F427538

General Info

Members Datasets Scaffolds Average Seq Length
376 243 279 274

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2739367874|2740061337
Length 308
Sequence IKWLFLLLNNKINMASGFFAILDDLAALMDDVAVTSKIATQKTAGILGDDLAVNAEKATGFISSREIPVLWAITKGSFINKLIILPIAFLLHWLYKPAIEIILILGGFYLAFEGVEKIIEFLFHRDKKGHEVIEESTKNEDAENSEKSKIKSAITTDFILSIEIVIIALGTVLEEQHPLLTQIITVSLVSFLATVGVYGIVALIVRMDDAGFKLIKKSNDKGFFSKLGHLLVKALPVIIKILAIVGTIALILVSGGIFAHNISYLHHFLPSWPTALKELVFGLSGGLIAVLLFTVGKKAYTLATRKGS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
10 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
22 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
23 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
24 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
25 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
26 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
27 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
28 2738541302 Pedobacter sp. CF074 Isolate Unclassified
29 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
30 2738543023 Pedobacter sp. OK628 Isolate Unclassified
31 2739367651 Pedobacter sp. OK291 Isolate Unclassified
32 2739367656 Pedobacter sp. CF523 Isolate Unclassified
33 2739367663 Pedobacter sp. YR510 Isolate Unclassified
34 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
35 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
36 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
37 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
38 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
39 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
40 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
41 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
42 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
43 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
44 2818991437 Pedobacter terrae 518 Isolate Unclassified
45 2818991444 Filimonas endophytica 3197 Isolate Unclassified
46 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
47 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
48 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
49 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
50 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
51 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
52 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
53 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
54 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
55 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
56 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
57 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
58 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
59 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
60 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
61 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
62 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
63 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
64 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
65 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
66 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
67 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
68 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
69 2914759650 Rhizosphaericola mali Isolate Rhizosphere
70 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
71 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
72 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
73 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
74 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
75 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
76 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
77 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
78 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
79 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
80 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
81 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
82 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
83 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
84 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
85 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
86 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
87 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
88 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
89 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
90 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
91 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
92 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
93 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
94 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
95 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
96 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
97 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
98 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
99 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
100 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
101 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
102 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
103 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
104 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
105 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
106 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
108 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
117 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
118 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
119 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
158 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
163 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
164 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
185 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
186 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
187 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
188 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
189 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
190 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
219 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
220 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
223 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
224 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
225 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
238 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
239 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
240 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
241 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
242 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
243 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.2
Metatranscriptomes 0
Isolates 25.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 7.98
Nodule 1.86
Rhizoplane 0.8
Rhizosphere 63.3
Stem 0
Stem Tuber 0
Unclassified 25.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_900766 2162886007 Bacteria 33637
2 JGI25152J39213_1000119 3300002773 Bacteria 55075
3 JGI25150J39212_1000015 3300002774 Bacteria 170613
4 JGI25151J46595_10000043 3300003187 Bacteria 170613
5 JGI25153J46596_10000009 3300003215 Bacteria 340925
6 rootH1_10127239 3300003316 Bacteria 2541
7 rootH1_10182401 3300003316 Unclassified 1200
8 rootH2_10058921 3300003320 Bacteria 3055
9 rootH2_10179811 3300003320 Unclassified 1574
10 rootL2_10067677 3300003322 Bacteria 2261
11 rootL2_10278768 3300003322 Unclassified 2431
12 rootL2_10340571 3300003322 Bacteria 1862
13 rootH1_10020336 3300003323 Bacteria 19882
14 rootH1_10033648 3300003323 Bacteria 8226
15 rootH1_10288399 3300003323 Bacteria 2117
16 Ga0055536_1000024 3300003781 Bacteria 185534
17 Ga0055530_10003260 3300003791 Bacteria 9440
18 Ga0065165_1001168 3300005262 Bacteria 30512
19 Ga0065714_10004609 3300005288 Bacteria 28110
20 Ga0065714_10022743 3300005288 Bacteria 1654
21 Ga0065714_10064675 3300005288 Bacteria 24373
22 Ga0065714_10064825 3300005288 Bacteria 17735
23 Ga0065714_10066564 3300005288 Bacteria 6644
24 Ga0065714_10073153 3300005288 Bacteria 3237
25 Ga0065714_10107213 3300005288 Bacteria 1536
26 Ga0065714_10115537 3300005288 Bacteria 1414
27 Ga0065714_10138697 3300005288 Bacteria 1188
28 Ga0065704_10000199 3300005289 Bacteria 297176
29 Ga0065704_10073246 3300005289 Bacteria 7396
30 Ga0065704_10107453 3300005289 Bacteria 2055
31 Ga0065715_10102814 3300005293 Bacteria 3083
32 Ga0065715_10162879 3300005293 Bacteria 1582
33 Ga0065715_10297305 3300005293 Bacteria 1049
34 Ga0070683_100004947 3300005329 Bacteria 11054
35 Ga0070682_100000371 3300005337 Bacteria 30205
36 Ga0070668_100075482 3300005347 Bacteria 2632
37 Ga0070663_100208444 3300005455 Bacteria 1529
38 Ga0070684_100008696 3300005535 Bacteria 7959
39 Ga0070665_100418664 3300005548 Bacteria 1348
40 Ga0068855_100013194 3300005563 Bacteria 9968
41 Ga0068856_100298232 3300005614 Bacteria 1629
42 Ga0075366_10000026 3300006195 Bacteria 51752
43 Ga0099824_1009165 3300006942 Bacteria 12295
44 Ga0079104_1000179 3300006946 Bacteria 90381
45 Ga0099826_10126459 3300006948 Bacteria 1497
46 Ga0105244_10000004 3300009036 Bacteria 492478
47 Ga0105244_10000069 3300009036 Bacteria 119620
48 Ga0105244_10113895 3300009036 Bacteria 1314
49 Ga0105240_10005314 3300009093 Bacteria 19213
50 Ga0105243_10000008 3300009148 Bacteria 390270
51 Ga0105243_10002193 3300009148 Bacteria 16461
52 Ga0105238_10137072 3300009551 Bacteria 2425
53 Ga0105239_10000006 3300010375 Bacteria 442319
54 Ga0157373_10000002 3300013100 Bacteria 750094
55 Ga0157373_10000015 3300013100 Bacteria 183381
56 Ga0157373_10007425 3300013100 Bacteria 8154
57 Ga0157373_10015051 3300013100 Bacteria 5658
58 Ga0157371_10000113 3300013102 Bacteria 122461
59 Ga0157371_10036425 3300013102 Bacteria 3523
60 Ga0157371_10076856 3300013102 Bacteria 2364
61 Ga0157371_10150649 3300013102 Bacteria 1659
62 Ga0157370_10000172 3300013104 Bacteria 80432
63 Ga0157370_10001033 3300013104 Bacteria 35017
64 Ga0157370_10003309 3300013104 Bacteria 19002
65 Ga0157370_10004730 3300013104 Bacteria 15518
66 Ga0157370_10012803 3300013104 Bacteria 8672
67 Ga0157370_10037857 3300013104 Bacteria 4670
68 Ga0157370_10084497 3300013104 Bacteria 2983
69 Ga0157370_10171864 3300013104 Bacteria 2014
70 Ga0157369_10011448 3300013105 Bacteria 10073
71 Ga0157369_10180954 3300013105 Bacteria 2218
72 Ga0157369_10521953 3300013105 Bacteria 1228
73 Ga0157374_10019166 3300013296 Bacteria 6053
74 Ga0157378_10002165 3300013297 Bacteria 17447
75 Ga0163162_10006470 3300013306 Bacteria 11341
76 Ga0163162_10021458 3300013306 Bacteria 6361
77 Ga0163162_10160580 3300013306 Bacteria 2369
78 Ga0157372_10146742 3300013307 Bacteria 2720
79 Ga0157372_10649785 3300013307 Bacteria 1228
80 Ga0157375_10000065 3300013308 Bacteria 112832
81 Ga0157375_10005507 3300013308 Bacteria 11017
82 Ga0163163_10700542 3300014325 Bacteria 1076
83 Ga0182008_10028564 3300014497 Bacteria 2820
84 Ga0157376_10112232 3300014969 Bacteria 2401
85 Ga0182006_1000015 3300015261 Bacteria 325938
86 Ga0182006_1001684 3300015261 Bacteria 12944
87 Ga0182006_1001701 3300015261 Bacteria 12843
88 Ga0182006_1006894 3300015261 Bacteria 5239
89 Ga0182006_1014721 3300015261 Bacteria 3367
90 Ga0182006_1021108 3300015261 Bacteria 2719
91 Ga0182007_10030781 3300015262 Bacteria 1832
92 Ga0183373_1020 3300015682 Bacteria 1626
93 Ga0163161_10000007 3300017792 Bacteria 301614
94 Ga0163161_10001683 3300017792 Bacteria 16226
95 Ga0163161_10005084 3300017792 Bacteria 9156
96 Ga0163161_10010556 3300017792 Bacteria 6397
97 Ga0163161_10029458 3300017792 Bacteria 3903
98 Ga0163161_10036674 3300017792 Bacteria 3512
99 Ga0163161_10036912 3300017792 Bacteria 3501
100 Ga0163161_10080967 3300017792 Bacteria 2390
101 Ga0163161_10103227 3300017792 Bacteria 2124
102 Ga0207425_1000023 3300025245 Bacteria 341339
103 Ga0209129_1000032 3300025258 Bacteria 341150
104 Ga0209675_1000042 3300025291 Bacteria 235989
105 Ga0209676_1000008 3300025292 Bacteria 991778
106 Ga0209025_1000047 3300025294 Bacteria 341150
107 Ga0209758_1000144 3300025297 Bacteria 170724
108 Ga0209050_1000055 3300025298 Bacteria 339254
109 Ga0207655_1000008 3300025728 Bacteria 734289
110 Ga0207655_1000492 3300025728 Bacteria 50910
111 Ga0207705_10141346 3300025909 Unclassified 1798
112 Ga0207695_10004439 3300025913 Bacteria 19146
113 Ga0207671_10010163 3300025914 Bacteria 7795
114 Ga0207709_10000006 3300025935 Bacteria 800946
115 Ga0207709_10001031 3300025935 Bacteria 20585
116 Ga0207661_10008472 3300025944 Bacteria 7351
117 Ga0207668_10170309 3300025972 Bacteria 1707
118 Ga0207703_10067722 3300026035 Bacteria 2939
119 Ga0207702_10371101 3300026078 Bacteria 1374
120 Ga0209281_1000116 3300027111 Bacteria 209707
121 Ga0209489_118300 3300027361 Bacteria 2799
122 Ga0209282_1099840 3300027666 Bacteria 1497
123 Ga0268266_10365539 3300028379 Bacteria 1358
124 Ga0307517_10002529 3300028786 Bacteria 29143
125 Ga0307515_10006038 3300028794 Bacteria 24361
126 Ga0307515_10321294 3300028794 Bacteria 1214
127 Ga0316176_1023444 3300030732 Bacteria 24481
128 Ga0316183_1145092 3300030742 Bacteria 25653
129 Ga0316181_1014202 3300030744 Bacteria 22841
130 Ga0316181_1059316 3300030744 Bacteria 1301
131 Ga0307408_100001531 3300031548 Bacteria 17165
132 Ga0307408_100002894 3300031548 Bacteria 11896
133 Ga0307408_100003112 3300031548 Bacteria 11435
134 Ga0307408_100025183 3300031548 Bacteria 4072
135 Ga0316576_10027540 3300031727 Bacteria 3997
136 Ga0316576_10104030 3300031727 Bacteria 2124
137 Ga0316578_10034450 3300031728 Bacteria 2907
138 Ga0316578_10043684 3300031728 Unclassified 2604
139 Ga0316578_10167820 3300031728 Bacteria 1323
140 Ga0307405_10031372 3300031731 Bacteria 3128
141 Ga0307405_10048274 3300031731 Bacteria 2624
142 Ga0307413_10042015 3300031824 Bacteria 2683
143 Ga0307413_10154380 3300031824 Bacteria 1604
144 Ga0307410_10000115 3300031852 Bacteria 28127
145 Ga0307406_10000111 3300031901 Bacteria 46791
146 Ga0307406_10056370 3300031901 Unclassified 2516
147 Ga0307407_10008551 3300031903 Bacteria 4708
148 Ga0307407_10052057 3300031903 Bacteria 2349
149 Ga0307412_10000019 3300031911 Bacteria 266611
150 Ga0307412_10000033 3300031911 Bacteria 206649
151 Ga0307412_10016906 3300031911 Bacteria 4358
152 Ga0307412_10080842 3300031911 Unclassified 2246
153 Ga0307409_100074848 3300031995 Unclassified 2708
154 Ga0307409_100220616 3300031995 Bacteria 1711
155 Ga0307416_100000004 3300032002 Bacteria 505535
156 Ga0307416_100002085 3300032002 Bacteria 11282
157 Ga0307416_100214795 3300032002 Bacteria 1838
158 Ga0307414_10000001 3300032004 Bacteria 1352954
159 Ga0307414_10000188 3300032004 Bacteria 42008
160 Ga0307414_10000306 3300032004 Bacteria 28470
161 Ga0307414_10037590 3300032004 Bacteria 3243
162 Ga0307414_10056447 3300032004 Bacteria 2754
163 Ga0307414_10112780 3300032004 Bacteria 2073
164 Ga0307414_10191723 3300032004 Bacteria 1654
165 Ga0307414_10369120 3300032004 Bacteria 1237
166 Ga0307411_10000013 3300032005 Bacteria 145335
167 Ga0307415_100074590 3300032126 Bacteria 2398
168 Ga0316583_10057642 3300032133 Bacteria 1364
169 Ga0316574_0001086 3300035398 Bacteria 12423
170 Ga0316574_0004177 3300035398 Bacteria 7525
171 Ga0316574_0026997 3300035398 Bacteria 3456
172 Ga0316574_0104656 3300035398 Bacteria 1812
173 Ga0316574_0219248 3300035398 Bacteria 1219
174 Ga0316582_0086171 3300036647 Bacteria 2059
175 Ga0316584_0005980 3300036712 Bacteria 8219
176 Ga0395899_0000002 3300037312 Bacteria 1324310
177 Ga0400484_12496 3300038725 Bacteria 5236
178 Ga0400484_31673 3300038725 Bacteria 14348
179 Ga0400490_05022 3300038726 Bacteria 39338
180 Ga0400490_10968 3300038726 Bacteria 49546
181 Ga0400485_09249 3300038735 Bacteria 2650
182 Ga0400485_21141 3300038735 Bacteria 6543
183 Ga0400488_27672 3300038741 Bacteria 2005
184 Ga0400488_48565 3300038741 Bacteria 15780
185 Ga0400488_55988 3300038741 Unclassified 4281
186 Ga0400483_009196 3300039062 Bacteria 2063
187 Ga0400483_161991 3300039062 Bacteria 2698
188 Ga0400483_218339 3300039062 Bacteria 9791
189 Ga0400483_225193 3300039062 Unclassified 3228
190 Ga0400483_243678 3300039062 Bacteria 3392
191 Ga0400483_287766 3300039062 Bacteria 2050
192 Ga0400489_25329 3300039093 Bacteria 25097
193 Ga0400487_18983 3300039110 Bacteria 1276
194 Ga0439466_0002554 3300041411 Bacteria 7128
195 Ga0439445_0000019 3300042004 Bacteria 21629
196 Ga0495627_000071 3300046453 Bacteria 124716
197 Ga0495627_001392 3300046453 Bacteria 14316
198 Ga0495627_012216 3300046453 Bacteria 3056
199 Ga0495596_0005913 3300046500 Bacteria 5707
200 Ga0495596_0009684 3300046500 Bacteria 4232
201 Ga0495606_0000478 3300046507 Bacteria 65674
202 Ga0495606_0036455 3300046507 Bacteria 3349
203 Ga0495606_0081534 3300046507 Bacteria 2011
204 Ga0495610_0000001 3300046512 Bacteria 1620061
205 Ga0495610_0015728 3300046512 Bacteria 4386
206 Ga0495632_0008958 3300046519 Bacteria 6072
207 Ga0495632_0024380 3300046519 Bacteria 3214
208 Ga0495643_0000452 3300046522 Bacteria 52237
209 Ga0495654_0000001 3300046530 Bacteria 1513197
210 Ga0495609_0000060 3300046538 Bacteria 139944
211 Ga0495633_0000018 3300046558 Bacteria 243398
212 Ga0495633_0000039 3300046558 Bacteria 180652
213 Ga0495633_0000626 3300046558 Bacteria 33117
214 Ga0495633_0009982 3300046558 Bacteria 5210
215 Ga0495633_0060219 3300046558 Bacteria 1779
216 Ga0495625_0000252 3300046660 Bacteria 83831
217 Ga0495625_0000970 3300046660 Bacteria 38139
218 Ga0495625_0011561 3300046660 Bacteria 7188
219 Ga0495625_0071722 3300046660 Bacteria 2430
220 Ga0495625_0303466 3300046660 Bacteria 1021
221 Ga0495669_0067053 3300046684 Bacteria 1631
222 Ga0495686_0000022 3300047472 Bacteria 403456
223 Ga0495686_0000711 3300047472 Bacteria 44734
224 Ga0495686_0005677 3300047472 Bacteria 9761
225 Ga0496102_0058937 3300048905 Bacteria 3510
226 Ga0496113_0142681 3300048916 Bacteria 1885
227 Ga0496115_0004487 3300048918 Bacteria 10102
228 Ga0496116_0000027 3300048919 Bacteria 448077
229 Ga0496116_0000047 3300048919 Bacteria 315121
230 Ga0496117_0000021 3300048920 Bacteria 444168
231 Ga0496117_0000289 3300048920 Bacteria 90202
232 Ga0496118_0000531 3300048921 Bacteria 62520
233 Ga0496118_0115355 3300048921 Bacteria 1768
234 Ga0496118_0125679 3300048921 Bacteria 1661
235 Ga0496119_0000004 3300048922 Bacteria 536344
236 Ga0496121_0060393 3300048924 Bacteria 3118
237 Ga0496122_0000119 3300048925 Bacteria 182576
238 Ga0496122_0000344 3300048925 Bacteria 100498
239 Ga0496122_0006744 3300048925 Bacteria 13070
240 Ga0496122_0025014 3300048925 Bacteria 5205
241 Ga0496122_0072469 3300048925 Bacteria 2449
242 Ga0496122_0100355 3300048925 Bacteria 1937
243 Ga0496123_0003713 3300048926 Bacteria 16792
244 Ga0496123_0125693 3300048926 Bacteria 1432
245 Ga0496124_0000526 3300048927 Bacteria 65165
246 Ga0496124_0021551 3300048927 Bacteria 5936
247 Ga0496125_0000050 3300048928 Bacteria 286703
248 Ga0496125_0003293 3300048928 Bacteria 19812
249 Ga0496125_0252051 3300048928 Bacteria 1113
250 Ga0496126_0000744 3300048929 Bacteria 59025
251 Ga0496126_0021822 3300048929 Bacteria 6247
252 Ga0496126_0032721 3300048929 Bacteria 4896
253 Ga0496126_0183350 3300048929 Bacteria 1777
254 Ga0496126_0595637 3300048929 Bacteria 871
255 Ga0501238_001733 3300049671 Bacteria 2539
256 Ga0501240_000158 3300049673 Bacteria 4664
257 Ga0501249_000003 3300049679 Bacteria 242930
258 Ga0501225_0005776 3300049705 Bacteria 3623
259 Ga0501241_000226 3300049758 Bacteria 12650
260 Ga0501241_000458 3300049758 Bacteria 8858
261 Ga0501241_011259 3300049758 Bacteria 1624
262 Ga0501266_000005 3300049763 Bacteria 346750
263 Ga0501269_000572 3300049766 Bacteria 6897
264 Ga0501280_000320 3300049776 Bacteria 12083
265 nmdc:mga0k408_26_c4 3300050493 Bacteria 51744
266 Ga0500635_0000557 3300053080 Bacteria 9937
267 Ga0500651_0000283 3300053093 Bacteria 29820
268 Ga0500641_0000027 3300053096 Bacteria 106908
269 Ga0500641_0001122 3300053096 Bacteria 9518
270 Ga0500608_005314 3300053122 Bacteria 5103
271 Ga0500655_013033 3300053133 Bacteria 1515
272 Ga0500658_0000021 3300053134 Bacteria 133042
273 Ga0500559_0070000 3300053136 Bacteria 1578
274 Ga0500604_0000513 3300053151 Bacteria 10741
275 Ga0500616_0017920 3300053153 Bacteria 4010
276 Ga0500622_0000017 3300053156 Bacteria 332114
277 Ga0500622_0000065 3300053156 Bacteria 125090
278 Ga0500634_0093238 3300053161 Bacteria 1523
279 Ga0500584_027548 3300053726 Bacteria 2642

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10002165 Ga0157378_1000216513 218
2 3300046453 Ga0495627_000071 Ga0495627_000071_42141_43040 222
3 3300046530 Ga0495654_0000001 Ga0495654_0000001_39268_40167 222
4 3300047472 Ga0495686_0005677 Ga0495686_0005677_1448_2347 222
5 3300048929 Ga0496126_0000744 Ga0496126_0000744_56651_57535 222
6 iso_pu_bacteria 2772190705 2772605041 222
7 3300013308 Ga0157375_10005507 Ga0157375_100055078 224
8 3300039062 Ga0400483_225193 Ga0400483_225193_2232_3119 224
9 3300003316 rootH1_10127239 rootH1_101272391 225
10 3300017792 Ga0163161_10005084 Ga0163161_100050844 225
11 3300039062 Ga0400483_287766 Ga0400483_287766_733_1620 225
12 3300005288 Ga0065714_10064825 Ga0065714_100648254 227
13 3300031911 Ga0307412_10016906 Ga0307412_100169065 228
14 3300048925 Ga0496122_0100355 Ga0496122_0100355_23_922 228
15 3300049758 Ga0501241_000458 Ga0501241_000458_3205_4104 228
16 3300005337 Ga0070682_100000371 Ga0070682_10000037114 229
17 3300005455 Ga0070663_100208444 Ga0070663_1002084442 229
18 3300013104 Ga0157370_10084497 Ga0157370_100844972 229
19 3300046538 Ga0495609_0000060 Ga0495609_0000060_78395_79279 229
20 3300003323 rootH1_10288399 rootH1_102883993 230
21 3300013104 Ga0157370_10171864 Ga0157370_101718642 230
22 3300015261 Ga0182006_1000015 Ga0182006_1000015192 230
23 3300031824 Ga0307413_10154380 Ga0307413_101543802 230
24 3300038741 Ga0400488_27672 Ga0400488_27672_748_1566 230
25 3300046660 Ga0495625_0000252 Ga0495625_0000252_9199_10065 230
26 3300048905 Ga0496102_0058937 Ga0496102_0058937_1662_2546 231
27 3300048916 Ga0496113_0142681 Ga0496113_0142681_887_1771 231
28 3300048920 Ga0496117_0000021 Ga0496117_0000021_184804_185688 231
29 3300048921 Ga0496118_0000531 Ga0496118_0000531_4625_5509 231
30 3300048922 Ga0496119_0000004 Ga0496119_0000004_258492_259376 231
31 3300048925 Ga0496122_0000344 Ga0496122_0000344_2142_3026 231
32 3300048926 Ga0496123_0003713 Ga0496123_0003713_2135_3019 231
33 3300006942 Ga0099824_1009165 Ga0099824_100916510 232
34 3300006948 Ga0099826_10126459 Ga0099826_101264593 232
35 3300027361 Ga0209489_118300 Ga0209489_1183003 232
36 3300027666 Ga0209282_1099840 Ga0209282_10998401 232
37 3300042004 Ga0439445_0000019 Ga0439445_0000019_8419_9318 233
38 3300046512 Ga0495610_0000001 Ga0495610_0000001_608788_609687 233
39 3300038735 Ga0400485_21141 Ga0400485_21141_3188_4075 234
40 3300038741 Ga0400488_48565 Ga0400488_48565_1397_2284 234
41 3300039062 Ga0400483_218339 Ga0400483_218339_1859_2746 234
42 3300039093 Ga0400489_25329 Ga0400489_25329_4349_5236 234
43 3300046500 Ga0495596_0005913 Ga0495596_0005913_465_1349 234
44 3300053136 Ga0500559_0070000 Ga0500559_0070000_740_1567 234
45 3300003322 rootL2_10340571 rootL2_103405712 235
46 3300013102 Ga0157371_10000113 Ga0157371_1000011374 235
47 3300032004 Ga0307414_10000188 Ga0307414_1000018812 235
48 3300039110 Ga0400487_18983 Ga0400487_18983_243_1157 235
49 3300048919 Ga0496116_0000027 Ga0496116_0000027_260560_261444 235
50 3300048924 Ga0496121_0060393 Ga0496121_0060393_1956_2840 235
51 3300048927 Ga0496124_0000526 Ga0496124_0000526_34070_34954 235
52 3300005288 Ga0065714_10064675 Ga0065714_100646754 236
53 3300005293 Ga0065715_10162879 Ga0065715_101628791 236
54 3300013104 Ga0157370_10037857 Ga0157370_100378574 236
55 3300017792 Ga0163161_10001683 Ga0163161_100016838 236
56 3300038725 Ga0400484_31673 Ga0400484_31673_11616_12503 236
57 3300048929 Ga0496126_0595637 Ga0496126_0595637_20_850 236
58 3300017792 Ga0163161_10000007 Ga0163161_10000007184 237
59 3300009036 Ga0105244_10000069 Ga0105244_100000699 238
60 3300025728 Ga0207655_1000492 Ga0207655_10004927 238
61 3300038726 Ga0400490_10968 Ga0400490_10968_417_1304 238
62 3300039062 Ga0400483_243678 Ga0400483_243678_831_1718 238
63 3300046558 Ga0495633_0060219 Ga0495633_0060219_521_1387 238
64 3300048918 Ga0496115_0004487 Ga0496115_0004487_8532_9404 238
65 3300048920 Ga0496117_0000289 Ga0496117_0000289_73972_74841 238
66 3300048921 Ga0496118_0115355 Ga0496118_0115355_693_1562 238
67 3300048925 Ga0496122_0025014 Ga0496122_0025014_4236_5105 238
68 3300048928 Ga0496125_0003293 Ga0496125_0003293_18675_19547 238
69 3300048929 Ga0496126_0021822 Ga0496126_0021822_13_885 238
70 3300017792 Ga0163161_10036912 Ga0163161_100369122 239
71 3300005288 Ga0065714_10107213 Ga0065714_101072132 240
72 3300006946 Ga0079104_1000179 Ga0079104_100017944 240
73 3300017792 Ga0163161_10036674 Ga0163161_100366742 240
74 3300027111 Ga0209281_1000116 Ga0209281_1000116100 240
75 3300032002 Ga0307416_100000004 Ga0307416_100000004307 240
76 3300046660 Ga0495625_0071722 Ga0495625_0071722_601_1476 240
77 3300049679 Ga0501249_000003 Ga0501249_000003_49740_50627 240
78 3300053096 Ga0500641_0001122 Ga0500641_0001122_4427_5305 240
79 3300002773 JGI25152J39213_1000119 JGI25152J39213_100011927 241
80 3300002774 JGI25150J39212_1000015 JGI25150J39212_100001573 241
81 3300003187 JGI25151J46595_10000043 JGI25151J46595_1000004360 241
82 3300003215 JGI25153J46596_10000009 JGI25153J46596_10000009214 241
83 3300005329 Ga0070683_100004947 Ga0070683_1000049477 241
84 3300005535 Ga0070684_100008696 Ga0070684_1000086968 241
85 3300013104 Ga0157370_10001033 Ga0157370_100010339 241
86 3300013308 Ga0157375_10000065 Ga0157375_1000006593 241
87 3300025245 Ga0207425_1000023 Ga0207425_1000023212 241
88 3300025258 Ga0209129_1000032 Ga0209129_100003260 241
89 3300025294 Ga0209025_1000047 Ga0209025_100004760 241
90 3300025297 Ga0209758_1000144 Ga0209758_100014470 241
91 3300025909 Ga0207705_10141346 Ga0207705_101413462 241
92 3300025944 Ga0207661_10008472 Ga0207661_100084722 241
93 3300031911 Ga0307412_10000019 Ga0307412_10000019226 241
94 3300032004 Ga0307414_10112780 Ga0307414_101127802 241
95 3300037312 Ga0395899_0000002 Ga0395899_0000002_218374_219213 241
96 3300039062 Ga0400483_009196 Ga0400483_009196_596_1486 241
97 3300039062 Ga0400483_161991 Ga0400483_161991_503_1393 241
98 3300046453 Ga0495627_012216 Ga0495627_012216_584_1483 241
99 3300046519 Ga0495632_0008958 Ga0495632_0008958_596_1495 241
100 3300046558 Ga0495633_0009982 Ga0495633_0009982_1125_2024 241
101 3300046660 Ga0495625_0000970 Ga0495625_0000970_25917_26816 241
102 3300047472 Ga0495686_0000022 Ga0495686_0000022_313229_314128 241
103 3300048921 Ga0496118_0125679 Ga0496118_0125679_509_1408 241
104 3300048926 Ga0496123_0125693 Ga0496123_0125693_459_1343 241
105 3300048929 Ga0496126_0183350 Ga0496126_0183350_835_1716 241
106 3300003316 rootH1_10182401 rootH1_101824011 242
107 3300038725 Ga0400484_12496 Ga0400484_12496_3971_4861 242
108 3300005288 Ga0065714_10115537 Ga0065714_101155372 243
109 3300005563 Ga0068855_100013194 Ga0068855_1000131945 243
110 3300009036 Ga0105244_10113895 Ga0105244_101138951 243
111 3300009093 Ga0105240_10005314 Ga0105240_100053145 243
112 3300013102 Ga0157371_10076856 Ga0157371_100768561 243
113 3300025913 Ga0207695_10004439 Ga0207695_100044394 243
114 3300028794 Ga0307515_10321294 Ga0307515_103212942 243
115 3300038726 Ga0400490_05022 Ga0400490_05022_10737_11624 243
116 3300038735 Ga0400485_09249 Ga0400485_09249_1382_2269 243
117 3300038741 Ga0400488_55988 Ga0400488_55988_781_1668 243
118 3300046507 Ga0495606_0000478 Ga0495606_0000478_38872_39735 243
119 3300049758 Ga0501241_000226 Ga0501241_000226_11755_12621 243
120 iso_pu_bacteria 2911138879 2911141247 243
121 3300009551 Ga0105238_10137072 Ga0105238_101370723 244
122 3300010375 Ga0105239_10000006 Ga0105239_10000006221 244
123 3300035398 Ga0316574_0104656 Ga0316574_0104656_900_1781 244
124 3300005293 Ga0065715_10297305 Ga0065715_102973051 245
125 3300013104 Ga0157370_10000172 Ga0157370_1000017225 245
126 3300025914 Ga0207671_10010163 Ga0207671_100101634 245
127 3300032004 Ga0307414_10369120 Ga0307414_103691201 245
128 3300048929 Ga0496126_0032721 Ga0496126_0032721_2212_3087 245
129 3300049766 Ga0501269_000572 Ga0501269_000572_3982_4881 245
130 3300013102 Ga0157371_10150649 Ga0157371_101506491 246
131 3300035398 Ga0316574_0219248 Ga0316574_0219248_226_1113 246
132 3300046558 Ga0495633_0000626 Ga0495633_0000626_9051_9917 246
133 3300003322 rootL2_10278768 rootL2_102787682 247
134 3300005288 Ga0065714_10138697 Ga0065714_101386972 247
135 3300006195 Ga0075366_10000026 Ga0075366_1000002623 247
136 3300013306 Ga0163162_10006470 Ga0163162_100064705 247
137 3300015261 Ga0182006_1001684 Ga0182006_10016847 247
138 3300025291 Ga0209675_1000042 Ga0209675_100004220 247
139 3300028794 Ga0307515_10006038 Ga0307515_1000603819 247
140 3300046684 Ga0495669_0067053 Ga0495669_0067053_634_1500 247
141 3300048925 Ga0496122_0006744 Ga0496122_0006744_1343_2227 247
142 3300050493 nmdc:mga0k408_26_c4 nmdc:mga0k408_26_c4_20918_21784 247
143 3300003323 rootH1_10020336 rootH1_100203369 248
144 3300003781 Ga0055536_1000024 Ga0055536_100002468 248
145 3300013296 Ga0157374_10019166 Ga0157374_100191662 248
146 3300014497 Ga0182008_10028564 Ga0182008_100285642 248
147 3300015261 Ga0182006_1014721 Ga0182006_10147215 248
148 3300025292 Ga0209676_1000008 Ga0209676_1000008203 248
149 3300025298 Ga0209050_1000055 Ga0209050_1000055209 248
150 3300030744 Ga0316181_1059316 Ga0316181_10593162 248
151 3300031824 Ga0307413_10042015 Ga0307413_100420152 248
152 3300003791 Ga0055530_10003260 Ga0055530_100032604 249
153 3300013307 Ga0157372_10649785 Ga0157372_106497851 249
154 3300015682 Ga0183373_1020 Ga0183373_10202 250
155 3300017792 Ga0163161_10103227 Ga0163161_101032273 250
156 3300031903 Ga0307407_10052057 Ga0307407_100520572 250
157 3300031995 Ga0307409_100220616 Ga0307409_1002206161 250
158 3300032002 Ga0307416_100214795 Ga0307416_1002147951 250
159 3300032004 Ga0307414_10191723 Ga0307414_101917231 250
160 3300046558 Ga0495633_0000018 Ga0495633_0000018_43928_44827 250
161 iso_pu_bacteria 646564506 646814477 250
162 3300005288 Ga0065714_10022743 Ga0065714_100227432 251
163 3300005614 Ga0068856_100298232 Ga0068856_1002982322 251
164 3300013100 Ga0157373_10015051 Ga0157373_100150515 251
165 3300013104 Ga0157370_10004730 Ga0157370_100047309 251
166 3300013104 Ga0157370_10012803 Ga0157370_100128037 251
167 3300013105 Ga0157369_10011448 Ga0157369_100114482 251
168 3300013105 Ga0157369_10180954 Ga0157369_101809541 251
169 3300013307 Ga0157372_10146742 Ga0157372_101467424 251
170 3300015261 Ga0182006_1021108 Ga0182006_10211082 251
171 3300015262 Ga0182007_10030781 Ga0182007_100307811 251
172 3300017792 Ga0163161_10080967 Ga0163161_100809672 251
173 3300026078 Ga0207702_10371101 Ga0207702_103711012 251
174 3300031731 Ga0307405_10048274 Ga0307405_100482741 251
175 3300046512 Ga0495610_0015728 Ga0495610_0015728_422_1288 251
176 3300047472 Ga0495686_0000711 Ga0495686_0000711_29704_30567 251
177 3300048927 Ga0496124_0021551 Ga0496124_0021551_1238_2113 251
178 3300048928 Ga0496125_0000050 Ga0496125_0000050_63902_64777 251
179 3300048928 Ga0496125_0252051 Ga0496125_0252051_12_881 251
180 3300053161 Ga0500634_0093238 Ga0500634_0093238_192_1058 251
181 iso_pu_bacteria 2818991437 2819546968 251
182 3300013102 Ga0157371_10036425 Ga0157371_100364252 252
183 3300013105 Ga0157369_10521953 Ga0157369_105219531 252
184 3300035398 Ga0316574_0004177 Ga0316574_0004177_258_1139 252
185 iso_pu_bacteria 2919186247 2919186657 252
186 iso_pu_bacteria 2939664404 2939666073 252
187 3300005548 Ga0070665_100418664 Ga0070665_1004186642 253
188 3300009148 Ga0105243_10000008 Ga0105243_10000008273 253
189 3300013100 Ga0157373_10007425 Ga0157373_100074255 253
190 3300025935 Ga0207709_10000006 Ga0207709_10000006205 253
191 3300028379 Ga0268266_10365539 Ga0268266_103655392 253
192 3300048925 Ga0496122_0072469 Ga0496122_0072469_1305_2228 253
193 3300053080 Ga0500635_0000557 Ga0500635_0000557_5821_6687 253
194 iso_pu_bacteria 2857613821 2857614555 253
195 iso_pu_bacteria 2904419702 2904419843 253
196 3300005288 Ga0065714_10073153 Ga0065714_100731531 254
197 3300048919 Ga0496116_0000047 Ga0496116_0000047_251208_252092 254
198 iso_pu_bacteria 2884634485 2884637210 254
199 iso_pu_bacteria 2896317667 2896321279 254
200 iso_pu_bacteria 2904555929 2904556630 254
201 3300003320 rootH2_10179811 rootH2_101798112 255
202 3300005288 Ga0065714_10066564 Ga0065714_100665646 255
203 3300013100 Ga0157373_10000002 Ga0157373_1000000260 255
204 3300013104 Ga0157370_10003309 Ga0157370_100033098 255
205 3300015261 Ga0182006_1001701 Ga0182006_10017013 255
206 3300031727 Ga0316576_10027540 Ga0316576_100275405 255
207 3300031728 Ga0316578_10034450 Ga0316578_100344502 255
208 3300031728 Ga0316578_10167820 Ga0316578_101678202 255
209 3300032004 Ga0307414_10000306 Ga0307414_100003068 255
210 3300032133 Ga0316583_10057642 Ga0316583_100576422 255
211 3300035398 Ga0316574_0026997 Ga0316574_0026997_1881_2762 255
212 3300036647 Ga0316582_0086171 Ga0316582_0086171_550_1431 255
213 3300036712 Ga0316584_0005980 Ga0316584_0005980_6088_6969 255
214 3300046558 Ga0495633_0000039 Ga0495633_0000039_75929_76792 255
215 iso_pu_bacteria 2513020052 2513234433 255
216 iso_pu_bacteria 2643221716 2644642306 255
217 3300017792 Ga0163161_10029458 Ga0163161_100294582 256
218 3300031548 Ga0307408_100002894 Ga0307408_1000028945 256
219 3300031731 Ga0307405_10031372 Ga0307405_100313723 256
220 3300031852 Ga0307410_10000115 Ga0307410_1000011519 256
221 3300031901 Ga0307406_10000111 Ga0307406_1000011119 256
222 3300031901 Ga0307406_10056370 Ga0307406_100563702 256
223 3300031903 Ga0307407_10008551 Ga0307407_100085511 256
224 3300031911 Ga0307412_10080842 Ga0307412_100808422 256
225 3300031995 Ga0307409_100074848 Ga0307409_1000748482 256
226 3300032002 Ga0307416_100002085 Ga0307416_1000020853 256
227 3300032004 Ga0307414_10000001 Ga0307414_10000001787 256
228 3300032126 Ga0307415_100074590 Ga0307415_1000745902 256
229 3300041411 Ga0439466_0002554 Ga0439466_0002554_5162_6034 256
230 3300049671 Ga0501238_001733 Ga0501238_001733_1288_2160 256
231 3300049758 Ga0501241_011259 Ga0501241_011259_734_1606 256
232 3300049776 Ga0501280_000320 Ga0501280_000320_818_1690 256
233 3300053096 Ga0500641_0000027 Ga0500641_0000027_45222_46112 256
234 3300053156 Ga0500622_0000017 Ga0500622_0000017_301246_302166 256
235 3300053726 Ga0500584_027548 Ga0500584_027548_1680_2570 256
236 iso_pu_bacteria 2904780799 2904784422 256
237 iso_pu_bacteria 2919177583 2919178953 256
238 iso_pu_bacteria 8054307821 8054308210 256
239 iso_pu_bacteria 8056440228 8056442213 256
240 3300005289 Ga0065704_10073246 Ga0065704_100732466 257
241 3300005347 Ga0070668_100075482 Ga0070668_1000754822 257
242 3300009036 Ga0105244_10000004 Ga0105244_10000004360 257
243 3300009148 Ga0105243_10002193 Ga0105243_100021936 257
244 3300025728 Ga0207655_1000008 Ga0207655_1000008228 257
245 3300025935 Ga0207709_10001031 Ga0207709_1000103110 257
246 3300025972 Ga0207668_10170309 Ga0207668_101703092 257
247 3300048925 Ga0496122_0000119 Ga0496122_0000119_147843_148724 257
248 iso_pu_bacteria 2519899754 2520878839 257
249 iso_pu_bacteria 2585427687 2586211188 257
250 iso_pu_bacteria 2643221600 2644011449 257
251 iso_pu_bacteria 2643221667 2644369852 257
252 iso_pu_bacteria 2643221725 2644685243 257
253 iso_pu_bacteria 2738541279 2738731960 257
254 iso_pu_bacteria 2738541285 2738764525 257
255 iso_pu_bacteria 2738543007 2739213540 257
256 iso_pu_bacteria 2739367651 2739586538 257
257 iso_pu_bacteria 2739367663 2739647959 257
258 iso_pu_bacteria 2739367857 2740000808 257
259 iso_pu_bacteria 2739367858 2740005624 257
260 iso_pu_bacteria 2802428842 2802654157 257
261 iso_pu_bacteria 2816332280 2817415818 257
262 iso_pu_bacteria 2818991437 2819550427 257
263 iso_pu_bacteria 2833640130 2833640275 257
264 iso_pu_bacteria 2842722452 2842727847 257
265 iso_pu_bacteria 2842909656 2842914984 257
266 iso_pu_bacteria 2849281842 2849287099 257
267 iso_pu_bacteria 2857618242 2857619062 257
268 iso_pu_bacteria 2857627736 2857630219 257
269 iso_pu_bacteria 2881359912 2881360462 257
270 iso_pu_bacteria 2896344016 2896344820 257
271 iso_pu_bacteria 2902048731 2902051502 257
272 iso_pu_bacteria 2903895155 2903898606 257
273 iso_pu_bacteria 2904445276 2904449884 257
274 iso_pu_bacteria 2919191525 2919194042 257
275 iso_pu_bacteria 2919683626 2919685788 257
276 iso_pu_bacteria 2919692658 2919696392 257
277 iso_pu_bacteria 2929150217 2929153059 257
278 iso_pu_bacteria 2945997725 2946002457 257
279 iso_pu_bacteria 2954016120 2954021816 257
280 iso_pu_bacteria 2958458903 2958460884 257
281 iso_pu_bacteria 2977232053 2977236623 257
282 iso_pu_bacteria 2977268062 2977269726 257
283 iso_pu_bacteria 8055419101 8055421495 257
284 iso_pu_bacteria 8055592153 8055594032 257
285 3300031548 Ga0307408_100001531 Ga0307408_10000153111 258
286 3300031548 Ga0307408_100003112 Ga0307408_10000311212 258
287 3300031548 Ga0307408_100025183 Ga0307408_1000251832 258
288 3300053151 Ga0500604_0000513 Ga0500604_0000513_306_1175 258
289 3300053156 Ga0500622_0000065 Ga0500622_0000065_97830_98699 258
290 iso_pu_bacteria 2511231000 2511232696 258
291 iso_pu_bacteria 2582581278 2585145640 258
292 iso_pu_bacteria 2582581281 2585158748 258
293 iso_pu_bacteria 2582581282 2585163036 258
294 iso_pu_bacteria 2582581873 2585425501 258
295 iso_pu_bacteria 2585428045 2587681152 258
296 iso_pu_bacteria 2585428060 2587745645 258
297 iso_pu_bacteria 2585428115 2587943644 258
298 iso_pu_bacteria 2585428182 2588209034 258
299 iso_pu_bacteria 2585428183 2588216199 258
300 iso_pu_bacteria 2585428184 2588220489 258
301 iso_pu_bacteria 2585428185 2588225206 258
302 iso_pu_bacteria 2585428187 2588234115 258
303 iso_pu_bacteria 2588253712 2588445568 258
304 iso_pu_bacteria 2588254255 2590602456 258
305 iso_pu_bacteria 2588254257 2590611178 258
306 iso_pu_bacteria 2728369107 2729202177 258
307 iso_pu_bacteria 2738541302 2738856871 258
308 iso_pu_bacteria 2738543023 2739304649 258
309 iso_pu_bacteria 2739367656 2739617667 258
310 iso_pu_bacteria 2751185877 2753671822 258
311 iso_pu_bacteria 2765235839 2765576746 258
312 iso_pu_bacteria 2775506739 2775673512 258
313 iso_pu_bacteria 2816332188 2816872046 258
314 iso_pu_bacteria 2842083920 2842085801 258
315 iso_pu_bacteria 2842903701 2842904654 258
316 iso_pu_bacteria 2871720351 2871720931 258
317 iso_pu_bacteria 2889290771 2889292793 258
318 iso_pu_bacteria 2905999023 2906002464 258
319 iso_pu_bacteria 2914759650 2914762904 258
320 iso_pu_bacteria 2919097161 2919097619 258
321 iso_pu_bacteria 2919399522 2919400926 258
322 iso_pu_bacteria 2929154850 2929159802 258
323 iso_pu_bacteria 2945924605 2945926783 258
324 iso_pu_bacteria 2946019816 2946020471 258
325 iso_pu_bacteria 2958512119 2958512177 258
326 iso_pu_bacteria 2977243572 2977246904 258
327 iso_pu_bacteria 2984572630 2984575242 258
328 iso_pu_bacteria 2984606641 2984608695 258
329 iso_pu_bacteria 2993372514 2993374186 258
330 iso_pu_bacteria 2993480792 2993481087 258
331 3300046453 Ga0495627_001392 Ga0495627_001392_4920_5789 259
332 3300049763 Ga0501266_000005 Ga0501266_000005_38773_39663 259
333 3300053134 Ga0500658_0000021 Ga0500658_0000021_116566_117456 259
334 3300005293 Ga0065715_10102814 Ga0065715_101028141 260
335 3300032004 Ga0307414_10056447 Ga0307414_100564472 260
336 3300032005 Ga0307411_10000013 Ga0307411_1000001357 260
337 3300049673 Ga0501240_000158 Ga0501240_000158_1118_1981 260
338 3300013306 Ga0163162_10021458 Ga0163162_100214584 261
339 3300013306 Ga0163162_10160580 Ga0163162_101605801 261
340 3300026035 Ga0207703_10067722 Ga0207703_100677222 261
341 3300028786 Ga0307517_10002529 Ga0307517_100025297 261
342 3300046500 Ga0495596_0009684 Ga0495596_0009684_540_1406 261
343 3300046519 Ga0495632_0024380 Ga0495632_0024380_833_1699 261
344 3300046660 Ga0495625_0303466 Ga0495625_0303466_38_904 261
345 3300053122 Ga0500608_005314 Ga0500608_005314_207_1073 261
346 2162886007 SwRhRL2b_contig_900766 SwRhRL2b_0592.00012360 262
347 3300003320 rootH2_10058921 rootH2_100589212 262
348 3300003322 rootL2_10067677 rootL2_100676771 262
349 3300003323 rootH1_10033648 rootH1_100336486 262
350 3300005262 Ga0065165_1001168 Ga0065165_100116820 262
351 3300005288 Ga0065714_10004609 Ga0065714_1000460914 262
352 3300005289 Ga0065704_10000199 Ga0065704_10000199252 262
353 3300005289 Ga0065704_10107453 Ga0065704_101074532 262
354 3300013100 Ga0157373_10000015 Ga0157373_1000001556 262
355 3300014325 Ga0163163_10700542 Ga0163163_107005421 262
356 3300014969 Ga0157376_10112232 Ga0157376_101122323 262
357 3300015261 Ga0182006_1006894 Ga0182006_10068942 262
358 3300017792 Ga0163161_10010556 Ga0163161_100105565 262
359 3300030732 Ga0316176_1023444 Ga0316176_102344411 262
360 3300030742 Ga0316183_1145092 Ga0316183_114509224 262
361 3300030744 Ga0316181_1014202 Ga0316181_101420224 262
362 3300031727 Ga0316576_10104030 Ga0316576_101040301 262
363 3300031728 Ga0316578_10043684 Ga0316578_100436842 262
364 3300031911 Ga0307412_10000033 Ga0307412_10000033163 262
365 3300032004 Ga0307414_10037590 Ga0307414_100375902 262
366 3300035398 Ga0316574_0001086 Ga0316574_0001086_7260_8156 262
367 3300046507 Ga0495606_0036455 Ga0495606_0036455_1361_2245 262
368 3300046507 Ga0495606_0081534 Ga0495606_0081534_1007_1894 262
369 3300046522 Ga0495643_0000452 Ga0495643_0000452_9934_10812 262
370 3300046660 Ga0495625_0011561 Ga0495625_0011561_5598_6476 262
371 3300049705 Ga0501225_0005776 Ga0501225_0005776_1155_2027 262
372 3300053093 Ga0500651_0000283 Ga0500651_0000283_989_1858 262
373 3300053133 Ga0500655_013033 Ga0500655_013033_596_1468 262
374 3300053153 Ga0500616_0017920 Ga0500616_0017920_1335_2207 262
375 iso_pu_bacteria 2739367874 2740061337 262
376 iso_pu_bacteria 2818991444 2819585532 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05661

DUF808

Protein of unknown function (DUF808)

16

303

0.9

Feature Viewer

pLDDT pTM Quality
61.51 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map