F427430

General Info

Members Datasets Scaffolds Average Seq Length
376 232 752 110

Family's Representative Sequence

Representative Sequence 3300042122|Ga0450920_011897|Ga0450920_011897_781_1122
Length 105
Sequence LAAVVVRFVLWSLADSKTSVAELRRYLADEAVDRFAEVEGLRFKAWWGAIYVWESAEAAQQELPGRARQLIGKDPDIGEEFDVEATVEGHFDVEQLSRLGLAFER

Samples

Sample ID Description Type Environment
1 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
113 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
114 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
115 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
116 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
139 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
149 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
157 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 9.04
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 20.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450920_011897 3300042122 Bacteria 1627
2 JGI25407J50210_10009158 3300003373 Bacteria 2504
3 JGI25405J52794_10058979 3300003911 Bacteria 828
4 Ga0070683_100067188 3300005329 Archaea 3339
5 Ga0070682_100670169 3300005337 Bacteria 828
6 Ga0068868_101478267 3300005338 Unclassified 635
7 Ga0070691_10333456 3300005341 Bacteria 838
8 Ga0070687_101467044 3300005343 Unclassified 512
9 Ga0070661_100666152 3300005344 Unclassified 846
10 Ga0070673_100144766 3300005364 Unclassified 2008
11 Ga0070659_100619919 3300005366 Unclassified 931
12 Ga0070703_10009074 3300005406 Bacteria 2804
13 Ga0070709_10024099 3300005434 Bacteria 3580
14 Ga0070709_10290316 3300005434 Bacteria 1191
15 Ga0070714_102389604 3300005435 Unclassified 514
16 Ga0070710_10001255 3300005437 Bacteria 12044
17 Ga0070711_100095038 3300005439 Bacteria 2156
18 Ga0070711_101540435 3300005439 Unclassified 580
19 Ga0070705_100125593 3300005440 Bacteria 1664
20 Ga0070705_100645535 3300005440 Unclassified 825
21 Ga0070700_100001464 3300005441 Bacteria 11741
22 Ga0070694_100005290 3300005444 Bacteria 7805
23 Ga0070708_100131386 3300005445 Bacteria 2317
24 Ga0070678_100234836 3300005456 Bacteria 1530
25 Ga0070678_100906792 3300005456 Unclassified 806
26 Ga0070706_100035153 3300005467 Bacteria 4627
27 Ga0070706_100082924 3300005467 Bacteria 2970
28 Ga0070707_100002173 3300005468 Bacteria 18762
29 Ga0070698_100651402 3300005471 Bacteria 994
30 Ga0070699_100154200 3300005518 Unclassified 2032
31 Ga0070699_100407089 3300005518 Bacteria 1230
32 Ga0070699_101017693 3300005518 Unclassified 760
33 Ga0070699_101694291 3300005518 Unclassified 579
34 Ga0070679_100841231 3300005530 Bacteria 861
35 Ga0070684_100001921 3300005535 Bacteria 15248
36 Ga0070684_100011940 3300005535 Bacteria 6938
37 Ga0070697_100174845 3300005536 Unclassified 1818
38 Ga0070697_100590322 3300005536 Bacteria 976
39 Ga0070697_100830916 3300005536 Unclassified 818
40 Ga0070672_100002647 3300005543 Bacteria 11435
41 Ga0070695_100022048 3300005545 Bacteria 3903
42 Ga0070695_100173462 3300005545 Bacteria 1523
43 Ga0070695_101517929 3300005545 Bacteria 558
44 Ga0070696_100062764 3300005546 Bacteria 2601
45 Ga0070696_100118446 3300005546 Bacteria 1914
46 Ga0070704_100263487 3300005549 Unclassified 1421
47 Ga0070704_100408131 3300005549 Bacteria 1161
48 Ga0070704_101542978 3300005549 Bacteria 611
49 Ga0070704_102022198 3300005549 Bacteria 535
50 Ga0068855_100209018 3300005563 Bacteria 2194
51 Ga0068857_100001430 3300005577 Bacteria 18914
52 Ga0068857_100049526 3300005577 Bacteria 3727
53 Ga0068857_100122869 3300005577 Bacteria 2339
54 Ga0068856_101668915 3300005614 Bacteria 650
55 Ga0070702_100008330 3300005615 Bacteria 5016
56 Ga0070702_100517271 3300005615 Bacteria 879
57 Ga0068852_100063229 3300005616 Bacteria 3222
58 Ga0068866_10008563 3300005718 Bacteria 4317
59 Ga0068861_100150742 3300005719 Bacteria 1908
60 Ga0068870_10333177 3300005840 Bacteria 968
61 Ga0068863_100759275 3300005841 Bacteria 966
62 Ga0068860_100056947 3300005843 Bacteria 3715
63 Ga0068862_100647475 3300005844 Bacteria 1019
64 Ga0081455_10006181 3300005937 Bacteria 12915
65 Ga0081455_10006261 3300005937 Bacteria 12806
66 Ga0081455_10106005 3300005937 Bacteria 2245
67 Ga0081455_10136415 3300005937 Bacteria 1911
68 Ga0081455_10466952 3300005937 Bacteria 858
69 Ga0081538_10000184 3300005981 Bacteria 68601
70 Ga0081538_10008247 3300005981 Bacteria 8876
71 Ga0081538_10162435 3300005981 Unclassified 990
72 Ga0081538_10365616 3300005981 Bacteria 521
73 Ga0081538_10373038 3300005981 Unclassified 515
74 Ga0081540_1010792 3300005983 Bacteria 6141
75 Ga0075364_11207382 3300006051 Unclassified 513
76 Ga0075432_10106378 3300006058 Bacteria 1041
77 Ga0075432_10226344 3300006058 Bacteria 750
78 Ga0070715_10454767 3300006163 Unclassified 724
79 Ga0070712_100073043 3300006175 Bacteria 2459
80 Ga0075428_100180827 3300006844 Bacteria 2283
81 Ga0075428_100285165 3300006844 Bacteria 1777
82 Ga0075428_100440506 3300006844 Unclassified 1396
83 Ga0075428_102077372 3300006844 Unclassified 588
84 Ga0075430_100672605 3300006846 Bacteria 853
85 Ga0075431_100019160 3300006847 Bacteria 6973
86 Ga0075431_101028970 3300006847 Bacteria 790
87 Ga0075431_101233010 3300006847 Unclassified 710
88 Ga0075433_10051316 3300006852 Bacteria 3591
89 Ga0075433_10085043 3300006852 Bacteria 2792
90 Ga0075434_100281252 3300006871 Bacteria 1683
91 Ga0068865_100008685 3300006881 Bacteria 6283
92 Ga0068865_100846609 3300006881 Unclassified 792
93 Ga0075436_100071837 3300006914 Bacteria 2393
94 Ga0075436_100573628 3300006914 Bacteria 830
95 Ga0075435_100021661 3300007076 Bacteria 4947
96 Ga0075435_101065266 3300007076 Unclassified 706
97 Ga0111539_10013906 3300009094 Bacteria 10063
98 Ga0111539_10044831 3300009094 Bacteria 5295
99 Ga0111539_10054253 3300009094 Bacteria 4770
100 Ga0111539_10431683 3300009094 Bacteria 1534
101 Ga0111539_11173925 3300009094 Bacteria 892
102 Ga0105245_10790192 3300009098 Bacteria 987
103 Ga0105245_11261441 3300009098 Unclassified 787
104 Ga0114129_10080297 3300009147 Bacteria 4533
105 Ga0114129_10242792 3300009147 Unclassified 2421
106 Ga0114129_12049523 3300009147 Unclassified 691
107 Ga0114129_12111729 3300009147 Bacteria 679
108 Ga0114129_12307143 3300009147 Bacteria 646
109 Ga0114129_12628518 3300009147 Bacteria 600
110 Ga0105243_10303833 3300009148 Bacteria 1447
111 Ga0105243_10679860 3300009148 Bacteria 1001
112 Ga0105243_11943815 3300009148 Bacteria 622
113 Ga0105242_10127099 3300009176 Bacteria 2195
114 Ga0105242_12303988 3300009176 Unclassified 585
115 Ga0105248_10778690 3300009177 Bacteria 1080
116 Ga0105238_10082898 3300009551 Bacteria 3196
117 Ga0105249_10035565 3300009553 Bacteria 4517
118 Ga0157314_1034874 3300012500 Bacteria 583
119 Ga0157373_10917927 3300013100 Unclassified 650
120 Ga0157374_10009159 3300013296 Bacteria 8485
121 Ga0157378_10040250 3300013297 Bacteria 4144
122 Ga0157378_10922069 3300013297 Bacteria 905
123 Ga0163162_10004499 3300013306 Bacteria 13428
124 Ga0157375_13444693 3300013308 Unclassified 527
125 Ga0163163_10605330 3300014325 Bacteria 1159
126 Ga0157380_13274293 3300014326 Unclassified 518
127 Ga0157377_10007703 3300014745 Bacteria 5218
128 Ga0157376_10842272 3300014969 Bacteria 932
129 Ga0157376_10931040 3300014969 Bacteria 889
130 Ga0207653_10169494 3300025885 Bacteria 812
131 Ga0207692_10020918 3300025898 Bacteria 2986
132 Ga0207692_10351943 3300025898 Bacteria 908
133 Ga0207685_10129938 3300025905 Bacteria 1117
134 Ga0207699_10047834 3300025906 Unclassified 2509
135 Ga0207643_10412129 3300025908 Bacteria 856
136 Ga0207684_10096775 3300025910 Bacteria 2519
137 Ga0207671_10099318 3300025914 Bacteria 2203
138 Ga0207693_10002108 3300025915 Bacteria 17353
139 Ga0207663_10299707 3300025916 Unclassified 1200
140 Ga0207662_11063646 3300025918 Unclassified 575
141 Ga0207657_10017047 3300025919 Bacteria 6986
142 Ga0207649_10764717 3300025920 Unclassified 752
143 Ga0207646_10001950 3300025922 Bacteria 24757
144 Ga0207700_11447986 3300025928 Bacteria 610
145 Ga0207690_10700750 3300025932 Unclassified 832
146 Ga0207686_10724524 3300025934 Bacteria 792
147 Ga0207709_10449170 3300025935 Bacteria 996
148 Ga0207665_10030446 3300025939 Bacteria 3566
149 Ga0207665_11542138 3300025939 Unclassified 527
150 Ga0207661_10013023 3300025944 Bacteria 6069
151 Ga0207661_10021215 3300025944 Bacteria 4867
152 Ga0207679_11364441 3300025945 Unclassified 650
153 Ga0207651_10143962 3300025960 Unclassified 1845
154 Ga0207640_10439092 3300025981 Bacteria 1073
155 Ga0207708_10000811 3300026075 Bacteria 23480
156 Ga0207702_10819397 3300026078 Bacteria 920
157 Ga0207641_10370270 3300026088 Unclassified 1370
158 Ga0207674_10007738 3300026116 Bacteria 12506
159 Ga0207674_10051800 3300026116 Bacteria 4188
160 Ga0207674_10095162 3300026116 Archaea 2965
161 Ga0207683_10022052 3300026121 Bacteria 5464
162 Ga0207698_10036695 3300026142 Bacteria 3601
163 Ga0207428_10065891 3300027907 Bacteria 2855
164 Ga0207428_10109731 3300027907 Bacteria 2125
165 Ga0207428_10455848 3300027907 Unclassified 932
166 Ga0268264_10027313 3300028381 Bacteria 4662
167 Ga0265338_10320376 3300028800 Bacteria 1122
168 Ga0307410_11288378 3300031852 Unclassified 639
169 Ga0307406_10411197 3300031901 Bacteria 1075
170 Ga0307409_100818382 3300031995 Bacteria 940
171 Ga0307416_100046229 3300032002 Bacteria 3434
172 Ga0373930_0034191 3300034816 Bacteria 1058
173 Ga0373948_0000790 3300034817 Bacteria 4157
174 Ga0373958_0000564 3300034819 Bacteria 4599
175 Ga0373959_0022233 3300034820 Bacteria 1224
176 Ga0373938_0001786 3300034957 Bacteria 3433
177 Ga0373928_0001680 3300035084 Bacteria 4293
178 Ga0373940_0000581 3300035088 Bacteria 5798
179 Ga0373949_0002135 3300035090 Bacteria 5195
180 Ga0373951_0013732 3300035091 Bacteria 1819
181 Ga0373952_0252727 3300035092 Unclassified 534
182 Ga0373932_0000189 3300035112 Bacteria 17836
183 Ga0373939_0114881 3300035114 Bacteria 942
184 Ga0373941_0002732 3300035115 Bacteria 3916
185 Ga0373960_0002553 3300035121 Bacteria 4105
186 Ga0373943_0639510 3300035170 Bacteria 628
187 Ga0373946_0297409 3300035171 Bacteria 797
188 Ga0373942_0009681 3300035207 Bacteria 2259
189 Ga0373961_0004169 3300035241 Bacteria 3511
190 Ga0373962_0000380 3300035242 Bacteria 9699
191 Ga0373931_0000374 3300035691 Bacteria 18399
192 Ga0373925_0299575 3300037068 Bacteria 1298
193 Ga0395899_0003928 3300037312 Bacteria 11718
194 Ga0395899_0012011 3300037312 Bacteria 6635
195 Ga0395899_0052413 3300037312 Unclassified 3024
196 Ga0395899_0144306 3300037312 Bacteria 1692
197 Ga0395899_0271232 3300037312 Bacteria 1157
198 Ga0395900_0003384 3300037418 Bacteria 17224
199 Ga0395900_0015067 3300037418 Bacteria 7881
200 Ga0395900_0062399 3300037418 Bacteria 3831
201 Ga0395900_0078021 3300037418 Bacteria 3403
202 Ga0395900_0099157 3300037418 Bacteria 2993
203 Ga0395900_0125600 3300037418 Unclassified 2631
204 Ga0395900_0146287 3300037418 Bacteria 2416
205 Ga0395900_0191168 3300037418 Unclassified 2076
206 Ga0395900_0419866 3300037418 Bacteria 1298
207 Ga0395900_0771314 3300037418 Bacteria 891
208 Ga0395900_0781348 3300037418 Bacteria 884
209 Ga0395900_1641111 3300037418 Bacteria 554
210 Ga0395898_0009213 3300037466 Bacteria 10386
211 Ga0395898_0016210 3300037466 Bacteria 7631
212 Ga0395898_0032137 3300037466 Bacteria 5237
213 Ga0395898_0035980 3300037466 Bacteria 4921
214 Ga0395898_0144163 3300037466 Unclassified 2280
215 Ga0395898_0239446 3300037466 Bacteria 1731
216 Ga0395898_0263062 3300037466 Bacteria 1645
217 Ga0395898_0562791 3300037466 Bacteria 1082
218 Ga0395898_1329584 3300037466 Bacteria 647
219 Ga0395898_1375796 3300037466 Bacteria 634
220 Ga0395898_1438776 3300037466 Unclassified 616
221 Ga0395898_1813674 3300037466 Archaea 531
222 Ga0395905_0021794 3300037471 Bacteria 6059
223 Ga0395905_0030799 3300037471 Bacteria 5052
224 Ga0395905_0048949 3300037471 Bacteria 3960
225 Ga0395905_0147696 3300037471 Bacteria 2212
226 Ga0395905_0268946 3300037471 Unclassified 1590
227 Ga0395901_0002723 3300038443 Bacteria 17814
228 Ga0395901_0014927 3300038443 Bacteria 7893
229 Ga0395901_0039351 3300038443 Bacteria 4893
230 Ga0395901_0086744 3300038443 Bacteria 3272
231 Ga0395901_0145754 3300038443 Bacteria 2488
232 Ga0395901_0192532 3300038443 Bacteria 2138
233 Ga0395901_0299556 3300038443 Unclassified 1667
234 Ga0395901_0311068 3300038443 Bacteria 1631
235 Ga0395901_0345433 3300038443 Unclassified 1536
236 Ga0395901_0438918 3300038443 Bacteria 1336
237 Ga0395901_0477971 3300038443 Bacteria 1271
238 Ga0395901_0506953 3300038443 Bacteria 1228
239 Ga0395901_0570747 3300038443 Unclassified 1144
240 Ga0395901_0595637 3300038443 Unclassified 1115
241 Ga0451787_098427 3300041441 Archaea 556
242 Ga0451789_0872612 3300041443 Unclassified 1967
243 Ga0451795_0124893 3300041456 Bacteria 840
244 Ga0451798_0925384 3300041458 Bacteria 600
245 Ga0451800_0463681 3300041459 Bacteria 1775
246 Ga0451802_1301646 3300041460 Unclassified 504
247 Ga0451807_2316627 3300041486 Bacteria 1445
248 Ga0451833_1166850 3300041491 Bacteria 1110
249 Ga0451835_0566642 3300041492 Unclassified 590
250 Ga0451839_0862092 3300041496 Bacteria 1590
251 Ga0451845_0896179 3300041501 Bacteria 1242
252 Ga0451847_0099630 3300041503 Archaea 520
253 Ga0451849_1323464 3300041505 Bacteria 787
254 Ga0451843_1149536 3300041509 Bacteria 900
255 Ga0451855_1742958 3300041511 Bacteria 1364
256 Ga0451853_3723233 3300041512 Unclassified 903
257 Ga0451853_4067866 3300041512 Bacteria 2465
258 Ga0439441_018220 3300042001 Bacteria 1268
259 Ga0439448_0292592 3300042005 Bacteria 578
260 Ga0439451_002996 3300042009 Bacteria 3433
261 Ga0450920_052442 3300042122 Bacteria 819
262 Ga0450890_013666 3300042127 Unclassified 1061
263 Ga0466964_0001244 3300044706 Bacteria 8644
264 Ga0466964_0675469 3300044706 Unclassified 573
265 Ga0466968_0084914 3300044735 Bacteria 1396
266 Ga0466960_0046645 3300044901 Bacteria 2075
267 Ga0466960_0083351 3300044901 Bacteria 1615
268 Ga0466967_0197982 3300045976 Unclassified 1901
269 Ga0495603_0027761 3300046455 Unclassified 3414
270 Ga0495603_0223492 3300046455 Bacteria 1086
271 Ga0495582_0020507 3300046473 Bacteria 3619
272 Ga0495582_0182662 3300046473 Unclassified 1195
273 Ga0495639_0030331 3300046475 Bacteria 2403
274 Ga0495662_0136512 3300046476 Bacteria 1206
275 Ga0495662_0461461 3300046476 Bacteria 623
276 Ga0495584_0631813 3300046491 Bacteria 546
277 Ga0495594_0069997 3300046499 Bacteria 1950
278 Ga0495596_0029624 3300046500 Bacteria 2194
279 Ga0495596_0442489 3300046500 Unclassified 507
280 Ga0495607_0108623 3300046501 Bacteria 1474
281 Ga0495607_0147005 3300046501 Bacteria 1210
282 Ga0495665_0119581 3300046531 Unclassified 1380
283 Ga0495656_0146080 3300046615 Bacteria 1138
284 Ga0495668_0427335 3300046616 Bacteria 729
285 Ga0495659_0103284 3300046664 Unclassified 1106
286 Ga0495659_0361028 3300046664 Unclassified 622
287 Ga0495661_0476029 3300046665 Bacteria 598
288 Ga0495588_0093682 3300046674 Unclassified 1574
289 Ga0495588_0180866 3300046674 Bacteria 1114
290 Ga0495647_0206746 3300046681 Unclassified 862
291 Ga0495658_0697887 3300046683 Bacteria 650
292 Ga0495658_0995290 3300046683 Bacteria 535
293 Ga0495613_0932110 3300046689 Bacteria 561
294 Ga0495624_0162595 3300046690 Bacteria 1363
295 Ga0495670_0332340 3300046691 Unclassified 817
296 Ga0495670_0389975 3300046691 Bacteria 752
297 Ga0495581_0001841 3300047315 Bacteria 11861
298 Ga0495581_0356665 3300047315 Bacteria 853
299 Ga0495581_0641234 3300047315 Bacteria 614
300 Ga0495676_0284627 3300047321 Bacteria 1118
301 Ga0495614_0381005 3300048089 Bacteria 661
302 Ga0496100_0003327 3300048903 Bacteria 8370
303 Ga0496101_0009143 3300048904 Bacteria 6503
304 Ga0496102_0010801 3300048905 Bacteria 7865
305 Ga0496103_0003434 3300048906 Bacteria 9683
306 Ga0496104_0007406 3300048907 Bacteria 9696
307 Ga0496104_0098867 3300048907 Bacteria 2793
308 Ga0496105_0001205 3300048908 Bacteria 18016
309 Ga0496105_0033377 3300048908 Bacteria 4226
310 Ga0496106_0029056 3300048909 Bacteria 4119
311 Ga0496107_0006565 3300048910 Bacteria 8003
312 Ga0496108_0007707 3300048911 Bacteria 8722
313 Ga0496108_0057235 3300048911 Bacteria 3276
314 Ga0496108_0366283 3300048911 Bacteria 1258
315 Ga0496109_0017569 3300048912 Bacteria 6272
316 Ga0496109_0026904 3300048912 Bacteria 5131
317 Ga0496109_0120552 3300048912 Bacteria 2443
318 Ga0496110_0025511 3300048913 Bacteria 5052
319 Ga0496110_0042074 3300048913 Bacteria 3988
320 Ga0496110_0693653 3300048913 Unclassified 919
321 Ga0496111_0081509 3300048914 Bacteria 2362
322 Ga0496112_0196310 3300048915 Bacteria 1978
323 Ga0496112_0624879 3300048915 Bacteria 1008
324 Ga0496112_0865808 3300048915 Bacteria 826
325 Ga0496113_0001255 3300048916 Bacteria 13985
326 Ga0496113_0390258 3300048916 Unclassified 1117
327 Ga0496114_0005241 3300048917 Bacteria 10132
328 Ga0496115_0001996 3300048918 Bacteria 14585
329 Ga0501031_0158366 3300049568 Bacteria 1480
330 Ga0501036_0053932 3300049572 Bacteria 3404
331 Ga0501037_0066280 3300049573 Bacteria 2631
332 Ga0501038_0229216 3300049574 Bacteria 1479
333 Ga0501039_0079516 3300049575 Bacteria 2551
334 Ga0501040_0034376 3300049576 Bacteria 3434
335 Ga0501041_0025165 3300049577 Bacteria 3578
336 Ga0501042_0230155 3300049578 Bacteria 1337
337 Ga0501043_0455268 3300049579 Bacteria 961
338 Ga0501046_0219908 3300049580 Bacteria 1407
339 Ga0501048_0092152 3300049582 Bacteria 2137
340 Ga0501067_0316074 3300049583 Bacteria 870
341 Ga0501072_0121283 3300049588 Bacteria 2083
342 Ga0501074_0357360 3300049590 Bacteria 1037
343 Ga0501075_0031307 3300049591 Bacteria 3948
344 Ga0501075_0924749 3300049591 Bacteria 663
345 Ga0501076_0158723 3300049592 Bacteria 1842
346 Ga0501077_0276793 3300049593 Unclassified 1068
347 Ga0501077_0423693 3300049593 Bacteria 851
348 Ga0501079_0116982 3300049741 Bacteria 2072
349 Ga0501079_0394818 3300049741 Unclassified 1085
350 Ga0501080_0100257 3300049742 Bacteria 2687
351 Ga0501081_0787735 3300049743 Bacteria 715
352 Ga0501045_0069923 3300049824 Bacteria 2582
353 Ga0501045_0182945 3300049824 Unclassified 1562
354 nmdc:mga05p37_1048684_c1 3300050507 Bacteria 860
355 nmdc:mga05p37_1870848_c1 3300050507 Bacteria 575
356 nmdc:mga05p37_209527_c1 3300050507 Unclassified 2357
357 nmdc:mga05p37_263678_c1 3300050507 Bacteria 2061
358 nmdc:mga09592_366391_c1 3300050508 Unclassified 1246
359 nmdc:mga0qj67_751279_c1 3300050509 Bacteria 774
360 nmdc:mga06r32_1103895_c1 3300050510 Unclassified 742
361 nmdc:mga06r32_17990_c1 3300050510 Bacteria 6461
362 nmdc:mga06r32_916395_c1 3300050510 Bacteria 832
363 nmdc:mga08y16_156155_c1 3300050511 Bacteria 2371
364 nmdc:mga08y16_242787_c1 3300050511 Bacteria 1862
365 nmdc:mga08y16_47581_c1 3300050511 Bacteria 4489
366 nmdc:mga08y16_670321_c1 3300050511 Bacteria 1039
367 nmdc:mga0n895_1118281_c1 3300050512 Unclassified 765
368 nmdc:mga0n895_512860_c1 3300050512 Bacteria 1207
369 nmdc:mga0rr50_371703_c1 3300050513 Bacteria 1205
370 nmdc:mga08x19_11506_c1 3300050514 Bacteria 5325
371 nmdc:mga08x19_43968_c1 3300050514 Bacteria 2851
372 nmdc:mga0a205_31308_c1 3300050515 Bacteria 5097
373 nmdc:mga0a205_62735_c1 3300050515 Bacteria 3591
374 Ga0501084_0231841 3300054114 Bacteria 1558
375 Ga0590075_057170 3300059424 Bacteria 1004
376 Ga0501082_0109843 3300060353 Bacteria 2387
377 Ga0450920_011897
378 JGI25407J50210_10009158
379 JGI25405J52794_10058979
380 Ga0070683_100067188
381 Ga0070682_100670169
382 Ga0068868_101478267
383 Ga0070691_10333456
384 Ga0070687_101467044
385 Ga0070661_100666152
386 Ga0070673_100144766
387 Ga0070659_100619919
388 Ga0070703_10009074
389 Ga0070709_10024099
390 Ga0070709_10290316
391 Ga0070714_102389604
392 Ga0070710_10001255
393 Ga0070711_100095038
394 Ga0070711_101540435
395 Ga0070705_100125593
396 Ga0070705_100645535
397 Ga0070700_100001464
398 Ga0070694_100005290
399 Ga0070708_100131386
400 Ga0070678_100234836
401 Ga0070678_100906792
402 Ga0070706_100035153
403 Ga0070706_100082924
404 Ga0070707_100002173
405 Ga0070698_100651402
406 Ga0070699_100154200
407 Ga0070699_100407089
408 Ga0070699_101017693
409 Ga0070699_101694291
410 Ga0070679_100841231
411 Ga0070684_100001921
412 Ga0070684_100011940
413 Ga0070697_100174845
414 Ga0070697_100590322
415 Ga0070697_100830916
416 Ga0070672_100002647
417 Ga0070695_100022048
418 Ga0070695_100173462
419 Ga0070695_101517929
420 Ga0070696_100062764
421 Ga0070696_100118446
422 Ga0070704_100263487
423 Ga0070704_100408131
424 Ga0070704_101542978
425 Ga0070704_102022198
426 Ga0068855_100209018
427 Ga0068857_100001430
428 Ga0068857_100049526
429 Ga0068857_100122869
430 Ga0068856_101668915
431 Ga0070702_100008330
432 Ga0070702_100517271
433 Ga0068852_100063229
434 Ga0068866_10008563
435 Ga0068861_100150742
436 Ga0068870_10333177
437 Ga0068863_100759275
438 Ga0068860_100056947
439 Ga0068862_100647475
440 Ga0081455_10006181
441 Ga0081455_10006261
442 Ga0081455_10106005
443 Ga0081455_10136415
444 Ga0081455_10466952
445 Ga0081538_10000184
446 Ga0081538_10008247
447 Ga0081538_10162435
448 Ga0081538_10365616
449 Ga0081538_10373038
450 Ga0081540_1010792
451 Ga0075364_11207382
452 Ga0075432_10106378
453 Ga0075432_10226344
454 Ga0070715_10454767
455 Ga0070712_100073043
456 Ga0075428_100180827
457 Ga0075428_100285165
458 Ga0075428_100440506
459 Ga0075428_102077372
460 Ga0075430_100672605
461 Ga0075431_100019160
462 Ga0075431_101028970
463 Ga0075431_101233010
464 Ga0075433_10051316
465 Ga0075433_10085043
466 Ga0075434_100281252
467 Ga0068865_100008685
468 Ga0068865_100846609
469 Ga0075436_100071837
470 Ga0075436_100573628
471 Ga0075435_100021661
472 Ga0075435_101065266
473 Ga0111539_10013906
474 Ga0111539_10044831
475 Ga0111539_10054253
476 Ga0111539_10431683
477 Ga0111539_11173925
478 Ga0105245_10790192
479 Ga0105245_11261441
480 Ga0114129_10080297
481 Ga0114129_10242792
482 Ga0114129_12049523
483 Ga0114129_12111729
484 Ga0114129_12307143
485 Ga0114129_12628518
486 Ga0105243_10303833
487 Ga0105243_10679860
488 Ga0105243_11943815
489 Ga0105242_10127099
490 Ga0105242_12303988
491 Ga0105248_10778690
492 Ga0105238_10082898
493 Ga0105249_10035565
494 Ga0157314_1034874
495 Ga0157373_10917927
496 Ga0157374_10009159
497 Ga0157378_10040250
498 Ga0157378_10922069
499 Ga0163162_10004499
500 Ga0157375_13444693
501 Ga0163163_10605330
502 Ga0157380_13274293
503 Ga0157377_10007703
504 Ga0157376_10842272
505 Ga0157376_10931040
506 Ga0207653_10169494
507 Ga0207692_10020918
508 Ga0207692_10351943
509 Ga0207685_10129938
510 Ga0207699_10047834
511 Ga0207643_10412129
512 Ga0207684_10096775
513 Ga0207671_10099318
514 Ga0207693_10002108
515 Ga0207663_10299707
516 Ga0207662_11063646
517 Ga0207657_10017047
518 Ga0207649_10764717
519 Ga0207646_10001950
520 Ga0207700_11447986
521 Ga0207690_10700750
522 Ga0207686_10724524
523 Ga0207709_10449170
524 Ga0207665_10030446
525 Ga0207665_11542138
526 Ga0207661_10013023
527 Ga0207661_10021215
528 Ga0207679_11364441
529 Ga0207651_10143962
530 Ga0207640_10439092
531 Ga0207708_10000811
532 Ga0207702_10819397
533 Ga0207641_10370270
534 Ga0207674_10007738
535 Ga0207674_10051800
536 Ga0207674_10095162
537 Ga0207683_10022052
538 Ga0207698_10036695
539 Ga0207428_10065891
540 Ga0207428_10109731
541 Ga0207428_10455848
542 Ga0268264_10027313
543 Ga0265338_10320376
544 Ga0307410_11288378
545 Ga0307406_10411197
546 Ga0307409_100818382
547 Ga0307416_100046229
548 Ga0373930_0034191
549 Ga0373948_0000790
550 Ga0373958_0000564
551 Ga0373959_0022233
552 Ga0373938_0001786
553 Ga0373928_0001680
554 Ga0373940_0000581
555 Ga0373949_0002135
556 Ga0373951_0013732
557 Ga0373952_0252727
558 Ga0373932_0000189
559 Ga0373939_0114881
560 Ga0373941_0002732
561 Ga0373960_0002553
562 Ga0373943_0639510
563 Ga0373946_0297409
564 Ga0373942_0009681
565 Ga0373961_0004169
566 Ga0373962_0000380
567 Ga0373931_0000374
568 Ga0373925_0299575
569 Ga0395899_0003928
570 Ga0395899_0012011
571 Ga0395899_0052413
572 Ga0395899_0144306
573 Ga0395899_0271232
574 Ga0395900_0003384
575 Ga0395900_0015067
576 Ga0395900_0062399
577 Ga0395900_0078021
578 Ga0395900_0099157
579 Ga0395900_0125600
580 Ga0395900_0146287
581 Ga0395900_0191168
582 Ga0395900_0419866
583 Ga0395900_0771314
584 Ga0395900_0781348
585 Ga0395900_1641111
586 Ga0395898_0009213
587 Ga0395898_0016210
588 Ga0395898_0032137
589 Ga0395898_0035980
590 Ga0395898_0144163
591 Ga0395898_0239446
592 Ga0395898_0263062
593 Ga0395898_0562791
594 Ga0395898_1329584
595 Ga0395898_1375796
596 Ga0395898_1438776
597 Ga0395898_1813674
598 Ga0395905_0021794
599 Ga0395905_0030799
600 Ga0395905_0048949
601 Ga0395905_0147696
602 Ga0395905_0268946
603 Ga0395901_0002723
604 Ga0395901_0014927
605 Ga0395901_0039351
606 Ga0395901_0086744
607 Ga0395901_0145754
608 Ga0395901_0192532
609 Ga0395901_0299556
610 Ga0395901_0311068
611 Ga0395901_0345433
612 Ga0395901_0438918
613 Ga0395901_0477971
614 Ga0395901_0506953
615 Ga0395901_0570747
616 Ga0395901_0595637
617 Ga0451787_098427
618 Ga0451789_0872612
619 Ga0451795_0124893
620 Ga0451798_0925384
621 Ga0451800_0463681
622 Ga0451802_1301646
623 Ga0451807_2316627
624 Ga0451833_1166850
625 Ga0451835_0566642
626 Ga0451839_0862092
627 Ga0451845_0896179
628 Ga0451847_0099630
629 Ga0451849_1323464
630 Ga0451843_1149536
631 Ga0451855_1742958
632 Ga0451853_3723233
633 Ga0451853_4067866
634 Ga0439441_018220
635 Ga0439448_0292592
636 Ga0439451_002996
637 Ga0450920_052442
638 Ga0450890_013666
639 Ga0466964_0001244
640 Ga0466964_0675469
641 Ga0466968_0084914
642 Ga0466960_0046645
643 Ga0466960_0083351
644 Ga0466967_0197982
645 Ga0495603_0027761
646 Ga0495603_0223492
647 Ga0495582_0020507
648 Ga0495582_0182662
649 Ga0495639_0030331
650 Ga0495662_0136512
651 Ga0495662_0461461
652 Ga0495584_0631813
653 Ga0495594_0069997
654 Ga0495596_0029624
655 Ga0495596_0442489
656 Ga0495607_0108623
657 Ga0495607_0147005
658 Ga0495665_0119581
659 Ga0495656_0146080
660 Ga0495668_0427335
661 Ga0495659_0103284
662 Ga0495659_0361028
663 Ga0495661_0476029
664 Ga0495588_0093682
665 Ga0495588_0180866
666 Ga0495647_0206746
667 Ga0495658_0697887
668 Ga0495658_0995290
669 Ga0495613_0932110
670 Ga0495624_0162595
671 Ga0495670_0332340
672 Ga0495670_0389975
673 Ga0495581_0001841
674 Ga0495581_0356665
675 Ga0495581_0641234
676 Ga0495676_0284627
677 Ga0495614_0381005
678 Ga0496100_0003327
679 Ga0496101_0009143
680 Ga0496102_0010801
681 Ga0496103_0003434
682 Ga0496104_0007406
683 Ga0496104_0098867
684 Ga0496105_0001205
685 Ga0496105_0033377
686 Ga0496106_0029056
687 Ga0496107_0006565
688 Ga0496108_0007707
689 Ga0496108_0057235
690 Ga0496108_0366283
691 Ga0496109_0017569
692 Ga0496109_0026904
693 Ga0496109_0120552
694 Ga0496110_0025511
695 Ga0496110_0042074
696 Ga0496110_0693653
697 Ga0496111_0081509
698 Ga0496112_0196310
699 Ga0496112_0624879
700 Ga0496112_0865808
701 Ga0496113_0001255
702 Ga0496113_0390258
703 Ga0496114_0005241
704 Ga0496115_0001996
705 Ga0501031_0158366
706 Ga0501036_0053932
707 Ga0501037_0066280
708 Ga0501038_0229216
709 Ga0501039_0079516
710 Ga0501040_0034376
711 Ga0501041_0025165
712 Ga0501042_0230155
713 Ga0501043_0455268
714 Ga0501046_0219908
715 Ga0501048_0092152
716 Ga0501067_0316074
717 Ga0501072_0121283
718 Ga0501074_0357360
719 Ga0501075_0031307
720 Ga0501075_0924749
721 Ga0501076_0158723
722 Ga0501077_0276793
723 Ga0501077_0423693
724 Ga0501079_0116982
725 Ga0501079_0394818
726 Ga0501080_0100257
727 Ga0501081_0787735
728 Ga0501045_0069923
729 Ga0501045_0182945
730 nmdc:mga05p37_1048684_c1
731 nmdc:mga05p37_1870848_c1
732 nmdc:mga05p37_209527_c1
733 nmdc:mga05p37_263678_c1
734 nmdc:mga09592_366391_c1
735 nmdc:mga0qj67_751279_c1
736 nmdc:mga06r32_1103895_c1
737 nmdc:mga06r32_17990_c1
738 nmdc:mga06r32_916395_c1
739 nmdc:mga08y16_156155_c1
740 nmdc:mga08y16_242787_c1
741 nmdc:mga08y16_47581_c1
742 nmdc:mga08y16_670321_c1
743 nmdc:mga0n895_1118281_c1
744 nmdc:mga0n895_512860_c1
745 nmdc:mga0rr50_371703_c1
746 nmdc:mga08x19_11506_c1
747 nmdc:mga08x19_43968_c1
748 nmdc:mga0a205_31308_c1
749 nmdc:mga0a205_62735_c1
750 Ga0501084_0231841
751 Ga0590075_057170
752 Ga0501082_0109843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fxd-assembly1.cif.gz_A-2 crystal structure of mupz from pseudomonas fluorescens 0.8314 2 64
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.8299 2 64
4za1-assembly1.cif.gz_C crystal structure of nosa involved in nosiheptide biosynthesis 0.8226 2 91
4za1-assembly1.cif.gz_A crystal structure of nosa involved in nosiheptide biosynthesis 0.7914 2 93
4za1-assembly1.cif.gz_C crystal structure of nosa involved in nosiheptide biosynthesis 0.7828 2 91
ID Description Score Start End Superfamily
af_K7L8B0_46_140_3.30.30.10 Alpha Beta;2-Layer Sandwich;Defensin A-like;Knottin, scorpion toxin-like 0.7952 3 64 3.30.30.10
4za1B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7707 2 91 3.30.70.100
1wd6B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7526 1 89 3.30.70.100
4za1B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7412 2 91 3.30.70.100
af_A0A0R0FRH5_26_129_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7258 36 60 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A538KJJ0-F1-model_v4 ABM domain-containing protein 0.9667 1 94
AF-A0A1I2J938-F1-model_v4 Uncharacterized protein 0.9432 1 92
AF-A0A0M9CQD8-F1-model_v4 deleted 0.9323 2 94
AF-A0A1C6VHE2-F1-model_v4 Uncharacterized protein 0.9018 1 94
AF-A0A518VLG9-F1-model_v4 deleted 0.8979 3 61

Map