0451800_1683387 3300041459 Bacteria 998
311 Ga0451837_0138885 3300041494 Bacteria 1263
312 Ga0451839_1384707 3300041496 Unclassified 564
313 Ga0451851_0822162 3300041507 Bacteria 595
314 Ga0451853_0143098 3300041512 Bacteria 966
315 Ga0451576_1745410 3300045051 Bacteria 644
316 Ga0495603_0107920 3300046455 Bacteria 1624
317 Ga0495629_0235978 3300046459 Unclassified 1260
318 Ga0495653_0311183 3300046463 Unclassified 1024
319 Ga0495653_0417968 3300046463 Viruses 849
320 Ga0495580_0124789 3300046472 Unclassified 1787
321 Ga0495580_0592851 3300046472 Unclassified 733
322 Ga0495582_0026573 3300046473 Bacteria 3173
323 Ga0495662_0024284 3300046476 Bacteria 2925
324 Ga0495664_0011513 3300046477 Bacteria 4989
325 Ga0495664_0737391 3300046477 Unclassified 581
326 Ga0495594_0087724 3300046499 Unclassified 1741
327 Ga0495618_0558801 3300046514 Unclassified 684
328 Ga0495630_0078659 3300046517 Unclassified 2487
329 Ga0495630_0900006 3300046517 Viruses 674
330 Ga0495666_0098629 3300046526 Bacteria 1377
331 Ga0495665_0082425 3300046531 Unclassified 1691
332 Ga0495586_0203804 3300046535 Unclassified 1122
333 Ga0495622_0142262 3300046557 Unclassified 1089
334 Ga0495634_0196271 3300046642 Unclassified 1256
335 Ga0495635_0178033 3300046663 Unclassified 1446
336 Ga0495588_0299511 3300046674 Unclassified 847
337 Ga0495647_0027805 3300046681 Bacteria 2081
338 Ga0495658_0009339 3300046683 Bacteria 4885
339 Ga0495613_0011591 3300046689 Bacteria 6553
340 Ga0495624_0105078 3300046690 Unclassified 1738
341 Ga0495604_0784841 3300047317 Unclassified 601
342 Ga0495674_0004348 3300047319 Bacteria 13617
343 Ga0495674_0130181 3300047319 Bacteria 2120
344 Ga0495676_0331506 3300047321 Unclassified 1020
345 Ga0495684_0168216 3300047471 Unclassified 1632
346 Ga0495593_0103126 3300047673 Unclassified 1462
347 Ga0495614_0070784 3300048089 Unclassified 1503
348 Ga0496102_0009810 3300048905 Bacteria 8235
349 Ga0496104_1282619 3300048907 Unclassified 636
350 Ga0496105_0502368 3300048908 Unclassified 952
351 Ga0496110_0248139 3300048913 Bacteria 1620
352 Ga0496111_1144415 3300048914 Bacteria 553
353 Ga0496112_0014560 3300048915 Bacteria 7306
354 Ga0496112_0026167 3300048915 Bacteria 5610
355 Ga0496112_0314573 3300048915 Unclassified 1511
356 Ga0496112_0567277 3300048915 Bacteria 1068
357 Ga0496112_0840204 3300048915 Unclassified 842
358 Ga0496114_0063414 3300048917 Bacteria 3094
359 Ga0496115_0764607 3300048918 Unclassified 754
360 nmdc:mga05p37_1001746_c1 3300050507 Bacteria 887
361 nmdc:mga05p37_142264_c1 3300050507 Bacteria 2938
362 nmdc:mga05p37_496541_c1 3300050507 Bacteria 1402
363 nmdc:mga0qj67_333365_c1 3300050509 Unclassified 1227
364 nmdc:mga06r32_954683_c1 3300050510 Bacteria 812
365 nmdc:mga0n895_104976_c1 3300050512 Bacteria 2838
366 nmdc:mga0n895_15808_c1 3300050512 Bacteria 6901
367 nmdc:mga0n895_570312_c1 3300050512 Bacteria 1136
368 nmdc:mga0n895_66938_c1 3300050512 Unclassified 3556
369 nmdc:mga0rr50_1306994_c1 3300050513 Bacteria 615
370 nmdc:mga0rr50_735796_c1 3300050513 Unclassified 842
371 nmdc:mga08x19_157711_c1 3300050514 Bacteria 1540
372 nmdc:mga08x19_83490_c1 3300050514 Bacteria 2100
373 nmdc:mga08x19_842318_c1 3300050514 Unclassified 651
374 nmdc:mga0a205_276133_c1 3300050515 Bacteria 1556
375 nmdc:mga0a205_41290_c1 3300050515 Bacteria 4442
376 Ga0495619_0249462 3300053085 Unclassified 1230
377 Ga0500555_103417 3300053103 Bacteria 721
378 Ga0058862_12773115
379 MBSR1b_contig_2170430
380 MBSR1b_contig_890778
381 2214936887
382 JGI25406J46586_10039828
383 Ga0058863_11979021
384 Ga0065712_10084450
385 Ga0065715_10089831
386 Ga0065715_10117963
387 Ga0065715_10458150
388 Ga0065715_10591011
389 Ga0070676_11203036
390 Ga0070683_100000514
391 Ga0070690_100365310
392 Ga0068869_100851797
393 Ga0070680_100002673
394 Ga0070680_100041088
395 Ga0070680_100099340
396 Ga0070682_100015886
397 Ga0070682_100187286
398 Ga0070682_100435076
399 Ga0070682_100979812
400 Ga0070682_101119862
401 Ga0070682_101157446
402 Ga0068868_100139312
403 Ga0068868_101663259
404 Ga0070687_100396305
405 Ga0070661_100128986
406 Ga0070661_100541325
407 Ga0070692_10004843
408 Ga0070692_10813215
409 Ga0070668_100661813
410 Ga0070669_100214873
411 Ga0070675_100558056
412 Ga0070671_101043446
413 Ga0070674_100101896
414 Ga0070673_100724869
415 Ga0070688_100415489
416 Ga0070659_100664879
417 Ga0070709_10107756
418 Ga0070714_100000051
419 Ga0070713_100044629
420 Ga0070713_101117774
421 Ga0070711_100004654
422 Ga0070711_100538026
423 Ga0070705_100469504
424 Ga0070700_100202850
425 Ga0070700_100321822
426 Ga0070694_100004037
427 Ga0070694_100086856
428 Ga0070694_100213919
429 Ga0070708_100000308
430 Ga0070708_100081753
431 Ga0070708_100092617
432 Ga0070708_100394649
433 Ga0070663_100136087
434 Ga0070678_100403208
435 Ga0070662_100012561
436 Ga0070662_100339867
437 Ga0070681_10000487
438 Ga0070681_10001575
439 Ga0070681_10059952
440 Ga0070681_10145738
441 Ga0068867_100035566
442 Ga0068867_100441682
443 Ga0070706_100423767
444 Ga0070706_100486725
445 Ga0070706_101480580
446 Ga0070707_100001652
447 Ga0070707_100425814
448 Ga0070698_100014088
449 Ga0070698_100748306
450 Ga0070699_100065319
451 Ga0070699_100687415
452 Ga0070699_100801665
453 Ga0070679_100000208
454 Ga0070679_100051815
455 Ga0070679_100107927
456 Ga0070684_100007396
457 Ga0070697_100039857
458 Ga0070697_100228790
459 Ga0070697_100360609
460 Ga0070697_100481525
461 Ga0070697_100628261
462 Ga0070697_101627276
463 Ga0068853_100045838
464 Ga0070672_100804476
465 Ga0070686_100111466
466 Ga0070686_100164662
467 Ga0070686_100481547
468 Ga0070695_100005117
469 Ga0070696_100232090
470 Ga0070696_101006157
471 Ga0070693_100101509
472 Ga0070693_100314155
473 Ga0070693_100329858
474 Ga0070693_100355243
475 Ga0070665_100103598
476 Ga0070704_100151633
477 Ga0070704_100463592
478 Ga0068855_100028746
479 Ga0070664_100002711
480 Ga0068857_100420845
481 Ga0068857_100831113
482 Ga0068854_100075017
483 Ga0068854_100662100
484 Ga0068854_101342151
485 Ga0068856_100017514
486 Ga0068856_100243464
487 Ga0070702_100237306
488 Ga0070702_100901480
489 Ga0068852_100871306
490 Ga0068866_10040968
491 Ga0068866_10221346
492 Ga0068861_100154261
493 Ga0068861_101866983
494 Ga0068858_100376054
495 Ga0068860_102248800
496 Ga0081539_10013035
497 Ga0070717_10124064
498 Ga0070717_10998982
499 Ga0070717_11274867
500 Ga0070717_11613630
501 Ga0070715_10000043
502 Ga0070715_10023075
503 Ga0070715_10473300
504 Ga0070716_100010084
505 Ga0070716_100201304
506 Ga0070712_100012370
507 Ga0070712_101790004
508 Ga0097621_100197787
509 Ga0068871_100022359
510 Ga0068871_100902191
511 Ga0075428_102191088
512 Ga0075431_100055230
513 Ga0075433_10048232
514 Ga0075434_100003975
515 Ga0075434_100010466
516 Ga0075434_100043728
517 Ga0075429_100565034
518 Ga0068865_100131120
519 Ga0075436_100451731
520 Ga0075436_100501661
521 Ga0075435_100152652
522 Ga0075435_100204277
523 Ga0075435_101551711
524 Ga0099794_10009305
525 Ga0099795_10046904
526 Ga0099795_10205945
527 Ga0099795_10310181
528 Ga0105240_10111802
529 Ga0111539_12623162
530 Ga0105245_10072050
531 Ga0105245_10102112
532 Ga0105245_10152190
533 Ga0105245_10157372
534 Ga0105245_10549878
535 Ga0114129_10047707
536 Ga0114129_10536549
537 Ga0114129_11002634
538 Ga0114129_11360666
539 Ga0114129_11560863
540 Ga0114129_12649766
541 Ga0105243_10412772
542 Ga0105243_10712970
543 Ga0105243_11963207
544 Ga0105241_10305184
545 Ga0105242_10195790
546 Ga0105248_10909607
547 Ga0105237_10171392
548 Ga0105237_11141344
549 Ga0105249_10012963
550 Ga0099796_10033212
551 Ga0105239_10088081
552 Ga0105239_10244714
553 Ga0157373_10194164
554 Ga0157373_10330424
555 Ga0157373_11017761
556 Ga0157371_10482651
557 Ga0157378_10054803
558 Ga0157378_10099051
559 Ga0157378_10118713
560 Ga0157378_10305948
561 Ga0157378_10533584
562 Ga0157378_10616611
563 Ga0157372_10006243
564 Ga0157372_13240771
565 Ga0157375_11525185
566 Ga0157380_11552472
567 Ga0157379_10981310
568 Ga0157376_10000037
569 Ga0163161_10270638
570 Ga0213873_10024808
571 Ga0224572_1012931
572 Ga0207692_10081582
573 Ga0207642_10015472
574 Ga0207642_10267133
575 Ga0207685_10000038
576 Ga0207699_10064486
577 Ga0207645_10008567
578 Ga0207684_10292862
579 Ga0207684_10460699
580 Ga0207707_10000044
581 Ga0207707_10005095
582 Ga0207707_10349784
583 Ga0207707_10401839
584 Ga0207695_10935526
585 Ga0207671_10133754
586 Ga0207671_10740002
587 Ga0207693_10018956
588 Ga0207693_10177174
589 Ga0207663_10022861
590 Ga0207663_10035915
591 Ga0207660_10002794
592 Ga0207660_10023820
593 Ga0207660_11095633
594 Ga0207660_11169681
595 Ga0207660_11460106
596 Ga0207662_10003812
597 Ga0207652_10000179
598 Ga0207652_10032586
599 Ga0207652_10142083
600 Ga0207646_10010452
601 Ga0207646_10130086
602 Ga0207646_10286397
603 Ga0207646_11217367
604 Ga0207687_10185685
605 Ga0207687_10503562
606 Ga0207687_10549259
607 Ga0207687_11122786
608 Ga0207700_10090951
609 Ga0207700_10440750
610 Ga0207664_10000762
611 Ga0207664_10465123
612 Ga0207644_10359254
613 Ga0207644_10471182
614 Ga0207690_10644810
615 Ga0207706_10031835
616 Ga0207706_11526576
617 Ga0207686_10204147
618 Ga0207709_10155115
619 Ga0207709_10792223
620 Ga0207669_10661670
621 Ga0207669_11802540
622 Ga0207704_10035272
623 Ga0207665_10053358
624 Ga0207665_10200122
625 Ga0207665_10209665
626 Ga0207665_11450318
627 Ga0207661_10013533
628 Ga0207679_10674944
629 Ga0207667_10061469
630 Ga0207667_10968635
631 Ga0207712_10020698
632 Ga0207712_10699590
633 Ga0207668_10791121
634 Ga0207640_10374496
635 Ga0207677_10217369
636 Ga0207639_10179164
637 Ga0207639_11271922
638 Ga0207678_10928863
639 Ga0207702_10244514
640 Ga0207641_10235159
641 Ga0207648_10050789
642 Ga0207648_10197322
643 Ga0207676_10645555
644 Ga0207674_10614976
645 Ga0207675_100420108
646 Ga0207683_10076845
647 Ga0207698_10568526
648 Ga0209973_1022243
649 Ga0209179_1003208
650 Ga0209968_1017071
651 Ga0209588_1022325
652 Ga0209974_10126243
653 Ga0268266_10049099
654 Ga0268265_10317727
655 Ga0268264_11135143
656 Ga0268264_11814042
657 Ga0265760_10011240
658 Ga0373928_0021316
659 Ga0373934_0081283
660 Ga0373923_0020946
661 Ga0373936_0044775
662 Ga0373941_0004088
663 Ga0373945_0010022
664 Ga0373953_0052626
665 Ga0373943_0002941
666 Ga0373946_0019828
667 Ga0373955_0143518
668 Ga0373955_0436345
669 Ga0373924_0235062
670 Ga0373935_0003420
671 Ga0373935_0135371
672 Ga0373927_0000274
673 Ga0373933_0027487
674 Ga0373947_0066227
675 Ga0373947_0071215
676 Ga0373925_0002915
677 Ga0373925_0306104
678 Ga0373925_1335481
679 Ga0395905_0877743
680 Ga0436364_0959599
681 Ga0242420_002022
682 Ga0436362_0372255
683 Ga0451787_056263
684 Ga0451789_0308968
685 Ga0451791_1768605
686 Ga0451793_1069359
687 Ga0451800_1683387
688 Ga0451837_0138885
689 Ga0451839_1384707
690 Ga0451851_0822162
691 Ga0451853_0143098
692 Ga0451576_1745410
693 Ga0495603_0107920
694 Ga0495629_0235978
695 Ga0495653_0311183
696 Ga0495653_0417968
697 Ga0495580_0124789
698 Ga0495580_0592851
699 Ga0495582_0026573
700 Ga0495662_0024284
701 Ga0495664_0011513
702 Ga0495664_0737391
703 Ga0495594_0087724
704 Ga0495618_0558801
705 Ga0495630_0078659
706 Ga0495630_0900006
707 Ga0495666_0098629
708 Ga0495665_0082425
709 Ga0495586_0203804
710 Ga0495622_0142262
711 Ga0495634_0196271
712 Ga0495635_0178033
713 Ga0495588_0299511
714 Ga0495647_0027805
715 Ga0495658_0009339
716 Ga0495613_0011591
717 Ga0495624_0105078
718 Ga0495604_0784841
719 Ga0495674_0004348
720 Ga0495674_0130181
721 Ga0495676_0331506
722 Ga0495684_0168216
723 Ga0495593_0103126
724 Ga0495614_0070784
725 Ga0496102_0009810
726 Ga0496104_1282619
727 Ga0496105_0502368
728 Ga0496110_0248139
729 Ga0496111_1144415
730 Ga0496112_0014560
731 Ga0496112_0026167
732 Ga0496112_0314573
733 Ga0496112_0567277
734 Ga0496112_0840204
735 Ga0496114_0063414
736 Ga0496115_0764607
737 nmdc:mga05p37_1001746_c1
738 nmdc:mga05p37_142264_c1
739 nmdc:mga05p37_496541_c1
740 nmdc:mga0qj67_333365_c1
741 nmdc:mga06r32_954683_c1
742 nmdc:mga0n895_104976_c1
743 nmdc:mga0n895_15808_c1
744 nmdc:mga0n895_570312_c1
745 nmdc:mga0n895_66938_c1
746 nmdc:mga0rr50_1306994_c1
747 nmdc:mga0rr50_735796_c1
748 nmdc:mga08x19_157711_c1
749 nmdc:mga08x19_83490_c1
750 nmdc:mga08x19_842318_c1
751 nmdc:mga0a205_276133_c1
752 nmdc:mga0a205_41290_c1
753 Ga0495619_0249462
754 Ga0500555_103417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

139

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qlz-assembly2.cif.gz_B idol f3ab subdomain 0.8299 112 141
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.7845 110 139
6o64-assembly3.cif.gz_E crystal structure of arabidopsis thaliana spermidine synthase isoform 2 (atspds2) 0.7839 111 137
2i5x-assembly1.cif.gz_A engineering the ptpbeta catalytic domain with improved crystallization properties 0.7828 110 139
1jq3-assembly1.cif.gz_D crystal structure of spermidine synthase in complex with transition state analogue adodato 0.782 112 137
ID Description Score Start End Superfamily
af_O57457_206_298_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8523 112 137 2.30.29.30
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.84 89 140 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8199 90 140 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8089 89 141 3.30.720.110
af_P77795_256_333_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8066 112 139 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A496NZ66-F1-model_v4 deleted 0.9346 89 140
AF-A0A0M9YF21-F1-model_v4 Glyoxalase 0.9343 92 139
AF-A0A1S2KET6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9328 89 141
AF-A0A4R8W9L0-F1-model_v4 VOC domain-containing protein 0.9298 92 140
AF-A0A6L9IQR2-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9297 92 140

Map