F427538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 376 | 243 | 279 | 274 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2739367874|2740061337 |
| Length | 308 |
| Sequence | IKWLFLLLNNKINMASGFFAILDDLAALMDDVAVTSKIATQKTAGILGDDLAVNAEKATGFISSREIPVLWAITKGSFINKLIILPIAFLLHWLYKPAIEIILILGGFYLAFEGVEKIIEFLFHRDKKGHEVIEESTKNEDAENSEKSKIKSAITTDFILSIEIVIIALGTVLEEQHPLLTQIITVSLVSFLATVGVYGIVALIVRMDDAGFKLIKKSNDKGFFSKLGHLLVKALPVIIKILAIVGTIALILVSGGIFAHNISYLHHFLPSWPTALKELVFGLSGGLIAVLLFTVGKKAYTLATRKGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 4 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 5 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 6 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 7 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 8 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 9 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 10 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 11 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 12 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 13 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 14 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 15 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 16 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 17 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 18 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 19 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 20 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 21 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 22 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 23 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 24 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 25 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 26 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 27 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 28 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 29 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 30 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 31 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 32 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 33 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 34 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 35 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 36 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 37 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 38 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 39 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 40 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 41 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 42 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 43 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 44 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 45 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 46 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 47 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 48 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 49 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 50 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 51 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 52 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 53 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 54 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 55 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 56 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 57 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 58 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 59 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 60 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 61 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 62 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 63 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 64 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 65 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 66 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 67 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 68 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 69 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 70 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 71 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 72 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 73 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 74 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 75 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 76 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 77 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 78 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 79 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 80 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 81 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 82 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 83 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 84 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 85 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 86 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 87 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 88 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 89 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 90 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 91 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 92 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 93 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 94 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 95 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 96 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 97 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 98 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 99 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 100 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 101 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 102 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 103 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 104 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 105 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 106 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 114 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 117 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 118 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 119 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 163 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 164 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 180 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 182 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 185 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 186 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 187 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 188 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 189 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 190 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 191 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 192 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 193 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 212 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 213 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 219 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 221 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 223 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 224 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 225 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 226 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 227 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 228 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 229 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 230 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 231 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 232 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 233 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 234 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 235 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 237 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 238 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 239 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
| 240 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 241 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 242 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 243 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.2 |
| Metatranscriptomes | 0 |
| Isolates | 25.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.53 |
| Bulb | 0 |
| Endosphere | 7.98 |
| Nodule | 1.86 |
| Rhizoplane | 0.8 |
| Rhizosphere | 63.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_900766 | 2162886007 | Bacteria | 33637 |
| 2 | JGI25152J39213_1000119 | 3300002773 | Bacteria | 55075 |
| 3 | JGI25150J39212_1000015 | 3300002774 | Bacteria | 170613 |
| 4 | JGI25151J46595_10000043 | 3300003187 | Bacteria | 170613 |
| 5 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 6 | rootH1_10127239 | 3300003316 | Bacteria | 2541 |
| 7 | rootH1_10182401 | 3300003316 | Unclassified | 1200 |
| 8 | rootH2_10058921 | 3300003320 | Bacteria | 3055 |
| 9 | rootH2_10179811 | 3300003320 | Unclassified | 1574 |
| 10 | rootL2_10067677 | 3300003322 | Bacteria | 2261 |
| 11 | rootL2_10278768 | 3300003322 | Unclassified | 2431 |
| 12 | rootL2_10340571 | 3300003322 | Bacteria | 1862 |
| 13 | rootH1_10020336 | 3300003323 | Bacteria | 19882 |
| 14 | rootH1_10033648 | 3300003323 | Bacteria | 8226 |
| 15 | rootH1_10288399 | 3300003323 | Bacteria | 2117 |
| 16 | Ga0055536_1000024 | 3300003781 | Bacteria | 185534 |
| 17 | Ga0055530_10003260 | 3300003791 | Bacteria | 9440 |
| 18 | Ga0065165_1001168 | 3300005262 | Bacteria | 30512 |
| 19 | Ga0065714_10004609 | 3300005288 | Bacteria | 28110 |
| 20 | Ga0065714_10022743 | 3300005288 | Bacteria | 1654 |
| 21 | Ga0065714_10064675 | 3300005288 | Bacteria | 24373 |
| 22 | Ga0065714_10064825 | 3300005288 | Bacteria | 17735 |
| 23 | Ga0065714_10066564 | 3300005288 | Bacteria | 6644 |
| 24 | Ga0065714_10073153 | 3300005288 | Bacteria | 3237 |
| 25 | Ga0065714_10107213 | 3300005288 | Bacteria | 1536 |
| 26 | Ga0065714_10115537 | 3300005288 | Bacteria | 1414 |
| 27 | Ga0065714_10138697 | 3300005288 | Bacteria | 1188 |
| 28 | Ga0065704_10000199 | 3300005289 | Bacteria | 297176 |
| 29 | Ga0065704_10073246 | 3300005289 | Bacteria | 7396 |
| 30 | Ga0065704_10107453 | 3300005289 | Bacteria | 2055 |
| 31 | Ga0065715_10102814 | 3300005293 | Bacteria | 3083 |
| 32 | Ga0065715_10162879 | 3300005293 | Bacteria | 1582 |
| 33 | Ga0065715_10297305 | 3300005293 | Bacteria | 1049 |
| 34 | Ga0070683_100004947 | 3300005329 | Bacteria | 11054 |
| 35 | Ga0070682_100000371 | 3300005337 | Bacteria | 30205 |
| 36 | Ga0070668_100075482 | 3300005347 | Bacteria | 2632 |
| 37 | Ga0070663_100208444 | 3300005455 | Bacteria | 1529 |
| 38 | Ga0070684_100008696 | 3300005535 | Bacteria | 7959 |
| 39 | Ga0070665_100418664 | 3300005548 | Bacteria | 1348 |
| 40 | Ga0068855_100013194 | 3300005563 | Bacteria | 9968 |
| 41 | Ga0068856_100298232 | 3300005614 | Bacteria | 1629 |
| 42 | Ga0075366_10000026 | 3300006195 | Bacteria | 51752 |
| 43 | Ga0099824_1009165 | 3300006942 | Bacteria | 12295 |
| 44 | Ga0079104_1000179 | 3300006946 | Bacteria | 90381 |
| 45 | Ga0099826_10126459 | 3300006948 | Bacteria | 1497 |
| 46 | Ga0105244_10000004 | 3300009036 | Bacteria | 492478 |
| 47 | Ga0105244_10000069 | 3300009036 | Bacteria | 119620 |
| 48 | Ga0105244_10113895 | 3300009036 | Bacteria | 1314 |
| 49 | Ga0105240_10005314 | 3300009093 | Bacteria | 19213 |
| 50 | Ga0105243_10000008 | 3300009148 | Bacteria | 390270 |
| 51 | Ga0105243_10002193 | 3300009148 | Bacteria | 16461 |
| 52 | Ga0105238_10137072 | 3300009551 | Bacteria | 2425 |
| 53 | Ga0105239_10000006 | 3300010375 | Bacteria | 442319 |
| 54 | Ga0157373_10000002 | 3300013100 | Bacteria | 750094 |
| 55 | Ga0157373_10000015 | 3300013100 | Bacteria | 183381 |
| 56 | Ga0157373_10007425 | 3300013100 | Bacteria | 8154 |
| 57 | Ga0157373_10015051 | 3300013100 | Bacteria | 5658 |
| 58 | Ga0157371_10000113 | 3300013102 | Bacteria | 122461 |
| 59 | Ga0157371_10036425 | 3300013102 | Bacteria | 3523 |
| 60 | Ga0157371_10076856 | 3300013102 | Bacteria | 2364 |
| 61 | Ga0157371_10150649 | 3300013102 | Bacteria | 1659 |
| 62 | Ga0157370_10000172 | 3300013104 | Bacteria | 80432 |
| 63 | Ga0157370_10001033 | 3300013104 | Bacteria | 35017 |
| 64 | Ga0157370_10003309 | 3300013104 | Bacteria | 19002 |
| 65 | Ga0157370_10004730 | 3300013104 | Bacteria | 15518 |
| 66 | Ga0157370_10012803 | 3300013104 | Bacteria | 8672 |
| 67 | Ga0157370_10037857 | 3300013104 | Bacteria | 4670 |
| 68 | Ga0157370_10084497 | 3300013104 | Bacteria | 2983 |
| 69 | Ga0157370_10171864 | 3300013104 | Bacteria | 2014 |
| 70 | Ga0157369_10011448 | 3300013105 | Bacteria | 10073 |
| 71 | Ga0157369_10180954 | 3300013105 | Bacteria | 2218 |
| 72 | Ga0157369_10521953 | 3300013105 | Bacteria | 1228 |
| 73 | Ga0157374_10019166 | 3300013296 | Bacteria | 6053 |
| 74 | Ga0157378_10002165 | 3300013297 | Bacteria | 17447 |
| 75 | Ga0163162_10006470 | 3300013306 | Bacteria | 11341 |
| 76 | Ga0163162_10021458 | 3300013306 | Bacteria | 6361 |
| 77 | Ga0163162_10160580 | 3300013306 | Bacteria | 2369 |
| 78 | Ga0157372_10146742 | 3300013307 | Bacteria | 2720 |
| 79 | Ga0157372_10649785 | 3300013307 | Bacteria | 1228 |
| 80 | Ga0157375_10000065 | 3300013308 | Bacteria | 112832 |
| 81 | Ga0157375_10005507 | 3300013308 | Bacteria | 11017 |
| 82 | Ga0163163_10700542 | 3300014325 | Bacteria | 1076 |
| 83 | Ga0182008_10028564 | 3300014497 | Bacteria | 2820 |
| 84 | Ga0157376_10112232 | 3300014969 | Bacteria | 2401 |
| 85 | Ga0182006_1000015 | 3300015261 | Bacteria | 325938 |
| 86 | Ga0182006_1001684 | 3300015261 | Bacteria | 12944 |
| 87 | Ga0182006_1001701 | 3300015261 | Bacteria | 12843 |
| 88 | Ga0182006_1006894 | 3300015261 | Bacteria | 5239 |
| 89 | Ga0182006_1014721 | 3300015261 | Bacteria | 3367 |
| 90 | Ga0182006_1021108 | 3300015261 | Bacteria | 2719 |
| 91 | Ga0182007_10030781 | 3300015262 | Bacteria | 1832 |
| 92 | Ga0183373_1020 | 3300015682 | Bacteria | 1626 |
| 93 | Ga0163161_10000007 | 3300017792 | Bacteria | 301614 |
| 94 | Ga0163161_10001683 | 3300017792 | Bacteria | 16226 |
| 95 | Ga0163161_10005084 | 3300017792 | Bacteria | 9156 |
| 96 | Ga0163161_10010556 | 3300017792 | Bacteria | 6397 |
| 97 | Ga0163161_10029458 | 3300017792 | Bacteria | 3903 |
| 98 | Ga0163161_10036674 | 3300017792 | Bacteria | 3512 |
| 99 | Ga0163161_10036912 | 3300017792 | Bacteria | 3501 |
| 100 | Ga0163161_10080967 | 3300017792 | Bacteria | 2390 |
| 101 | Ga0163161_10103227 | 3300017792 | Bacteria | 2124 |
| 102 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 103 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 104 | Ga0209675_1000042 | 3300025291 | Bacteria | 235989 |
| 105 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 106 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 107 | Ga0209758_1000144 | 3300025297 | Bacteria | 170724 |
| 108 | Ga0209050_1000055 | 3300025298 | Bacteria | 339254 |
| 109 | Ga0207655_1000008 | 3300025728 | Bacteria | 734289 |
| 110 | Ga0207655_1000492 | 3300025728 | Bacteria | 50910 |
| 111 | Ga0207705_10141346 | 3300025909 | Unclassified | 1798 |
| 112 | Ga0207695_10004439 | 3300025913 | Bacteria | 19146 |
| 113 | Ga0207671_10010163 | 3300025914 | Bacteria | 7795 |
| 114 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 115 | Ga0207709_10001031 | 3300025935 | Bacteria | 20585 |
| 116 | Ga0207661_10008472 | 3300025944 | Bacteria | 7351 |
| 117 | Ga0207668_10170309 | 3300025972 | Bacteria | 1707 |
| 118 | Ga0207703_10067722 | 3300026035 | Bacteria | 2939 |
| 119 | Ga0207702_10371101 | 3300026078 | Bacteria | 1374 |
| 120 | Ga0209281_1000116 | 3300027111 | Bacteria | 209707 |
| 121 | Ga0209489_118300 | 3300027361 | Bacteria | 2799 |
| 122 | Ga0209282_1099840 | 3300027666 | Bacteria | 1497 |
| 123 | Ga0268266_10365539 | 3300028379 | Bacteria | 1358 |
| 124 | Ga0307517_10002529 | 3300028786 | Bacteria | 29143 |
| 125 | Ga0307515_10006038 | 3300028794 | Bacteria | 24361 |
| 126 | Ga0307515_10321294 | 3300028794 | Bacteria | 1214 |
| 127 | Ga0316176_1023444 | 3300030732 | Bacteria | 24481 |
| 128 | Ga0316183_1145092 | 3300030742 | Bacteria | 25653 |
| 129 | Ga0316181_1014202 | 3300030744 | Bacteria | 22841 |
| 130 | Ga0316181_1059316 | 3300030744 | Bacteria | 1301 |
| 131 | Ga0307408_100001531 | 3300031548 | Bacteria | 17165 |
| 132 | Ga0307408_100002894 | 3300031548 | Bacteria | 11896 |
| 133 | Ga0307408_100003112 | 3300031548 | Bacteria | 11435 |
| 134 | Ga0307408_100025183 | 3300031548 | Bacteria | 4072 |
| 135 | Ga0316576_10027540 | 3300031727 | Bacteria | 3997 |
| 136 | Ga0316576_10104030 | 3300031727 | Bacteria | 2124 |
| 137 | Ga0316578_10034450 | 3300031728 | Bacteria | 2907 |
| 138 | Ga0316578_10043684 | 3300031728 | Unclassified | 2604 |
| 139 | Ga0316578_10167820 | 3300031728 | Bacteria | 1323 |
| 140 | Ga0307405_10031372 | 3300031731 | Bacteria | 3128 |
| 141 | Ga0307405_10048274 | 3300031731 | Bacteria | 2624 |
| 142 | Ga0307413_10042015 | 3300031824 | Bacteria | 2683 |
| 143 | Ga0307413_10154380 | 3300031824 | Bacteria | 1604 |
| 144 | Ga0307410_10000115 | 3300031852 | Bacteria | 28127 |
| 145 | Ga0307406_10000111 | 3300031901 | Bacteria | 46791 |
| 146 | Ga0307406_10056370 | 3300031901 | Unclassified | 2516 |
| 147 | Ga0307407_10008551 | 3300031903 | Bacteria | 4708 |
| 148 | Ga0307407_10052057 | 3300031903 | Bacteria | 2349 |
| 149 | Ga0307412_10000019 | 3300031911 | Bacteria | 266611 |
| 150 | Ga0307412_10000033 | 3300031911 | Bacteria | 206649 |
| 151 | Ga0307412_10016906 | 3300031911 | Bacteria | 4358 |
| 152 | Ga0307412_10080842 | 3300031911 | Unclassified | 2246 |
| 153 | Ga0307409_100074848 | 3300031995 | Unclassified | 2708 |
| 154 | Ga0307409_100220616 | 3300031995 | Bacteria | 1711 |
| 155 | Ga0307416_100000004 | 3300032002 | Bacteria | 505535 |
| 156 | Ga0307416_100002085 | 3300032002 | Bacteria | 11282 |
| 157 | Ga0307416_100214795 | 3300032002 | Bacteria | 1838 |
| 158 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 159 | Ga0307414_10000188 | 3300032004 | Bacteria | 42008 |
| 160 | Ga0307414_10000306 | 3300032004 | Bacteria | 28470 |
| 161 | Ga0307414_10037590 | 3300032004 | Bacteria | 3243 |
| 162 | Ga0307414_10056447 | 3300032004 | Bacteria | 2754 |
| 163 | Ga0307414_10112780 | 3300032004 | Bacteria | 2073 |
| 164 | Ga0307414_10191723 | 3300032004 | Bacteria | 1654 |
| 165 | Ga0307414_10369120 | 3300032004 | Bacteria | 1237 |
| 166 | Ga0307411_10000013 | 3300032005 | Bacteria | 145335 |
| 167 | Ga0307415_100074590 | 3300032126 | Bacteria | 2398 |
| 168 | Ga0316583_10057642 | 3300032133 | Bacteria | 1364 |
| 169 | Ga0316574_0001086 | 3300035398 | Bacteria | 12423 |
| 170 | Ga0316574_0004177 | 3300035398 | Bacteria | 7525 |
| 171 | Ga0316574_0026997 | 3300035398 | Bacteria | 3456 |
| 172 | Ga0316574_0104656 | 3300035398 | Bacteria | 1812 |
| 173 | Ga0316574_0219248 | 3300035398 | Bacteria | 1219 |
| 174 | Ga0316582_0086171 | 3300036647 | Bacteria | 2059 |
| 175 | Ga0316584_0005980 | 3300036712 | Bacteria | 8219 |
| 176 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 177 | Ga0400484_12496 | 3300038725 | Bacteria | 5236 |
| 178 | Ga0400484_31673 | 3300038725 | Bacteria | 14348 |
| 179 | Ga0400490_05022 | 3300038726 | Bacteria | 39338 |
| 180 | Ga0400490_10968 | 3300038726 | Bacteria | 49546 |
| 181 | Ga0400485_09249 | 3300038735 | Bacteria | 2650 |
| 182 | Ga0400485_21141 | 3300038735 | Bacteria | 6543 |
| 183 | Ga0400488_27672 | 3300038741 | Bacteria | 2005 |
| 184 | Ga0400488_48565 | 3300038741 | Bacteria | 15780 |
| 185 | Ga0400488_55988 | 3300038741 | Unclassified | 4281 |
| 186 | Ga0400483_009196 | 3300039062 | Bacteria | 2063 |
| 187 | Ga0400483_161991 | 3300039062 | Bacteria | 2698 |
| 188 | Ga0400483_218339 | 3300039062 | Bacteria | 9791 |
| 189 | Ga0400483_225193 | 3300039062 | Unclassified | 3228 |
| 190 | Ga0400483_243678 | 3300039062 | Bacteria | 3392 |
| 191 | Ga0400483_287766 | 3300039062 | Bacteria | 2050 |
| 192 | Ga0400489_25329 | 3300039093 | Bacteria | 25097 |
| 193 | Ga0400487_18983 | 3300039110 | Bacteria | 1276 |
| 194 | Ga0439466_0002554 | 3300041411 | Bacteria | 7128 |
| 195 | Ga0439445_0000019 | 3300042004 | Bacteria | 21629 |
| 196 | Ga0495627_000071 | 3300046453 | Bacteria | 124716 |
| 197 | Ga0495627_001392 | 3300046453 | Bacteria | 14316 |
| 198 | Ga0495627_012216 | 3300046453 | Bacteria | 3056 |
| 199 | Ga0495596_0005913 | 3300046500 | Bacteria | 5707 |
| 200 | Ga0495596_0009684 | 3300046500 | Bacteria | 4232 |
| 201 | Ga0495606_0000478 | 3300046507 | Bacteria | 65674 |
| 202 | Ga0495606_0036455 | 3300046507 | Bacteria | 3349 |
| 203 | Ga0495606_0081534 | 3300046507 | Bacteria | 2011 |
| 204 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 205 | Ga0495610_0015728 | 3300046512 | Bacteria | 4386 |
| 206 | Ga0495632_0008958 | 3300046519 | Bacteria | 6072 |
| 207 | Ga0495632_0024380 | 3300046519 | Bacteria | 3214 |
| 208 | Ga0495643_0000452 | 3300046522 | Bacteria | 52237 |
| 209 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 210 | Ga0495609_0000060 | 3300046538 | Bacteria | 139944 |
| 211 | Ga0495633_0000018 | 3300046558 | Bacteria | 243398 |
| 212 | Ga0495633_0000039 | 3300046558 | Bacteria | 180652 |
| 213 | Ga0495633_0000626 | 3300046558 | Bacteria | 33117 |
| 214 | Ga0495633_0009982 | 3300046558 | Bacteria | 5210 |
| 215 | Ga0495633_0060219 | 3300046558 | Bacteria | 1779 |
| 216 | Ga0495625_0000252 | 3300046660 | Bacteria | 83831 |
| 217 | Ga0495625_0000970 | 3300046660 | Bacteria | 38139 |
| 218 | Ga0495625_0011561 | 3300046660 | Bacteria | 7188 |
| 219 | Ga0495625_0071722 | 3300046660 | Bacteria | 2430 |
| 220 | Ga0495625_0303466 | 3300046660 | Bacteria | 1021 |
| 221 | Ga0495669_0067053 | 3300046684 | Bacteria | 1631 |
| 222 | Ga0495686_0000022 | 3300047472 | Bacteria | 403456 |
| 223 | Ga0495686_0000711 | 3300047472 | Bacteria | 44734 |
| 224 | Ga0495686_0005677 | 3300047472 | Bacteria | 9761 |
| 225 | Ga0496102_0058937 | 3300048905 | Bacteria | 3510 |
| 226 | Ga0496113_0142681 | 3300048916 | Bacteria | 1885 |
| 227 | Ga0496115_0004487 | 3300048918 | Bacteria | 10102 |
| 228 | Ga0496116_0000027 | 3300048919 | Bacteria | 448077 |
| 229 | Ga0496116_0000047 | 3300048919 | Bacteria | 315121 |
| 230 | Ga0496117_0000021 | 3300048920 | Bacteria | 444168 |
| 231 | Ga0496117_0000289 | 3300048920 | Bacteria | 90202 |
| 232 | Ga0496118_0000531 | 3300048921 | Bacteria | 62520 |
| 233 | Ga0496118_0115355 | 3300048921 | Bacteria | 1768 |
| 234 | Ga0496118_0125679 | 3300048921 | Bacteria | 1661 |
| 235 | Ga0496119_0000004 | 3300048922 | Bacteria | 536344 |
| 236 | Ga0496121_0060393 | 3300048924 | Bacteria | 3118 |
| 237 | Ga0496122_0000119 | 3300048925 | Bacteria | 182576 |
| 238 | Ga0496122_0000344 | 3300048925 | Bacteria | 100498 |
| 239 | Ga0496122_0006744 | 3300048925 | Bacteria | 13070 |
| 240 | Ga0496122_0025014 | 3300048925 | Bacteria | 5205 |
| 241 | Ga0496122_0072469 | 3300048925 | Bacteria | 2449 |
| 242 | Ga0496122_0100355 | 3300048925 | Bacteria | 1937 |
| 243 | Ga0496123_0003713 | 3300048926 | Bacteria | 16792 |
| 244 | Ga0496123_0125693 | 3300048926 | Bacteria | 1432 |
| 245 | Ga0496124_0000526 | 3300048927 | Bacteria | 65165 |
| 246 | Ga0496124_0021551 | 3300048927 | Bacteria | 5936 |
| 247 | Ga0496125_0000050 | 3300048928 | Bacteria | 286703 |
| 248 | Ga0496125_0003293 | 3300048928 | Bacteria | 19812 |
| 249 | Ga0496125_0252051 | 3300048928 | Bacteria | 1113 |
| 250 | Ga0496126_0000744 | 3300048929 | Bacteria | 59025 |
| 251 | Ga0496126_0021822 | 3300048929 | Bacteria | 6247 |
| 252 | Ga0496126_0032721 | 3300048929 | Bacteria | 4896 |
| 253 | Ga0496126_0183350 | 3300048929 | Bacteria | 1777 |
| 254 | Ga0496126_0595637 | 3300048929 | Bacteria | 871 |
| 255 | Ga0501238_001733 | 3300049671 | Bacteria | 2539 |
| 256 | Ga0501240_000158 | 3300049673 | Bacteria | 4664 |
| 257 | Ga0501249_000003 | 3300049679 | Bacteria | 242930 |
| 258 | Ga0501225_0005776 | 3300049705 | Bacteria | 3623 |
| 259 | Ga0501241_000226 | 3300049758 | Bacteria | 12650 |
| 260 | Ga0501241_000458 | 3300049758 | Bacteria | 8858 |
| 261 | Ga0501241_011259 | 3300049758 | Bacteria | 1624 |
| 262 | Ga0501266_000005 | 3300049763 | Bacteria | 346750 |
| 263 | Ga0501269_000572 | 3300049766 | Bacteria | 6897 |
| 264 | Ga0501280_000320 | 3300049776 | Bacteria | 12083 |
| 265 | nmdc:mga0k408_26_c4 | 3300050493 | Bacteria | 51744 |
| 266 | Ga0500635_0000557 | 3300053080 | Bacteria | 9937 |
| 267 | Ga0500651_0000283 | 3300053093 | Bacteria | 29820 |
| 268 | Ga0500641_0000027 | 3300053096 | Bacteria | 106908 |
| 269 | Ga0500641_0001122 | 3300053096 | Bacteria | 9518 |
| 270 | Ga0500608_005314 | 3300053122 | Bacteria | 5103 |
| 271 | Ga0500655_013033 | 3300053133 | Bacteria | 1515 |
| 272 | Ga0500658_0000021 | 3300053134 | Bacteria | 133042 |
| 273 | Ga0500559_0070000 | 3300053136 | Bacteria | 1578 |
| 274 | Ga0500604_0000513 | 3300053151 | Bacteria | 10741 |
| 275 | Ga0500616_0017920 | 3300053153 | Bacteria | 4010 |
| 276 | Ga0500622_0000017 | 3300053156 | Bacteria | 332114 |
| 277 | Ga0500622_0000065 | 3300053156 | Bacteria | 125090 |
| 278 | Ga0500634_0093238 | 3300053161 | Bacteria | 1523 |
| 279 | Ga0500584_027548 | 3300053726 | Bacteria | 2642 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10002165 | Ga0157378_1000216513 | 218 |
| 2 | 3300046453 | Ga0495627_000071 | Ga0495627_000071_42141_43040 | 222 |
| 3 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_39268_40167 | 222 |
| 4 | 3300047472 | Ga0495686_0005677 | Ga0495686_0005677_1448_2347 | 222 |
| 5 | 3300048929 | Ga0496126_0000744 | Ga0496126_0000744_56651_57535 | 222 |
| 6 | iso_pu_bacteria | 2772190705 | 2772605041 | 222 |
| 7 | 3300013308 | Ga0157375_10005507 | Ga0157375_100055078 | 224 |
| 8 | 3300039062 | Ga0400483_225193 | Ga0400483_225193_2232_3119 | 224 |
| 9 | 3300003316 | rootH1_10127239 | rootH1_101272391 | 225 |
| 10 | 3300017792 | Ga0163161_10005084 | Ga0163161_100050844 | 225 |
| 11 | 3300039062 | Ga0400483_287766 | Ga0400483_287766_733_1620 | 225 |
| 12 | 3300005288 | Ga0065714_10064825 | Ga0065714_100648254 | 227 |
| 13 | 3300031911 | Ga0307412_10016906 | Ga0307412_100169065 | 228 |
| 14 | 3300048925 | Ga0496122_0100355 | Ga0496122_0100355_23_922 | 228 |
| 15 | 3300049758 | Ga0501241_000458 | Ga0501241_000458_3205_4104 | 228 |
| 16 | 3300005337 | Ga0070682_100000371 | Ga0070682_10000037114 | 229 |
| 17 | 3300005455 | Ga0070663_100208444 | Ga0070663_1002084442 | 229 |
| 18 | 3300013104 | Ga0157370_10084497 | Ga0157370_100844972 | 229 |
| 19 | 3300046538 | Ga0495609_0000060 | Ga0495609_0000060_78395_79279 | 229 |
| 20 | 3300003323 | rootH1_10288399 | rootH1_102883993 | 230 |
| 21 | 3300013104 | Ga0157370_10171864 | Ga0157370_101718642 | 230 |
| 22 | 3300015261 | Ga0182006_1000015 | Ga0182006_1000015192 | 230 |
| 23 | 3300031824 | Ga0307413_10154380 | Ga0307413_101543802 | 230 |
| 24 | 3300038741 | Ga0400488_27672 | Ga0400488_27672_748_1566 | 230 |
| 25 | 3300046660 | Ga0495625_0000252 | Ga0495625_0000252_9199_10065 | 230 |
| 26 | 3300048905 | Ga0496102_0058937 | Ga0496102_0058937_1662_2546 | 231 |
| 27 | 3300048916 | Ga0496113_0142681 | Ga0496113_0142681_887_1771 | 231 |
| 28 | 3300048920 | Ga0496117_0000021 | Ga0496117_0000021_184804_185688 | 231 |
| 29 | 3300048921 | Ga0496118_0000531 | Ga0496118_0000531_4625_5509 | 231 |
| 30 | 3300048922 | Ga0496119_0000004 | Ga0496119_0000004_258492_259376 | 231 |
| 31 | 3300048925 | Ga0496122_0000344 | Ga0496122_0000344_2142_3026 | 231 |
| 32 | 3300048926 | Ga0496123_0003713 | Ga0496123_0003713_2135_3019 | 231 |
| 33 | 3300006942 | Ga0099824_1009165 | Ga0099824_100916510 | 232 |
| 34 | 3300006948 | Ga0099826_10126459 | Ga0099826_101264593 | 232 |
| 35 | 3300027361 | Ga0209489_118300 | Ga0209489_1183003 | 232 |
| 36 | 3300027666 | Ga0209282_1099840 | Ga0209282_10998401 | 232 |
| 37 | 3300042004 | Ga0439445_0000019 | Ga0439445_0000019_8419_9318 | 233 |
| 38 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_608788_609687 | 233 |
| 39 | 3300038735 | Ga0400485_21141 | Ga0400485_21141_3188_4075 | 234 |
| 40 | 3300038741 | Ga0400488_48565 | Ga0400488_48565_1397_2284 | 234 |
| 41 | 3300039062 | Ga0400483_218339 | Ga0400483_218339_1859_2746 | 234 |
| 42 | 3300039093 | Ga0400489_25329 | Ga0400489_25329_4349_5236 | 234 |
| 43 | 3300046500 | Ga0495596_0005913 | Ga0495596_0005913_465_1349 | 234 |
| 44 | 3300053136 | Ga0500559_0070000 | Ga0500559_0070000_740_1567 | 234 |
| 45 | 3300003322 | rootL2_10340571 | rootL2_103405712 | 235 |
| 46 | 3300013102 | Ga0157371_10000113 | Ga0157371_1000011374 | 235 |
| 47 | 3300032004 | Ga0307414_10000188 | Ga0307414_1000018812 | 235 |
| 48 | 3300039110 | Ga0400487_18983 | Ga0400487_18983_243_1157 | 235 |
| 49 | 3300048919 | Ga0496116_0000027 | Ga0496116_0000027_260560_261444 | 235 |
| 50 | 3300048924 | Ga0496121_0060393 | Ga0496121_0060393_1956_2840 | 235 |
| 51 | 3300048927 | Ga0496124_0000526 | Ga0496124_0000526_34070_34954 | 235 |
| 52 | 3300005288 | Ga0065714_10064675 | Ga0065714_100646754 | 236 |
| 53 | 3300005293 | Ga0065715_10162879 | Ga0065715_101628791 | 236 |
| 54 | 3300013104 | Ga0157370_10037857 | Ga0157370_100378574 | 236 |
| 55 | 3300017792 | Ga0163161_10001683 | Ga0163161_100016838 | 236 |
| 56 | 3300038725 | Ga0400484_31673 | Ga0400484_31673_11616_12503 | 236 |
| 57 | 3300048929 | Ga0496126_0595637 | Ga0496126_0595637_20_850 | 236 |
| 58 | 3300017792 | Ga0163161_10000007 | Ga0163161_10000007184 | 237 |
| 59 | 3300009036 | Ga0105244_10000069 | Ga0105244_100000699 | 238 |
| 60 | 3300025728 | Ga0207655_1000492 | Ga0207655_10004927 | 238 |
| 61 | 3300038726 | Ga0400490_10968 | Ga0400490_10968_417_1304 | 238 |
| 62 | 3300039062 | Ga0400483_243678 | Ga0400483_243678_831_1718 | 238 |
| 63 | 3300046558 | Ga0495633_0060219 | Ga0495633_0060219_521_1387 | 238 |
| 64 | 3300048918 | Ga0496115_0004487 | Ga0496115_0004487_8532_9404 | 238 |
| 65 | 3300048920 | Ga0496117_0000289 | Ga0496117_0000289_73972_74841 | 238 |
| 66 | 3300048921 | Ga0496118_0115355 | Ga0496118_0115355_693_1562 | 238 |
| 67 | 3300048925 | Ga0496122_0025014 | Ga0496122_0025014_4236_5105 | 238 |
| 68 | 3300048928 | Ga0496125_0003293 | Ga0496125_0003293_18675_19547 | 238 |
| 69 | 3300048929 | Ga0496126_0021822 | Ga0496126_0021822_13_885 | 238 |
| 70 | 3300017792 | Ga0163161_10036912 | Ga0163161_100369122 | 239 |
| 71 | 3300005288 | Ga0065714_10107213 | Ga0065714_101072132 | 240 |
| 72 | 3300006946 | Ga0079104_1000179 | Ga0079104_100017944 | 240 |
| 73 | 3300017792 | Ga0163161_10036674 | Ga0163161_100366742 | 240 |
| 74 | 3300027111 | Ga0209281_1000116 | Ga0209281_1000116100 | 240 |
| 75 | 3300032002 | Ga0307416_100000004 | Ga0307416_100000004307 | 240 |
| 76 | 3300046660 | Ga0495625_0071722 | Ga0495625_0071722_601_1476 | 240 |
| 77 | 3300049679 | Ga0501249_000003 | Ga0501249_000003_49740_50627 | 240 |
| 78 | 3300053096 | Ga0500641_0001122 | Ga0500641_0001122_4427_5305 | 240 |
| 79 | 3300002773 | JGI25152J39213_1000119 | JGI25152J39213_100011927 | 241 |
| 80 | 3300002774 | JGI25150J39212_1000015 | JGI25150J39212_100001573 | 241 |
| 81 | 3300003187 | JGI25151J46595_10000043 | JGI25151J46595_1000004360 | 241 |
| 82 | 3300003215 | JGI25153J46596_10000009 | JGI25153J46596_10000009214 | 241 |
| 83 | 3300005329 | Ga0070683_100004947 | Ga0070683_1000049477 | 241 |
| 84 | 3300005535 | Ga0070684_100008696 | Ga0070684_1000086968 | 241 |
| 85 | 3300013104 | Ga0157370_10001033 | Ga0157370_100010339 | 241 |
| 86 | 3300013308 | Ga0157375_10000065 | Ga0157375_1000006593 | 241 |
| 87 | 3300025245 | Ga0207425_1000023 | Ga0207425_1000023212 | 241 |
| 88 | 3300025258 | Ga0209129_1000032 | Ga0209129_100003260 | 241 |
| 89 | 3300025294 | Ga0209025_1000047 | Ga0209025_100004760 | 241 |
| 90 | 3300025297 | Ga0209758_1000144 | Ga0209758_100014470 | 241 |
| 91 | 3300025909 | Ga0207705_10141346 | Ga0207705_101413462 | 241 |
| 92 | 3300025944 | Ga0207661_10008472 | Ga0207661_100084722 | 241 |
| 93 | 3300031911 | Ga0307412_10000019 | Ga0307412_10000019226 | 241 |
| 94 | 3300032004 | Ga0307414_10112780 | Ga0307414_101127802 | 241 |
| 95 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_218374_219213 | 241 |
| 96 | 3300039062 | Ga0400483_009196 | Ga0400483_009196_596_1486 | 241 |
| 97 | 3300039062 | Ga0400483_161991 | Ga0400483_161991_503_1393 | 241 |
| 98 | 3300046453 | Ga0495627_012216 | Ga0495627_012216_584_1483 | 241 |
| 99 | 3300046519 | Ga0495632_0008958 | Ga0495632_0008958_596_1495 | 241 |
| 100 | 3300046558 | Ga0495633_0009982 | Ga0495633_0009982_1125_2024 | 241 |
| 101 | 3300046660 | Ga0495625_0000970 | Ga0495625_0000970_25917_26816 | 241 |
| 102 | 3300047472 | Ga0495686_0000022 | Ga0495686_0000022_313229_314128 | 241 |
| 103 | 3300048921 | Ga0496118_0125679 | Ga0496118_0125679_509_1408 | 241 |
| 104 | 3300048926 | Ga0496123_0125693 | Ga0496123_0125693_459_1343 | 241 |
| 105 | 3300048929 | Ga0496126_0183350 | Ga0496126_0183350_835_1716 | 241 |
| 106 | 3300003316 | rootH1_10182401 | rootH1_101824011 | 242 |
| 107 | 3300038725 | Ga0400484_12496 | Ga0400484_12496_3971_4861 | 242 |
| 108 | 3300005288 | Ga0065714_10115537 | Ga0065714_101155372 | 243 |
| 109 | 3300005563 | Ga0068855_100013194 | Ga0068855_1000131945 | 243 |
| 110 | 3300009036 | Ga0105244_10113895 | Ga0105244_101138951 | 243 |
| 111 | 3300009093 | Ga0105240_10005314 | Ga0105240_100053145 | 243 |
| 112 | 3300013102 | Ga0157371_10076856 | Ga0157371_100768561 | 243 |
| 113 | 3300025913 | Ga0207695_10004439 | Ga0207695_100044394 | 243 |
| 114 | 3300028794 | Ga0307515_10321294 | Ga0307515_103212942 | 243 |
| 115 | 3300038726 | Ga0400490_05022 | Ga0400490_05022_10737_11624 | 243 |
| 116 | 3300038735 | Ga0400485_09249 | Ga0400485_09249_1382_2269 | 243 |
| 117 | 3300038741 | Ga0400488_55988 | Ga0400488_55988_781_1668 | 243 |
| 118 | 3300046507 | Ga0495606_0000478 | Ga0495606_0000478_38872_39735 | 243 |
| 119 | 3300049758 | Ga0501241_000226 | Ga0501241_000226_11755_12621 | 243 |
| 120 | iso_pu_bacteria | 2911138879 | 2911141247 | 243 |
| 121 | 3300009551 | Ga0105238_10137072 | Ga0105238_101370723 | 244 |
| 122 | 3300010375 | Ga0105239_10000006 | Ga0105239_10000006221 | 244 |
| 123 | 3300035398 | Ga0316574_0104656 | Ga0316574_0104656_900_1781 | 244 |
| 124 | 3300005293 | Ga0065715_10297305 | Ga0065715_102973051 | 245 |
| 125 | 3300013104 | Ga0157370_10000172 | Ga0157370_1000017225 | 245 |
| 126 | 3300025914 | Ga0207671_10010163 | Ga0207671_100101634 | 245 |
| 127 | 3300032004 | Ga0307414_10369120 | Ga0307414_103691201 | 245 |
| 128 | 3300048929 | Ga0496126_0032721 | Ga0496126_0032721_2212_3087 | 245 |
| 129 | 3300049766 | Ga0501269_000572 | Ga0501269_000572_3982_4881 | 245 |
| 130 | 3300013102 | Ga0157371_10150649 | Ga0157371_101506491 | 246 |
| 131 | 3300035398 | Ga0316574_0219248 | Ga0316574_0219248_226_1113 | 246 |
| 132 | 3300046558 | Ga0495633_0000626 | Ga0495633_0000626_9051_9917 | 246 |
| 133 | 3300003322 | rootL2_10278768 | rootL2_102787682 | 247 |
| 134 | 3300005288 | Ga0065714_10138697 | Ga0065714_101386972 | 247 |
| 135 | 3300006195 | Ga0075366_10000026 | Ga0075366_1000002623 | 247 |
| 136 | 3300013306 | Ga0163162_10006470 | Ga0163162_100064705 | 247 |
| 137 | 3300015261 | Ga0182006_1001684 | Ga0182006_10016847 | 247 |
| 138 | 3300025291 | Ga0209675_1000042 | Ga0209675_100004220 | 247 |
| 139 | 3300028794 | Ga0307515_10006038 | Ga0307515_1000603819 | 247 |
| 140 | 3300046684 | Ga0495669_0067053 | Ga0495669_0067053_634_1500 | 247 |
| 141 | 3300048925 | Ga0496122_0006744 | Ga0496122_0006744_1343_2227 | 247 |
| 142 | 3300050493 | nmdc:mga0k408_26_c4 | nmdc:mga0k408_26_c4_20918_21784 | 247 |
| 143 | 3300003323 | rootH1_10020336 | rootH1_100203369 | 248 |
| 144 | 3300003781 | Ga0055536_1000024 | Ga0055536_100002468 | 248 |
| 145 | 3300013296 | Ga0157374_10019166 | Ga0157374_100191662 | 248 |
| 146 | 3300014497 | Ga0182008_10028564 | Ga0182008_100285642 | 248 |
| 147 | 3300015261 | Ga0182006_1014721 | Ga0182006_10147215 | 248 |
| 148 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008203 | 248 |
| 149 | 3300025298 | Ga0209050_1000055 | Ga0209050_1000055209 | 248 |
| 150 | 3300030744 | Ga0316181_1059316 | Ga0316181_10593162 | 248 |
| 151 | 3300031824 | Ga0307413_10042015 | Ga0307413_100420152 | 248 |
| 152 | 3300003791 | Ga0055530_10003260 | Ga0055530_100032604 | 249 |
| 153 | 3300013307 | Ga0157372_10649785 | Ga0157372_106497851 | 249 |
| 154 | 3300015682 | Ga0183373_1020 | Ga0183373_10202 | 250 |
| 155 | 3300017792 | Ga0163161_10103227 | Ga0163161_101032273 | 250 |
| 156 | 3300031903 | Ga0307407_10052057 | Ga0307407_100520572 | 250 |
| 157 | 3300031995 | Ga0307409_100220616 | Ga0307409_1002206161 | 250 |
| 158 | 3300032002 | Ga0307416_100214795 | Ga0307416_1002147951 | 250 |
| 159 | 3300032004 | Ga0307414_10191723 | Ga0307414_101917231 | 250 |
| 160 | 3300046558 | Ga0495633_0000018 | Ga0495633_0000018_43928_44827 | 250 |
| 161 | iso_pu_bacteria | 646564506 | 646814477 | 250 |
| 162 | 3300005288 | Ga0065714_10022743 | Ga0065714_100227432 | 251 |
| 163 | 3300005614 | Ga0068856_100298232 | Ga0068856_1002982322 | 251 |
| 164 | 3300013100 | Ga0157373_10015051 | Ga0157373_100150515 | 251 |
| 165 | 3300013104 | Ga0157370_10004730 | Ga0157370_100047309 | 251 |
| 166 | 3300013104 | Ga0157370_10012803 | Ga0157370_100128037 | 251 |
| 167 | 3300013105 | Ga0157369_10011448 | Ga0157369_100114482 | 251 |
| 168 | 3300013105 | Ga0157369_10180954 | Ga0157369_101809541 | 251 |
| 169 | 3300013307 | Ga0157372_10146742 | Ga0157372_101467424 | 251 |
| 170 | 3300015261 | Ga0182006_1021108 | Ga0182006_10211082 | 251 |
| 171 | 3300015262 | Ga0182007_10030781 | Ga0182007_100307811 | 251 |
| 172 | 3300017792 | Ga0163161_10080967 | Ga0163161_100809672 | 251 |
| 173 | 3300026078 | Ga0207702_10371101 | Ga0207702_103711012 | 251 |
| 174 | 3300031731 | Ga0307405_10048274 | Ga0307405_100482741 | 251 |
| 175 | 3300046512 | Ga0495610_0015728 | Ga0495610_0015728_422_1288 | 251 |
| 176 | 3300047472 | Ga0495686_0000711 | Ga0495686_0000711_29704_30567 | 251 |
| 177 | 3300048927 | Ga0496124_0021551 | Ga0496124_0021551_1238_2113 | 251 |
| 178 | 3300048928 | Ga0496125_0000050 | Ga0496125_0000050_63902_64777 | 251 |
| 179 | 3300048928 | Ga0496125_0252051 | Ga0496125_0252051_12_881 | 251 |
| 180 | 3300053161 | Ga0500634_0093238 | Ga0500634_0093238_192_1058 | 251 |
| 181 | iso_pu_bacteria | 2818991437 | 2819546968 | 251 |
| 182 | 3300013102 | Ga0157371_10036425 | Ga0157371_100364252 | 252 |
| 183 | 3300013105 | Ga0157369_10521953 | Ga0157369_105219531 | 252 |
| 184 | 3300035398 | Ga0316574_0004177 | Ga0316574_0004177_258_1139 | 252 |
| 185 | iso_pu_bacteria | 2919186247 | 2919186657 | 252 |
| 186 | iso_pu_bacteria | 2939664404 | 2939666073 | 252 |
| 187 | 3300005548 | Ga0070665_100418664 | Ga0070665_1004186642 | 253 |
| 188 | 3300009148 | Ga0105243_10000008 | Ga0105243_10000008273 | 253 |
| 189 | 3300013100 | Ga0157373_10007425 | Ga0157373_100074255 | 253 |
| 190 | 3300025935 | Ga0207709_10000006 | Ga0207709_10000006205 | 253 |
| 191 | 3300028379 | Ga0268266_10365539 | Ga0268266_103655392 | 253 |
| 192 | 3300048925 | Ga0496122_0072469 | Ga0496122_0072469_1305_2228 | 253 |
| 193 | 3300053080 | Ga0500635_0000557 | Ga0500635_0000557_5821_6687 | 253 |
| 194 | iso_pu_bacteria | 2857613821 | 2857614555 | 253 |
| 195 | iso_pu_bacteria | 2904419702 | 2904419843 | 253 |
| 196 | 3300005288 | Ga0065714_10073153 | Ga0065714_100731531 | 254 |
| 197 | 3300048919 | Ga0496116_0000047 | Ga0496116_0000047_251208_252092 | 254 |
| 198 | iso_pu_bacteria | 2884634485 | 2884637210 | 254 |
| 199 | iso_pu_bacteria | 2896317667 | 2896321279 | 254 |
| 200 | iso_pu_bacteria | 2904555929 | 2904556630 | 254 |
| 201 | 3300003320 | rootH2_10179811 | rootH2_101798112 | 255 |
| 202 | 3300005288 | Ga0065714_10066564 | Ga0065714_100665646 | 255 |
| 203 | 3300013100 | Ga0157373_10000002 | Ga0157373_1000000260 | 255 |
| 204 | 3300013104 | Ga0157370_10003309 | Ga0157370_100033098 | 255 |
| 205 | 3300015261 | Ga0182006_1001701 | Ga0182006_10017013 | 255 |
| 206 | 3300031727 | Ga0316576_10027540 | Ga0316576_100275405 | 255 |
| 207 | 3300031728 | Ga0316578_10034450 | Ga0316578_100344502 | 255 |
| 208 | 3300031728 | Ga0316578_10167820 | Ga0316578_101678202 | 255 |
| 209 | 3300032004 | Ga0307414_10000306 | Ga0307414_100003068 | 255 |
| 210 | 3300032133 | Ga0316583_10057642 | Ga0316583_100576422 | 255 |
| 211 | 3300035398 | Ga0316574_0026997 | Ga0316574_0026997_1881_2762 | 255 |
| 212 | 3300036647 | Ga0316582_0086171 | Ga0316582_0086171_550_1431 | 255 |
| 213 | 3300036712 | Ga0316584_0005980 | Ga0316584_0005980_6088_6969 | 255 |
| 214 | 3300046558 | Ga0495633_0000039 | Ga0495633_0000039_75929_76792 | 255 |
| 215 | iso_pu_bacteria | 2513020052 | 2513234433 | 255 |
| 216 | iso_pu_bacteria | 2643221716 | 2644642306 | 255 |
| 217 | 3300017792 | Ga0163161_10029458 | Ga0163161_100294582 | 256 |
| 218 | 3300031548 | Ga0307408_100002894 | Ga0307408_1000028945 | 256 |
| 219 | 3300031731 | Ga0307405_10031372 | Ga0307405_100313723 | 256 |
| 220 | 3300031852 | Ga0307410_10000115 | Ga0307410_1000011519 | 256 |
| 221 | 3300031901 | Ga0307406_10000111 | Ga0307406_1000011119 | 256 |
| 222 | 3300031901 | Ga0307406_10056370 | Ga0307406_100563702 | 256 |
| 223 | 3300031903 | Ga0307407_10008551 | Ga0307407_100085511 | 256 |
| 224 | 3300031911 | Ga0307412_10080842 | Ga0307412_100808422 | 256 |
| 225 | 3300031995 | Ga0307409_100074848 | Ga0307409_1000748482 | 256 |
| 226 | 3300032002 | Ga0307416_100002085 | Ga0307416_1000020853 | 256 |
| 227 | 3300032004 | Ga0307414_10000001 | Ga0307414_10000001787 | 256 |
| 228 | 3300032126 | Ga0307415_100074590 | Ga0307415_1000745902 | 256 |
| 229 | 3300041411 | Ga0439466_0002554 | Ga0439466_0002554_5162_6034 | 256 |
| 230 | 3300049671 | Ga0501238_001733 | Ga0501238_001733_1288_2160 | 256 |
| 231 | 3300049758 | Ga0501241_011259 | Ga0501241_011259_734_1606 | 256 |
| 232 | 3300049776 | Ga0501280_000320 | Ga0501280_000320_818_1690 | 256 |
| 233 | 3300053096 | Ga0500641_0000027 | Ga0500641_0000027_45222_46112 | 256 |
| 234 | 3300053156 | Ga0500622_0000017 | Ga0500622_0000017_301246_302166 | 256 |
| 235 | 3300053726 | Ga0500584_027548 | Ga0500584_027548_1680_2570 | 256 |
| 236 | iso_pu_bacteria | 2904780799 | 2904784422 | 256 |
| 237 | iso_pu_bacteria | 2919177583 | 2919178953 | 256 |
| 238 | iso_pu_bacteria | 8054307821 | 8054308210 | 256 |
| 239 | iso_pu_bacteria | 8056440228 | 8056442213 | 256 |
| 240 | 3300005289 | Ga0065704_10073246 | Ga0065704_100732466 | 257 |
| 241 | 3300005347 | Ga0070668_100075482 | Ga0070668_1000754822 | 257 |
| 242 | 3300009036 | Ga0105244_10000004 | Ga0105244_10000004360 | 257 |
| 243 | 3300009148 | Ga0105243_10002193 | Ga0105243_100021936 | 257 |
| 244 | 3300025728 | Ga0207655_1000008 | Ga0207655_1000008228 | 257 |
| 245 | 3300025935 | Ga0207709_10001031 | Ga0207709_1000103110 | 257 |
| 246 | 3300025972 | Ga0207668_10170309 | Ga0207668_101703092 | 257 |
| 247 | 3300048925 | Ga0496122_0000119 | Ga0496122_0000119_147843_148724 | 257 |
| 248 | iso_pu_bacteria | 2519899754 | 2520878839 | 257 |
| 249 | iso_pu_bacteria | 2585427687 | 2586211188 | 257 |
| 250 | iso_pu_bacteria | 2643221600 | 2644011449 | 257 |
| 251 | iso_pu_bacteria | 2643221667 | 2644369852 | 257 |
| 252 | iso_pu_bacteria | 2643221725 | 2644685243 | 257 |
| 253 | iso_pu_bacteria | 2738541279 | 2738731960 | 257 |
| 254 | iso_pu_bacteria | 2738541285 | 2738764525 | 257 |
| 255 | iso_pu_bacteria | 2738543007 | 2739213540 | 257 |
| 256 | iso_pu_bacteria | 2739367651 | 2739586538 | 257 |
| 257 | iso_pu_bacteria | 2739367663 | 2739647959 | 257 |
| 258 | iso_pu_bacteria | 2739367857 | 2740000808 | 257 |
| 259 | iso_pu_bacteria | 2739367858 | 2740005624 | 257 |
| 260 | iso_pu_bacteria | 2802428842 | 2802654157 | 257 |
| 261 | iso_pu_bacteria | 2816332280 | 2817415818 | 257 |
| 262 | iso_pu_bacteria | 2818991437 | 2819550427 | 257 |
| 263 | iso_pu_bacteria | 2833640130 | 2833640275 | 257 |
| 264 | iso_pu_bacteria | 2842722452 | 2842727847 | 257 |
| 265 | iso_pu_bacteria | 2842909656 | 2842914984 | 257 |
| 266 | iso_pu_bacteria | 2849281842 | 2849287099 | 257 |
| 267 | iso_pu_bacteria | 2857618242 | 2857619062 | 257 |
| 268 | iso_pu_bacteria | 2857627736 | 2857630219 | 257 |
| 269 | iso_pu_bacteria | 2881359912 | 2881360462 | 257 |
| 270 | iso_pu_bacteria | 2896344016 | 2896344820 | 257 |
| 271 | iso_pu_bacteria | 2902048731 | 2902051502 | 257 |
| 272 | iso_pu_bacteria | 2903895155 | 2903898606 | 257 |
| 273 | iso_pu_bacteria | 2904445276 | 2904449884 | 257 |
| 274 | iso_pu_bacteria | 2919191525 | 2919194042 | 257 |
| 275 | iso_pu_bacteria | 2919683626 | 2919685788 | 257 |
| 276 | iso_pu_bacteria | 2919692658 | 2919696392 | 257 |
| 277 | iso_pu_bacteria | 2929150217 | 2929153059 | 257 |
| 278 | iso_pu_bacteria | 2945997725 | 2946002457 | 257 |
| 279 | iso_pu_bacteria | 2954016120 | 2954021816 | 257 |
| 280 | iso_pu_bacteria | 2958458903 | 2958460884 | 257 |
| 281 | iso_pu_bacteria | 2977232053 | 2977236623 | 257 |
| 282 | iso_pu_bacteria | 2977268062 | 2977269726 | 257 |
| 283 | iso_pu_bacteria | 8055419101 | 8055421495 | 257 |
| 284 | iso_pu_bacteria | 8055592153 | 8055594032 | 257 |
| 285 | 3300031548 | Ga0307408_100001531 | Ga0307408_10000153111 | 258 |
| 286 | 3300031548 | Ga0307408_100003112 | Ga0307408_10000311212 | 258 |
| 287 | 3300031548 | Ga0307408_100025183 | Ga0307408_1000251832 | 258 |
| 288 | 3300053151 | Ga0500604_0000513 | Ga0500604_0000513_306_1175 | 258 |
| 289 | 3300053156 | Ga0500622_0000065 | Ga0500622_0000065_97830_98699 | 258 |
| 290 | iso_pu_bacteria | 2511231000 | 2511232696 | 258 |
| 291 | iso_pu_bacteria | 2582581278 | 2585145640 | 258 |
| 292 | iso_pu_bacteria | 2582581281 | 2585158748 | 258 |
| 293 | iso_pu_bacteria | 2582581282 | 2585163036 | 258 |
| 294 | iso_pu_bacteria | 2582581873 | 2585425501 | 258 |
| 295 | iso_pu_bacteria | 2585428045 | 2587681152 | 258 |
| 296 | iso_pu_bacteria | 2585428060 | 2587745645 | 258 |
| 297 | iso_pu_bacteria | 2585428115 | 2587943644 | 258 |
| 298 | iso_pu_bacteria | 2585428182 | 2588209034 | 258 |
| 299 | iso_pu_bacteria | 2585428183 | 2588216199 | 258 |
| 300 | iso_pu_bacteria | 2585428184 | 2588220489 | 258 |
| 301 | iso_pu_bacteria | 2585428185 | 2588225206 | 258 |
| 302 | iso_pu_bacteria | 2585428187 | 2588234115 | 258 |
| 303 | iso_pu_bacteria | 2588253712 | 2588445568 | 258 |
| 304 | iso_pu_bacteria | 2588254255 | 2590602456 | 258 |
| 305 | iso_pu_bacteria | 2588254257 | 2590611178 | 258 |
| 306 | iso_pu_bacteria | 2728369107 | 2729202177 | 258 |
| 307 | iso_pu_bacteria | 2738541302 | 2738856871 | 258 |
| 308 | iso_pu_bacteria | 2738543023 | 2739304649 | 258 |
| 309 | iso_pu_bacteria | 2739367656 | 2739617667 | 258 |
| 310 | iso_pu_bacteria | 2751185877 | 2753671822 | 258 |
| 311 | iso_pu_bacteria | 2765235839 | 2765576746 | 258 |
| 312 | iso_pu_bacteria | 2775506739 | 2775673512 | 258 |
| 313 | iso_pu_bacteria | 2816332188 | 2816872046 | 258 |
| 314 | iso_pu_bacteria | 2842083920 | 2842085801 | 258 |
| 315 | iso_pu_bacteria | 2842903701 | 2842904654 | 258 |
| 316 | iso_pu_bacteria | 2871720351 | 2871720931 | 258 |
| 317 | iso_pu_bacteria | 2889290771 | 2889292793 | 258 |
| 318 | iso_pu_bacteria | 2905999023 | 2906002464 | 258 |
| 319 | iso_pu_bacteria | 2914759650 | 2914762904 | 258 |
| 320 | iso_pu_bacteria | 2919097161 | 2919097619 | 258 |
| 321 | iso_pu_bacteria | 2919399522 | 2919400926 | 258 |
| 322 | iso_pu_bacteria | 2929154850 | 2929159802 | 258 |
| 323 | iso_pu_bacteria | 2945924605 | 2945926783 | 258 |
| 324 | iso_pu_bacteria | 2946019816 | 2946020471 | 258 |
| 325 | iso_pu_bacteria | 2958512119 | 2958512177 | 258 |
| 326 | iso_pu_bacteria | 2977243572 | 2977246904 | 258 |
| 327 | iso_pu_bacteria | 2984572630 | 2984575242 | 258 |
| 328 | iso_pu_bacteria | 2984606641 | 2984608695 | 258 |
| 329 | iso_pu_bacteria | 2993372514 | 2993374186 | 258 |
| 330 | iso_pu_bacteria | 2993480792 | 2993481087 | 258 |
| 331 | 3300046453 | Ga0495627_001392 | Ga0495627_001392_4920_5789 | 259 |
| 332 | 3300049763 | Ga0501266_000005 | Ga0501266_000005_38773_39663 | 259 |
| 333 | 3300053134 | Ga0500658_0000021 | Ga0500658_0000021_116566_117456 | 259 |
| 334 | 3300005293 | Ga0065715_10102814 | Ga0065715_101028141 | 260 |
| 335 | 3300032004 | Ga0307414_10056447 | Ga0307414_100564472 | 260 |
| 336 | 3300032005 | Ga0307411_10000013 | Ga0307411_1000001357 | 260 |
| 337 | 3300049673 | Ga0501240_000158 | Ga0501240_000158_1118_1981 | 260 |
| 338 | 3300013306 | Ga0163162_10021458 | Ga0163162_100214584 | 261 |
| 339 | 3300013306 | Ga0163162_10160580 | Ga0163162_101605801 | 261 |
| 340 | 3300026035 | Ga0207703_10067722 | Ga0207703_100677222 | 261 |
| 341 | 3300028786 | Ga0307517_10002529 | Ga0307517_100025297 | 261 |
| 342 | 3300046500 | Ga0495596_0009684 | Ga0495596_0009684_540_1406 | 261 |
| 343 | 3300046519 | Ga0495632_0024380 | Ga0495632_0024380_833_1699 | 261 |
| 344 | 3300046660 | Ga0495625_0303466 | Ga0495625_0303466_38_904 | 261 |
| 345 | 3300053122 | Ga0500608_005314 | Ga0500608_005314_207_1073 | 261 |
| 346 | 2162886007 | SwRhRL2b_contig_900766 | SwRhRL2b_0592.00012360 | 262 |
| 347 | 3300003320 | rootH2_10058921 | rootH2_100589212 | 262 |
| 348 | 3300003322 | rootL2_10067677 | rootL2_100676771 | 262 |
| 349 | 3300003323 | rootH1_10033648 | rootH1_100336486 | 262 |
| 350 | 3300005262 | Ga0065165_1001168 | Ga0065165_100116820 | 262 |
| 351 | 3300005288 | Ga0065714_10004609 | Ga0065714_1000460914 | 262 |
| 352 | 3300005289 | Ga0065704_10000199 | Ga0065704_10000199252 | 262 |
| 353 | 3300005289 | Ga0065704_10107453 | Ga0065704_101074532 | 262 |
| 354 | 3300013100 | Ga0157373_10000015 | Ga0157373_1000001556 | 262 |
| 355 | 3300014325 | Ga0163163_10700542 | Ga0163163_107005421 | 262 |
| 356 | 3300014969 | Ga0157376_10112232 | Ga0157376_101122323 | 262 |
| 357 | 3300015261 | Ga0182006_1006894 | Ga0182006_10068942 | 262 |
| 358 | 3300017792 | Ga0163161_10010556 | Ga0163161_100105565 | 262 |
| 359 | 3300030732 | Ga0316176_1023444 | Ga0316176_102344411 | 262 |
| 360 | 3300030742 | Ga0316183_1145092 | Ga0316183_114509224 | 262 |
| 361 | 3300030744 | Ga0316181_1014202 | Ga0316181_101420224 | 262 |
| 362 | 3300031727 | Ga0316576_10104030 | Ga0316576_101040301 | 262 |
| 363 | 3300031728 | Ga0316578_10043684 | Ga0316578_100436842 | 262 |
| 364 | 3300031911 | Ga0307412_10000033 | Ga0307412_10000033163 | 262 |
| 365 | 3300032004 | Ga0307414_10037590 | Ga0307414_100375902 | 262 |
| 366 | 3300035398 | Ga0316574_0001086 | Ga0316574_0001086_7260_8156 | 262 |
| 367 | 3300046507 | Ga0495606_0036455 | Ga0495606_0036455_1361_2245 | 262 |
| 368 | 3300046507 | Ga0495606_0081534 | Ga0495606_0081534_1007_1894 | 262 |
| 369 | 3300046522 | Ga0495643_0000452 | Ga0495643_0000452_9934_10812 | 262 |
| 370 | 3300046660 | Ga0495625_0011561 | Ga0495625_0011561_5598_6476 | 262 |
| 371 | 3300049705 | Ga0501225_0005776 | Ga0501225_0005776_1155_2027 | 262 |
| 372 | 3300053093 | Ga0500651_0000283 | Ga0500651_0000283_989_1858 | 262 |
| 373 | 3300053133 | Ga0500655_013033 | Ga0500655_013033_596_1468 | 262 |
| 374 | 3300053153 | Ga0500616_0017920 | Ga0500616_0017920_1335_2207 | 262 |
| 375 | iso_pu_bacteria | 2739367874 | 2740061337 | 262 |
| 376 | iso_pu_bacteria | 2818991444 | 2819585532 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar