F427352

General Info

Members Datasets Scaffolds Average Seq Length
376 227 752 155

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10408955|Ga0105246_104089552
Length 175
Sequence LFATNALRLRGDHARQKESVMAAAPRTRSPQSVLFACGLNSVRSPMAESLLQQMFPKALYVRSAGVRKGELDPFAVAVMAELGQDISRHKPITFDELEDWEGLNFDLIITLAPEAHHKALELTRTLAADVEYWPTHDPTGAEGNREQKLSAYREVCDTLLARIRKRFANVGAASG

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
212 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
221 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
222 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
223 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
224 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
225 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
226 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
227 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.27
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.9
Nodule 0.53
Rhizoplane 2.13
Rhizosphere 80.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10408955 3300011119 Bacteria 1129
2 JGI24740J21852_10028543 3300001979 Bacteria 1843
3 JGI24738J21930_10021607 3300002075 Bacteria 1334
4 JGI25405J52794_10026794 3300003911 Bacteria 1185
5 Ga0070680_101286356 3300005336 Bacteria 633
6 Ga0070661_100636068 3300005344 Bacteria 865
7 Ga0070675_100517807 3300005354 Bacteria 1076
8 Ga0070709_10021403 3300005434 Bacteria 3766
9 Ga0070714_100357506 3300005435 Bacteria 1372
10 Ga0070714_101176824 3300005435 Bacteria 748
11 Ga0070713_101355094 3300005436 Bacteria 690
12 Ga0070710_10015263 3300005437 Bacteria 3885
13 Ga0070710_10536673 3300005437 Bacteria 806
14 Ga0070711_100031727 3300005439 Bacteria 3510
15 Ga0070711_100067864 3300005439 Bacteria 2504
16 Ga0070711_101362133 3300005439 Bacteria 617
17 Ga0070708_100523971 3300005445 Bacteria 1118
18 Ga0070663_100008818 3300005455 Bacteria 6222
19 Ga0070662_101458798 3300005457 Bacteria 590
20 Ga0070681_10668182 3300005458 Bacteria 954
21 Ga0070706_100246653 3300005467 Bacteria 1667
22 Ga0070706_101602812 3300005467 Bacteria 594
23 Ga0068853_100065825 3300005539 Bacteria 3145
24 Ga0070696_101544752 3300005546 Bacteria 569
25 Ga0070665_100122485 3300005548 Bacteria 2602
26 Ga0068855_100261442 3300005563 Bacteria 1928
27 Ga0068855_101152586 3300005563 Bacteria 808
28 Ga0068857_100147082 3300005577 Bacteria 2132
29 Ga0068854_100031071 3300005578 Bacteria 3709
30 Ga0068856_100275555 3300005614 Bacteria 1699
31 Ga0068852_100217322 3300005616 Bacteria 1816
32 Ga0068851_10003652 3300005834 Bacteria 6869
33 Ga0068863_101104560 3300005841 Bacteria 798
34 Ga0068860_100000251 3300005843 Bacteria 79943
35 Ga0081455_10025968 3300005937 Bacteria 5397
36 Ga0081540_1052335 3300005983 Bacteria 2011
37 Ga0081539_10002294 3300005985 Bacteria 27712
38 Ga0070717_10018516 3300006028 Bacteria 5439
39 Ga0070717_10947753 3300006028 Bacteria 784
40 Ga0070717_10973270 3300006028 Bacteria 773
41 Ga0075365_10017288 3300006038 Bacteria 4409
42 Ga0075365_10281866 3300006038 Bacteria 1169
43 Ga0075368_10068235 3300006042 Bacteria 1433
44 Ga0075363_100059481 3300006048 Bacteria 2055
45 Ga0070715_10952162 3300006163 Bacteria 532
46 Ga0070716_100041581 3300006173 Bacteria 2562
47 Ga0070712_100118872 3300006175 Bacteria 1986
48 Ga0070712_100249356 3300006175 Bacteria 1418
49 Ga0070712_100271895 3300006175 Bacteria 1362
50 Ga0070712_100514647 3300006175 Bacteria 1005
51 Ga0075362_10089992 3300006177 Bacteria 1424
52 Ga0075367_10022131 3300006178 Bacteria 3561
53 Ga0075369_10003142 3300006186 Bacteria 5986
54 Ga0075434_100013157 3300006871 Bacteria 7861
55 Ga0075434_100013416 3300006871 Bacteria 7797
56 Ga0068865_101133638 3300006881 Bacteria 690
57 Ga0075436_100203074 3300006914 Bacteria 1404
58 Ga0099794_10142975 3300007265 Bacteria 1212
59 Ga0105240_10032407 3300009093 Bacteria 6765
60 Ga0105240_11471990 3300009093 Bacteria 714
61 Ga0111539_10321594 3300009094 Bacteria 1800
62 Ga0105243_10601064 3300009148 Bacteria 1059
63 Ga0105241_10002070 3300009174 Bacteria 15157
64 Ga0105241_11853559 3300009174 Bacteria 590
65 Ga0105237_10286779 3300009545 Bacteria 1649
66 Ga0105237_10677164 3300009545 Bacteria 1038
67 Ga0105237_10831303 3300009545 Bacteria 930
68 Ga0105238_10003705 3300009551 Bacteria 15211
69 Ga0105238_10187370 3300009551 Bacteria 2045
70 Ga0099796_10200913 3300010159 Bacteria 808
71 Ga0105239_10012498 3300010375 Bacteria 9457
72 Ga0157369_10201477 3300013105 Bacteria 2089
73 Ga0163162_10415869 3300013306 Bacteria 1477
74 Ga0213873_10073827 3300021358 Bacteria 944
75 Ga0213876_10164626 3300021384 Bacteria 1180
76 Ga0213875_10240715 3300021388 Bacteria 853
77 Ga0213871_10085726 3300021441 Bacteria 907
78 Ga0207697_10027329 3300025315 Bacteria 2333
79 Ga0207656_10044603 3300025321 Bacteria 1894
80 Ga0207699_10007596 3300025906 Bacteria 5307
81 Ga0207699_10380148 3300025906 Bacteria 1002
82 Ga0207684_10089054 3300025910 Bacteria 2630
83 Ga0207654_10000131 3300025911 Bacteria 48376
84 Ga0207695_10000506 3300025913 Bacteria 82904
85 Ga0207671_10195152 3300025914 Bacteria 1580
86 Ga0207671_10199907 3300025914 Bacteria 1561
87 Ga0207671_10617303 3300025914 Bacteria 864
88 Ga0207693_10079505 3300025915 Bacteria 2566
89 Ga0207663_10289967 3300025916 Bacteria 1219
90 Ga0207663_11166514 3300025916 Bacteria 620
91 Ga0207649_10426595 3300025920 Bacteria 997
92 Ga0207694_10000086 3300025924 Bacteria 108152
93 Ga0207694_10709369 3300025924 Bacteria 848
94 Ga0207659_10415071 3300025926 Bacteria 1128
95 Ga0207700_10075091 3300025928 Bacteria 2618
96 Ga0207700_10744338 3300025928 Bacteria 876
97 Ga0207664_10301585 3300025929 Bacteria 1409
98 Ga0207644_10576776 3300025931 Bacteria 933
99 Ga0207704_10851916 3300025938 Bacteria 764
100 Ga0207665_10030788 3300025939 Bacteria 3548
101 Ga0207665_11008247 3300025939 Bacteria 662
102 Ga0207689_10072766 3300025942 Bacteria 2824
103 Ga0207667_10013204 3300025949 Bacteria 9469
104 Ga0207667_10309441 3300025949 Bacteria 1614
105 Ga0207667_10615793 3300025949 Bacteria 1094
106 Ga0207658_11473306 3300025986 Bacteria 623
107 Ga0207678_10085370 3300026067 Bacteria 2699
108 Ga0207702_10000098 3300026078 Bacteria 101326
109 Ga0207702_11156135 3300026078 Bacteria 768
110 Ga0207641_10303379 3300026088 Bacteria 1509
111 Ga0207674_10166727 3300026116 Bacteria 2157
112 Ga0209179_1007889 3300027512 Bacteria 1774
113 Ga0209588_1031722 3300027671 Bacteria 1692
114 Ga0209588_1070262 3300027671 Bacteria 1131
115 Ga0209588_1121253 3300027671 Bacteria 837
116 Ga0209813_10006761 3300027866 Bacteria 2841
117 Ga0207428_10768092 3300027907 Bacteria 686
118 Ga0268266_10429355 3300028379 Bacteria 1253
119 Ga0268265_10538877 3300028380 Bacteria 1106
120 Ga0268264_10000051 3300028381 Bacteria 321565
121 Ga0307511_10211746 3300030521 Bacteria 988
122 Ga0265325_10114818 3300031241 Bacteria 1304
123 Ga0265313_10100300 3300031595 Bacteria 1286
124 Ga0307508_10000114 3300031616 Bacteria 95098
125 Ga0307508_10082442 3300031616 Bacteria 2798
126 Ga0307508_10177565 3300031616 Bacteria 1732
127 Ga0307508_10415870 3300031616 Bacteria 936
128 Ga0307516_10001674 3300031730 Bacteria 30538
129 Ga0307516_10260360 3300031730 Bacteria 1425
130 Ga0307507_10012898 3300033179 Bacteria 10247
131 Ga0373926_0158273 3300035083 Bacteria 864
132 Ga0373934_0005514 3300035086 Bacteria 4682
133 Ga0373934_0104823 3300035086 Bacteria 1144
134 Ga0373944_0077732 3300035089 Bacteria 1091
135 Ga0373949_0270576 3300035090 Bacteria 531
136 Ga0373923_0166772 3300035111 Bacteria 1007
137 Ga0373923_0579530 3300035111 Bacteria 551
138 Ga0373923_0600069 3300035111 Bacteria 542
139 Ga0373936_0048732 3300035113 Bacteria 1710
140 Ga0373936_0050746 3300035113 Bacteria 1678
141 Ga0373936_0072044 3300035113 Bacteria 1426
142 Ga0373945_0004300 3300035116 Bacteria 4523
143 Ga0373945_0005945 3300035116 Bacteria 3919
144 Ga0373945_0029865 3300035116 Bacteria 1918
145 Ga0373953_0002803 3300035117 Bacteria 5299
146 Ga0373953_0038438 3300035117 Bacteria 1893
147 Ga0373954_0005204 3300035118 Bacteria 5621
148 Ga0373954_0114592 3300035118 Bacteria 1305
149 Ga0373956_0008461 3300035119 Bacteria 4166
150 Ga0373956_0178464 3300035119 Bacteria 1003
151 Ga0373957_0040043 3300035120 Bacteria 1760
152 Ga0373960_0327535 3300035121 Bacteria 576
153 Ga0373943_0001745 3300035170 Bacteria 9866
154 Ga0373946_0002595 3300035171 Bacteria 6388
155 Ga0373946_0003559 3300035171 Bacteria 5528
156 Ga0373955_0001254 3300035172 Bacteria 10791
157 Ga0373955_0078324 3300035172 Bacteria 1862
158 Ga0373924_0001548 3300035410 Bacteria 7503
159 Ga0373924_0076116 3300035410 Bacteria 1421
160 Ga0373931_0329196 3300035691 Bacteria 951
161 Ga0373935_0000328 3300035692 Bacteria 23872
162 Ga0373935_0004624 3300035692 Bacteria 8085
163 Ga0373935_0010091 3300035692 Bacteria 5657
164 Ga0373935_0032240 3300035692 Bacteria 3255
165 Ga0373935_0171250 3300035692 Bacteria 1485
166 Ga0373927_0006202 3300035695 Bacteria 8162
167 Ga0373927_0067977 3300035695 Bacteria 2305
168 Ga0373927_0102581 3300035695 Bacteria 1861
169 Ga0373927_0282170 3300035695 Bacteria 1092
170 Ga0373927_0404303 3300035695 Bacteria 901
171 Ga0373933_0000290 3300035724 Bacteria 32568
172 Ga0373933_0029643 3300035724 Bacteria 3166
173 Ga0373933_0102458 3300035724 Bacteria 1777
174 Ga0373933_0461387 3300035724 Bacteria 831
175 Ga0373933_0509191 3300035724 Bacteria 789
176 Ga0373947_0009098 3300035725 Bacteria 5708
177 Ga0373947_0010847 3300035725 Bacteria 5228
178 Ga0373947_0128748 3300035725 Bacteria 1614
179 Ga0373947_0378739 3300035725 Bacteria 952
180 Ga0373947_0427314 3300035725 Bacteria 896
181 Ga0373947_0538810 3300035725 Bacteria 794
182 Ga0373937_0000365 3300036401 Bacteria 42154
183 Ga0373937_0534453 3300036401 Bacteria 1114
184 Ga0373937_0881708 3300036401 Bacteria 843
185 Ga0372808_001084 3300036459 Bacteria 2655
186 Ga0373925_0000038 3300037068 Bacteria 142088
187 Ga0373925_0003269 3300037068 Bacteria 12616
188 Ga0373925_0056491 3300037068 Bacteria 2940
189 Ga0373925_0149516 3300037068 Bacteria 1833
190 Ga0373925_0285478 3300037068 Bacteria 1330
191 Ga0395899_0085567 3300037312 Bacteria 2291
192 Ga0395900_0810985 3300037418 Bacteria 863
193 Ga0436364_1350268 3300037853 Bacteria 2639
194 Ga0436364_1385829 3300037853 Bacteria 3651
195 Ga0395901_0509178 3300038443 Bacteria 1225
196 Ga0436365_1841604 3300039437 Bacteria 2145
197 Ga0436361_0722528 3300039447 Bacteria 3289
198 Ga0436361_0801319 3300039447 Bacteria 920
199 Ga0436363_1451784 3300039450 Bacteria 1310
200 Ga0436362_0807531 3300039453 Bacteria 1790
201 Ga0451804_0317326 3300041463 Bacteria 776
202 Ga0451843_1010641 3300041509 Bacteria 1260
203 Ga0451843_1388868 3300041509 Bacteria 857
204 Ga0439435_0287430 3300042436 Bacteria 561
205 Ga0466963_0182099 3300044694 Bacteria 1467
206 Ga0466968_0210613 3300044735 Bacteria 913
207 Ga0466970_0047235 3300044765 Bacteria 2294
208 Ga0466959_0102781 3300045049 Bacteria 2045
209 Ga0466967_0600877 3300045976 Bacteria 1086
210 Ga0495592_0000062 3300046454 Bacteria 99207
211 Ga0495592_0036174 3300046454 Bacteria 3719
212 Ga0495603_0063724 3300046455 Bacteria 2174
213 Ga0495629_0007057 3300046459 Bacteria 8278
214 Ga0495629_0098265 3300046459 Bacteria 2042
215 Ga0495641_0442334 3300046461 Bacteria 591
216 Ga0495651_0000935 3300046462 Bacteria 22624
217 Ga0495651_0033717 3300046462 Bacteria 3993
218 Ga0495653_0000075 3300046463 Bacteria 82856
219 Ga0495653_0076069 3300046463 Bacteria 2497
220 Ga0495580_0282352 3300046472 Bacteria 1132
221 Ga0495582_0088016 3300046473 Bacteria 1730
222 Ga0495662_0009191 3300046476 Bacteria 4849
223 Ga0495662_0228406 3300046476 Bacteria 917
224 Ga0495662_0261503 3300046476 Bacteria 852
225 Ga0495662_0331074 3300046476 Bacteria 749
226 Ga0495664_0000009 3300046477 Bacteria 289534
227 Ga0495664_0770462 3300046477 Bacteria 566
228 Ga0495584_0032972 3300046491 Bacteria 2620
229 Ga0495594_0308337 3300046499 Bacteria 902
230 Ga0495606_0113628 3300046507 Bacteria 1630
231 Ga0495608_0000061 3300046511 Bacteria 86891
232 Ga0495618_0000016 3300046514 Bacteria 151770
233 Ga0495618_0017687 3300046514 Bacteria 4375
234 Ga0495618_0099163 3300046514 Bacteria 1864
235 Ga0495628_0000012 3300046516 Bacteria 224162
236 Ga0495628_0157928 3300046516 Bacteria 1724
237 Ga0495628_0358000 3300046516 Bacteria 1072
238 Ga0495630_0002768 3300046517 Bacteria 12173
239 Ga0495630_0010617 3300046517 Bacteria 6650
240 Ga0495630_0177406 3300046517 Bacteria 1624
241 Ga0495630_0383838 3300046517 Bacteria 1076
242 Ga0495648_0001338 3300046524 Bacteria 24368
243 Ga0495666_0156981 3300046526 Bacteria 1056
244 Ga0495652_0000021 3300046529 Bacteria 181454
245 Ga0495652_0145602 3300046529 Bacteria 1857
246 Ga0495652_0759919 3300046529 Bacteria 648
247 Ga0495665_0039700 3300046531 Bacteria 2506
248 Ga0495665_0104526 3300046531 Bacteria 1486
249 Ga0495640_0000031 3300046533 Bacteria 77381
250 Ga0495640_0013952 3300046533 Bacteria 6096
251 Ga0495640_0031937 3300046533 Bacteria 3754
252 Ga0495640_0104949 3300046533 Bacteria 1851
253 Ga0495586_0564329 3300046535 Bacteria 657
254 Ga0495587_0000052 3300046536 Bacteria 100154
255 Ga0495587_0148417 3300046536 Bacteria 1336
256 Ga0495645_0000254 3300046543 Bacteria 39053
257 Ga0495622_0036790 3300046557 Bacteria 2281
258 Ga0495667_0000011 3300046559 Bacteria 222545
259 Ga0495667_0054128 3300046559 Bacteria 2641
260 Ga0495634_0000080 3300046642 Bacteria 76133
261 Ga0495634_0062595 3300046642 Bacteria 2470
262 Ga0495634_0244870 3300046642 Bacteria 1098
263 Ga0495635_0000018 3300046663 Bacteria 193591
264 Ga0495635_0105783 3300046663 Bacteria 1922
265 Ga0495635_0107309 3300046663 Bacteria 1907
266 Ga0495657_0000308 3300046675 Bacteria 44743
267 Ga0495657_0323866 3300046675 Bacteria 915
268 Ga0495599_0000128 3300046678 Bacteria 48691
269 Ga0495599_0237693 3300046678 Bacteria 1111
270 Ga0495623_0001080 3300046679 Bacteria 18452
271 Ga0495646_0000038 3300046680 Bacteria 75050
272 Ga0495646_0132186 3300046680 Bacteria 1404
273 Ga0495647_0054121 3300046681 Bacteria 1567
274 Ga0495658_0097493 3300046683 Bacteria 1750
275 Ga0495658_0111715 3300046683 Bacteria 1644
276 Ga0495613_0024336 3300046689 Bacteria 4511
277 Ga0495613_0072226 3300046689 Bacteria 2515
278 Ga0495613_0082227 3300046689 Bacteria 2339
279 Ga0495624_0171941 3300046690 Bacteria 1322
280 Ga0495624_0657952 3300046690 Bacteria 623
281 Ga0495600_0000822 3300046809 Bacteria 16495
282 Ga0495581_0012282 3300047315 Bacteria 4960
283 Ga0495581_0089317 3300047315 Bacteria 1787
284 Ga0495581_0158076 3300047315 Bacteria 1325
285 Ga0495581_0318380 3300047315 Bacteria 909
286 Ga0495581_0586656 3300047315 Bacteria 646
287 Ga0495604_0000011 3300047317 Bacteria 292024
288 Ga0495604_0172865 3300047317 Bacteria 1517
289 Ga0495674_0000015 3300047319 Bacteria 224071
290 Ga0495674_0013032 3300047319 Bacteria 7826
291 Ga0495674_0097152 3300047319 Bacteria 2509
292 Ga0495674_0140011 3300047319 Bacteria 2034
293 Ga0495674_0255623 3300047319 Bacteria 1440
294 Ga0495672_0170053 3300047320 Bacteria 1112
295 Ga0495672_0437609 3300047320 Bacteria 592
296 Ga0495676_0017130 3300047321 Bacteria 6412
297 Ga0495676_0262465 3300047321 Bacteria 1174
298 Ga0495680_0080214 3300047322 Bacteria 2466
299 Ga0495675_0000424 3300047444 Bacteria 28500
300 Ga0495675_0020845 3300047444 Bacteria 4171
301 Ga0495673_0085882 3300047469 Bacteria 1294
302 Ga0495684_0000012 3300047471 Bacteria 187118
303 Ga0495684_0000987 3300047471 Bacteria 23140
304 Ga0495684_0080412 3300047471 Bacteria 2474
305 Ga0495593_0000789 3300047673 Bacteria 18348
306 Ga0495593_0040992 3300047673 Bacteria 2491
307 Ga0495593_0654437 3300047673 Bacteria 527
308 Ga0495602_0000018 3300048088 Bacteria 183837
309 Ga0496100_1374827 3300048903 Bacteria 557
310 Ga0496106_0493189 3300048909 Bacteria 984
311 Ga0496110_1582704 3300048913 Bacteria 565
312 Ga0496114_0254843 3300048917 Bacteria 1544
313 Ga0496114_0583077 3300048917 Bacteria 987
314 Ga0496115_0517470 3300048918 Bacteria 957
315 Ga0496115_0808719 3300048918 Bacteria 729
316 Ga0496121_0001674 3300048924 Bacteria 36437
317 Ga0496121_0197356 3300048924 Bacteria 1437
318 Ga0496126_0028469 3300048929 Bacteria 5324
319 Ga0496126_0177289 3300048929 Bacteria 1812
320 Ga0496126_0312219 3300048929 Bacteria 1294
321 Ga0496126_0647465 3300048929 Bacteria 827
322 Ga0501067_0635104 3300049583 Bacteria 599
323 nmdc:mga03683_84246_c1 3300050489 Bacteria 1377
324 nmdc:mga00v17_195320_c1 3300050491 Bacteria 1308
325 nmdc:mga06z11_28766_c1 3300050494 Bacteria 2670
326 nmdc:mga06z11_74100_c1 3300050494 Bacteria 1494
327 nmdc:mga04h51_171177_c1 3300050495 Bacteria 841
328 nmdc:mga05p37_264846_c1 3300050507 Bacteria 2055
329 nmdc:mga08y16_258590_c1 3300050511 Bacteria 1798
330 nmdc:mga08y16_421017_c1 3300050511 Bacteria 1365
331 nmdc:mga0n895_14101_c1 3300050512 Bacteria 7245
332 nmdc:mga0n895_39037_c1 3300050512 Bacteria 4603
333 nmdc:mga0n895_42531_c1 3300050512 Bacteria 4420
334 Ga0495601_0000015 3300053077 Bacteria 213851
335 Ga0495601_0003928 3300053077 Bacteria 8553
336 Ga0495601_0344540 3300053077 Bacteria 969
337 Ga0495612_0000016 3300053078 Bacteria 158947
338 Ga0495612_0026181 3300053078 Bacteria 2344
339 Ga0495612_0099658 3300053078 Bacteria 1236
340 Ga0495612_0107787 3300053078 Bacteria 1190
341 Ga0495612_0227873 3300053078 Bacteria 826
342 Ga0500635_0004538 3300053080 Bacteria 3582
343 Ga0500635_0127933 3300053080 Bacteria 955
344 Ga0495595_0000037 3300053084 Bacteria 78496
345 Ga0495595_0163095 3300053084 Bacteria 1100
346 Ga0495619_0000066 3300053085 Bacteria 83667
347 Ga0495619_0051606 3300053085 Bacteria 2718
348 Ga0495619_0281243 3300053085 Bacteria 1153
349 Ga0500647_0423607 3300053091 Bacteria 533
350 Ga0500566_0000056 3300053094 Bacteria 53974
351 Ga0500566_0065236 3300053094 Bacteria 2054
352 Ga0500640_005083 3300053095 Bacteria 4861
353 Ga0500554_016949 3300053102 Bacteria 1937
354 Ga0500572_000724 3300053111 Bacteria 10668
355 Ga0500591_017742 3300053115 Bacteria 3440
356 Ga0500593_125307 3300053117 Bacteria 1035
357 Ga0500595_001347 3300053119 Bacteria 13271
358 Ga0500595_019483 3300053119 Bacteria 2461
359 Ga0500608_058462 3300053122 Bacteria 1846
360 Ga0500614_000963 3300053123 Bacteria 7160
361 Ga0500658_0116077 3300053134 Bacteria 1183
362 Ga0500559_0004908 3300053136 Bacteria 6230
363 Ga0500564_325670 3300053138 Bacteria 580
364 Ga0500568_0045540 3300053139 Bacteria 1745
365 Ga0500590_232280 3300053148 Bacteria 750
366 Ga0500603_000723 3300053150 Bacteria 8044
367 Ga0500603_101547 3300053150 Bacteria 855
368 Ga0500630_033209 3300053159 Bacteria 2531
369 Ga0500639_000622 3300053163 Bacteria 17806
370 Ga0500639_107433 3300053163 Bacteria 1363
371 Ga0500637_0000243 3300053178 Bacteria 20274
372 Ga0500637_0046673 3300053178 Bacteria 2459
373 Ga0500637_0062572 3300053178 Bacteria 2132
374 Ga0500596_004005 3300053735 Bacteria 2741
375 2904695608 2904690495 Bacteria 9412302
376 2908764137 2908756301 Bacteria 8864324
377 Ga0105246_10408955
378 JGI24740J21852_10028543
379 JGI24738J21930_10021607
380 JGI25405J52794_10026794
381 Ga0070680_101286356
382 Ga0070661_100636068
383 Ga0070675_100517807
384 Ga0070709_10021403
385 Ga0070714_100357506
386 Ga0070714_101176824
387 Ga0070713_101355094
388 Ga0070710_10015263
389 Ga0070710_10536673
390 Ga0070711_100031727
391 Ga0070711_100067864
392 Ga0070711_101362133
393 Ga0070708_100523971
394 Ga0070663_100008818
395 Ga0070662_101458798
396 Ga0070681_10668182
397 Ga0070706_100246653
398 Ga0070706_101602812
399 Ga0068853_100065825
400 Ga0070696_101544752
401 Ga0070665_100122485
402 Ga0068855_100261442
403 Ga0068855_101152586
404 Ga0068857_100147082
405 Ga0068854_100031071
406 Ga0068856_100275555
407 Ga0068852_100217322
408 Ga0068851_10003652
409 Ga0068863_101104560
410 Ga0068860_100000251
411 Ga0081455_10025968
412 Ga0081540_1052335
413 Ga0081539_10002294
414 Ga0070717_10018516
415 Ga0070717_10947753
416 Ga0070717_10973270
417 Ga0075365_10017288
418 Ga0075365_10281866
419 Ga0075368_10068235
420 Ga0075363_100059481
421 Ga0070715_10952162
422 Ga0070716_100041581
423 Ga0070712_100118872
424 Ga0070712_100249356
425 Ga0070712_100271895
426 Ga0070712_100514647
427 Ga0075362_10089992
428 Ga0075367_10022131
429 Ga0075369_10003142
430 Ga0075434_100013157
431 Ga0075434_100013416
432 Ga0068865_101133638
433 Ga0075436_100203074
434 Ga0099794_10142975
435 Ga0105240_10032407
436 Ga0105240_11471990
437 Ga0111539_10321594
438 Ga0105243_10601064
439 Ga0105241_10002070
440 Ga0105241_11853559
441 Ga0105237_10286779
442 Ga0105237_10677164
443 Ga0105237_10831303
444 Ga0105238_10003705
445 Ga0105238_10187370
446 Ga0099796_10200913
447 Ga0105239_10012498
448 Ga0157369_10201477
449 Ga0163162_10415869
450 Ga0213873_10073827
451 Ga0213876_10164626
452 Ga0213875_10240715
453 Ga0213871_10085726
454 Ga0207697_10027329
455 Ga0207656_10044603
456 Ga0207699_10007596
457 Ga0207699_10380148
458 Ga0207684_10089054
459 Ga0207654_10000131
460 Ga0207695_10000506
461 Ga0207671_10195152
462 Ga0207671_10199907
463 Ga0207671_10617303
464 Ga0207693_10079505
465 Ga0207663_10289967
466 Ga0207663_11166514
467 Ga0207649_10426595
468 Ga0207694_10000086
469 Ga0207694_10709369
470 Ga0207659_10415071
471 Ga0207700_10075091
472 Ga0207700_10744338
473 Ga0207664_10301585
474 Ga0207644_10576776
475 Ga0207704_10851916
476 Ga0207665_10030788
477 Ga0207665_11008247
478 Ga0207689_10072766
479 Ga0207667_10013204
480 Ga0207667_10309441
481 Ga0207667_10615793
482 Ga0207658_11473306
483 Ga0207678_10085370
484 Ga0207702_10000098
485 Ga0207702_11156135
486 Ga0207641_10303379
487 Ga0207674_10166727
488 Ga0209179_1007889
489 Ga0209588_1031722
490 Ga0209588_1070262
491 Ga0209588_1121253
492 Ga0209813_10006761
493 Ga0207428_10768092
494 Ga0268266_10429355
495 Ga0268265_10538877
496 Ga0268264_10000051
497 Ga0307511_10211746
498 Ga0265325_10114818
499 Ga0265313_10100300
500 Ga0307508_10000114
501 Ga0307508_10082442
502 Ga0307508_10177565
503 Ga0307508_10415870
504 Ga0307516_10001674
505 Ga0307516_10260360
506 Ga0307507_10012898
507 Ga0373926_0158273
508 Ga0373934_0005514
509 Ga0373934_0104823
510 Ga0373944_0077732
511 Ga0373949_0270576
512 Ga0373923_0166772
513 Ga0373923_0579530
514 Ga0373923_0600069
515 Ga0373936_0048732
516 Ga0373936_0050746
517 Ga0373936_0072044
518 Ga0373945_0004300
519 Ga0373945_0005945
520 Ga0373945_0029865
521 Ga0373953_0002803
522 Ga0373953_0038438
523 Ga0373954_0005204
524 Ga0373954_0114592
525 Ga0373956_0008461
526 Ga0373956_0178464
527 Ga0373957_0040043
528 Ga0373960_0327535
529 Ga0373943_0001745
530 Ga0373946_0002595
531 Ga0373946_0003559
532 Ga0373955_0001254
533 Ga0373955_0078324
534 Ga0373924_0001548
535 Ga0373924_0076116
536 Ga0373931_0329196
537 Ga0373935_0000328
538 Ga0373935_0004624
539 Ga0373935_0010091
540 Ga0373935_0032240
541 Ga0373935_0171250
542 Ga0373927_0006202
543 Ga0373927_0067977
544 Ga0373927_0102581
545 Ga0373927_0282170
546 Ga0373927_0404303
547 Ga0373933_0000290
548 Ga0373933_0029643
549 Ga0373933_0102458
550 Ga0373933_0461387
551 Ga0373933_0509191
552 Ga0373947_0009098
553 Ga0373947_0010847
554 Ga0373947_0128748
555 Ga0373947_0378739
556 Ga0373947_0427314
557 Ga0373947_0538810
558 Ga0373937_0000365
559 Ga0373937_0534453
560 Ga0373937_0881708
561 Ga0372808_001084
562 Ga0373925_0000038
563 Ga0373925_0003269
564 Ga0373925_0056491
565 Ga0373925_0149516
566 Ga0373925_0285478
567 Ga0395899_0085567
568 Ga0395900_0810985
569 Ga0436364_1350268
570 Ga0436364_1385829
571 Ga0395901_0509178
572 Ga0436365_1841604
573 Ga0436361_0722528
574 Ga0436361_0801319
575 Ga0436363_1451784
576 Ga0436362_0807531
577 Ga0451804_0317326
578 Ga0451843_1010641
579 Ga0451843_1388868
580 Ga0439435_0287430
581 Ga0466963_0182099
582 Ga0466968_0210613
583 Ga0466970_0047235
584 Ga0466959_0102781
585 Ga0466967_0600877
586 Ga0495592_0000062
587 Ga0495592_0036174
588 Ga0495603_0063724
589 Ga0495629_0007057
590 Ga0495629_0098265
591 Ga0495641_0442334
592 Ga0495651_0000935
593 Ga0495651_0033717
594 Ga0495653_0000075
595 Ga0495653_0076069
596 Ga0495580_0282352
597 Ga0495582_0088016
598 Ga0495662_0009191
599 Ga0495662_0228406
600 Ga0495662_0261503
601 Ga0495662_0331074
602 Ga0495664_0000009
603 Ga0495664_0770462
604 Ga0495584_0032972
605 Ga0495594_0308337
606 Ga0495606_0113628
607 Ga0495608_0000061
608 Ga0495618_0000016
609 Ga0495618_0017687
610 Ga0495618_0099163
611 Ga0495628_0000012
612 Ga0495628_0157928
613 Ga0495628_0358000
614 Ga0495630_0002768
615 Ga0495630_0010617
616 Ga0495630_0177406
617 Ga0495630_0383838
618 Ga0495648_0001338
619 Ga0495666_0156981
620 Ga0495652_0000021
621 Ga0495652_0145602
622 Ga0495652_0759919
623 Ga0495665_0039700
624 Ga0495665_0104526
625 Ga0495640_0000031
626 Ga0495640_0013952
627 Ga0495640_0031937
628 Ga0495640_0104949
629 Ga0495586_0564329
630 Ga0495587_0000052
631 Ga0495587_0148417
632 Ga0495645_0000254
633 Ga0495622_0036790
634 Ga0495667_0000011
635 Ga0495667_0054128
636 Ga0495634_0000080
637 Ga0495634_0062595
638 Ga0495634_0244870
639 Ga0495635_0000018
640 Ga0495635_0105783
641 Ga0495635_0107309
642 Ga0495657_0000308
643 Ga0495657_0323866
644 Ga0495599_0000128
645 Ga0495599_0237693
646 Ga0495623_0001080
647 Ga0495646_0000038
648 Ga0495646_0132186
649 Ga0495647_0054121
650 Ga0495658_0097493
651 Ga0495658_0111715
652 Ga0495613_0024336
653 Ga0495613_0072226
654 Ga0495613_0082227
655 Ga0495624_0171941
656 Ga0495624_0657952
657 Ga0495600_0000822
658 Ga0495581_0012282
659 Ga0495581_0089317
660 Ga0495581_0158076
661 Ga0495581_0318380
662 Ga0495581_0586656
663 Ga0495604_0000011
664 Ga0495604_0172865
665 Ga0495674_0000015
666 Ga0495674_0013032
667 Ga0495674_0097152
668 Ga0495674_0140011
669 Ga0495674_0255623
670 Ga0495672_0170053
671 Ga0495672_0437609
672 Ga0495676_0017130
673 Ga0495676_0262465
674 Ga0495680_0080214
675 Ga0495675_0000424
676 Ga0495675_0020845
677 Ga0495673_0085882
678 Ga0495684_0000012
679 Ga0495684_0000987
680 Ga0495684_0080412
681 Ga0495593_0000789
682 Ga0495593_0040992
683 Ga0495593_0654437
684 Ga0495602_0000018
685 Ga0496100_1374827
686 Ga0496106_0493189
687 Ga0496110_1582704
688 Ga0496114_0254843
689 Ga0496114_0583077
690 Ga0496115_0517470
691 Ga0496115_0808719
692 Ga0496121_0001674
693 Ga0496121_0197356
694 Ga0496126_0028469
695 Ga0496126_0177289
696 Ga0496126_0312219
697 Ga0496126_0647465
698 Ga0501067_0635104
699 nmdc:mga03683_84246_c1
700 nmdc:mga00v17_195320_c1
701 nmdc:mga06z11_28766_c1
702 nmdc:mga06z11_74100_c1
703 nmdc:mga04h51_171177_c1
704 nmdc:mga05p37_264846_c1
705 nmdc:mga08y16_258590_c1
706 nmdc:mga08y16_421017_c1
707 nmdc:mga0n895_14101_c1
708 nmdc:mga0n895_39037_c1
709 nmdc:mga0n895_42531_c1
710 Ga0495601_0000015
711 Ga0495601_0003928
712 Ga0495601_0344540
713 Ga0495612_0000016
714 Ga0495612_0026181
715 Ga0495612_0099658
716 Ga0495612_0107787
717 Ga0495612_0227873
718 Ga0500635_0004538
719 Ga0500635_0127933
720 Ga0495595_0000037
721 Ga0495595_0163095
722 Ga0495619_0000066
723 Ga0495619_0051606
724 Ga0495619_0281243
725 Ga0500647_0423607
726 Ga0500566_0000056
727 Ga0500566_0065236
728 Ga0500640_005083
729 Ga0500554_016949
730 Ga0500572_000724
731 Ga0500591_017742
732 Ga0500593_125307
733 Ga0500595_001347
734 Ga0500595_019483
735 Ga0500608_058462
736 Ga0500614_000963
737 Ga0500658_0116077
738 Ga0500559_0004908
739 Ga0500564_325670
740 Ga0500568_0045540
741 Ga0500590_232280
742 Ga0500603_000723
743 Ga0500603_101547
744 Ga0500630_033209
745 Ga0500639_000622
746 Ga0500639_107433
747 Ga0500637_0000243
748 Ga0500637_0046673
749 Ga0500637_0062572
750 Ga0500596_004005
751 2904695608
752 2908764137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

33

167

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9049 9 143
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.9041 7 143
1ljl-assembly1.cif.gz_A wild type pi258 s. aureus arsenate reductase 0.8902 8 143
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.8848 7 143
1jl3-assembly1.cif.gz_A crystal structure of b. subtilis arsc 0.8838 9 149
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8699 9 149 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8645 9 149 3.40.50.2300
3rh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8616 8 143 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8564 9 149 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8469 9 149 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A848JZK5-F1-model_v4 Protein-tyrosine-phosphatase 0.9941 15 145 GO:0046685
AF-A0A4Q3FGG8-F1-model_v4 Low molecular weight phosphatase family protein 0.9935 15 133 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A7C5KTW2-F1-model_v4 Low molecular weight phosphatase family protein 0.9891 12 145 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A0Q6KUI4-F1-model_v4 ArsC family transcriptional regulator 0.9889 8 146 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A6M1M6F0-F1-model_v4 Low molecular weight phosphatase family protein 0.9888 8 144 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Map