F427312

General Info

Members Datasets Scaffolds Average Seq Length
376 203 753 283

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100083911|Ga0075428_1000839114
Length 326
Sequence MTGLQRLARLKKALPNMSVHHTLWPMGGMMIRNTFFGCTLLLVLGVFLATSGYAQPPPHAPRAAKHAKVPKQAAAPTVKPVLEPKALEILKAASDRLAAAHSMSFTAVISYESPSRLGPPLVYTTTSEVMLQRPDKLRVITPGDGPASEFYYDGKTMTAFEPAANLVAVADAPPTIDAALKAAYDAAAIYFPFTDVIVTDPYQGIADGLQHAFYIGQSRVVGGTTTDMVAIVNTWVFEQIWIGADDKLPRKARAVFLADPSRLRHEIAFSQWQLDPAVPAEAFASASATSAPRIAFTRPDLKLPPGLKPPAPGKVSTTQSKLSTTQ

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
200 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
201 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
202 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
203 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 7.18
Rhizosphere 87.23
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100083911 3300006844 Bacteria 3476
2 JGI24739J22299_10026429 3300001989 Bacteria 2037
3 rootH2_10018765 3300003320 Bacteria 24216
4 rootL2_10110157 3300003322 Bacteria 3569
5 rootH1_10053916 3300003316 Bacteria 3566
6 rootH1_10053916 3300003323 Bacteria 10660
7 Ga0070670_100129209 3300005331 Bacteria 2181
8 Ga0070666_10012445 3300005335 Bacteria 5367
9 Ga0068868_100179239 3300005338 Unclassified 1757
10 Ga0070669_100193808 3300005353 Bacteria 1595
11 Ga0070675_100011462 3300005354 Bacteria 6941
12 Ga0070673_100341928 3300005364 Bacteria 1326
13 Ga0070673_100400584 3300005364 Unclassified 1227
14 Ga0070667_100038073 3300005367 Bacteria 4032
15 Ga0070667_100075269 3300005367 Bacteria 2882
16 Ga0070714_100008764 3300005435 Bacteria 7909
17 Ga0070713_100020623 3300005436 Bacteria 5056
18 Ga0070711_100126500 3300005439 Unclassified 1898
19 Ga0070678_100002243 3300005456 Bacteria 10514
20 Ga0070678_100009553 3300005456 Bacteria 5883
21 Ga0070678_100023316 3300005456 Bacteria 4122
22 Ga0068867_100104766 3300005459 Unclassified 2165
23 Ga0068867_100317736 3300005459 Unclassified 1289
24 Ga0070706_100064084 3300005467 Bacteria 3397
25 Ga0070706_100343356 3300005467 Bacteria 1392
26 Ga0070684_100259923 3300005535 Unclassified 1588
27 Ga0070672_100016271 3300005543 Bacteria 5321
28 Ga0070672_100115199 3300005543 Bacteria 2195
29 Ga0070665_100006367 3300005548 Bacteria 12036
30 Ga0070665_100045436 3300005548 Unclassified 4411
31 Ga0070665_100249690 3300005548 Bacteria 1775
32 Ga0070665_100321713 3300005548 Unclassified 1551
33 Ga0068864_100121272 3300005618 Bacteria 2338
34 Ga0068864_100326740 3300005618 Bacteria 1442
35 Ga0068863_100059724 3300005841 Bacteria 3608
36 Ga0068858_100366456 3300005842 Unclassified 1381
37 Ga0081538_10026042 3300005981 Bacteria 4104
38 Ga0070717_10182445 3300006028 Bacteria 1830
39 Ga0097621_100128524 3300006237 Bacteria 2154
40 Ga0068871_100015139 3300006358 Bacteria 5766
41 Ga0068871_100023268 3300006358 Bacteria 4790
42 Ga0068871_100171421 3300006358 Bacteria 1860
43 Ga0068871_100262057 3300006358 Unclassified 1508
44 Ga0075428_100026600 3300006844 Bacteria 6405
45 Ga0075428_100051803 3300006844 Bacteria 4501
46 Ga0075428_100102686 3300006844 Bacteria 3118
47 Ga0075430_100219164 3300006846 Bacteria 1579
48 Ga0075431_100048896 3300006847 Bacteria 4361
49 Ga0075431_100235987 3300006847 Bacteria 1862
50 Ga0075431_100323831 3300006847 Bacteria 1554
51 Ga0075431_100347717 3300006847 Unclassified 1491
52 Ga0075433_10430399 3300006852 Bacteria 1163
53 Ga0075429_100464675 3300006880 Bacteria 1109
54 Ga0111539_10080601 3300009094 Bacteria 3829
55 Ga0105245_10224668 3300009098 Bacteria 1813
56 Ga0105243_10031030 3300009148 Unclassified 4120
57 Ga0105242_10018088 3300009176 Bacteria 5505
58 Ga0105242_10162787 3300009176 Bacteria 1954
59 Ga0105242_10329823 3300009176 Unclassified 1403
60 Ga0157374_10225035 3300013296 Bacteria 1842
61 Ga0163162_10033626 3300013306 Bacteria 5096
62 Ga0163162_10037600 3300013306 Bacteria 4830
63 Ga0163162_10173868 3300013306 Bacteria 2278
64 Ga0157375_10045549 3300013308 Bacteria 4270
65 Ga0157375_10175839 3300013308 Unclassified 2290
66 Ga0157375_10342897 3300013308 Bacteria 1659
67 Ga0163163_10114299 3300014325 Bacteria 2730
68 Ga0182008_10001476 3300014497 Bacteria 15726
69 Ga0157376_10000322 3300014969 Bacteria 32155
70 Ga0157376_10111537 3300014969 Bacteria 2408
71 Ga0157376_10145119 3300014969 Bacteria 2134
72 Ga0157376_10195177 3300014969 Bacteria 1859
73 Ga0157376_10268296 3300014969 Bacteria 1602
74 Ga0182006_1026381 3300015261 Bacteria 2379
75 Ga0182007_10004515 3300015262 Bacteria 6291
76 Ga0163161_10170018 3300017792 Unclassified 1666
77 Ga0209759_1010877 3300025256 Bacteria 2631
78 Ga0207692_10037333 3300025898 Bacteria 2376
79 Ga0207688_10057547 3300025901 Unclassified 2186
80 Ga0207680_10031974 3300025903 Bacteria 2986
81 Ga0207647_10013760 3300025904 Bacteria 5602
82 Ga0207699_10012247 3300025906 Bacteria 4359
83 Ga0207645_10033860 3300025907 Bacteria 3283
84 Ga0207681_10189669 3300025923 Unclassified 1572
85 Ga0207687_10383973 3300025927 Bacteria 1151
86 Ga0207664_10084484 3300025929 Bacteria 2589
87 Ga0207686_10196891 3300025934 Bacteria 1440
88 Ga0207709_10415311 3300025935 Bacteria 1032
89 Ga0207669_10382215 3300025937 Unclassified 1097
90 Ga0207665_10107880 3300025939 Bacteria 1953
91 Ga0207691_10013882 3300025940 Bacteria 7687
92 Ga0207691_10034604 3300025940 Bacteria 4696
93 Ga0207691_10072626 3300025940 Unclassified 3103
94 Ga0207691_10091411 3300025940 Bacteria 2727
95 Ga0207689_10130425 3300025942 Bacteria 2069
96 Ga0207651_10439945 3300025960 Bacteria 1117
97 Ga0207668_10030699 3300025972 Bacteria 3534
98 Ga0207658_10052820 3300025986 Bacteria 3000
99 Ga0207658_10062136 3300025986 Bacteria 2794
100 Ga0207658_10089799 3300025986 Unclassified 2380
101 Ga0207677_10246887 3300026023 Unclassified 1447
102 Ga0207703_10053019 3300026035 Bacteria 3296
103 Ga0207703_10349525 3300026035 Unclassified 1361
104 Ga0207641_10100614 3300026088 Bacteria 2546
105 Ga0207641_10121431 3300026088 Bacteria 2332
106 Ga0207641_10169627 3300026088 Unclassified 1991
107 Ga0207648_10107264 3300026089 Bacteria 2451
108 Ga0207648_10163794 3300026089 Unclassified 1964
109 Ga0207683_10002843 3300026121 Bacteria 15118
110 Ga0207683_10010346 3300026121 Bacteria 7957
111 Ga0207683_10032926 3300026121 Bacteria 4503
112 Ga0207683_10129430 3300026121 Bacteria 2270
113 Ga0268266_10020437 3300028379 Bacteria 5644
114 Ga0268266_10239428 3300028379 Bacteria 1674
115 Ga0268266_10242682 3300028379 Bacteria 1663
116 Ga0265318_10025413 3300028577 Bacteria 2338
117 Ga0265330_10000948 3300031235 Bacteria 17890
118 Ga0265332_10020669 3300031238 Bacteria 2906
119 Ga0265328_10012659 3300031239 Bacteria 3355
120 Ga0265325_10033852 3300031241 Bacteria 2723
121 Ga0265329_10002504 3300031242 Bacteria 8297
122 Ga0265331_10001617 3300031250 Bacteria 16448
123 Ga0265327_10008991 3300031251 Bacteria 7315
124 Ga0265316_10049040 3300031344 Bacteria 3328
125 Ga0265316_10291351 3300031344 Bacteria 1191
126 Ga0316575_10007274 3300031665 Bacteria 4007
127 Ga0265314_10007319 3300031711 Bacteria 9585
128 Ga0265342_10031895 3300031712 Bacteria 3253
129 Ga0373953_0057589 3300035117 Bacteria 1583
130 Ga0373954_0017719 3300035118 Bacteria 3201
131 Ga0373954_0130492 3300035118 Bacteria 1223
132 Ga0373954_0165810 3300035118 Bacteria 1081
133 Ga0373956_0018967 3300035119 Bacteria 2913
134 Ga0373956_0118917 3300035119 Bacteria 1233
135 Ga0373943_0017113 3300035170 Bacteria 3316
136 Ga0373955_0025812 3300035172 Bacteria 3021
137 Ga0316574_0007812 3300035398 Bacteria 5895
138 Ga0316574_0165512 3300035398 Bacteria 1424
139 Ga0373924_0017462 3300035410 Bacteria 2753
140 Ga0373924_0112364 3300035410 Bacteria 1178
141 Ga0373935_0141014 3300035692 Bacteria 1628
142 Ga0373927_0002649 3300035695 Bacteria 13041
143 Ga0373927_0038032 3300035695 Bacteria 3126
144 Ga0373927_0196628 3300035695 Bacteria 1323
145 Ga0373927_0242314 3300035695 Bacteria 1185
146 Ga0373933_0022590 3300035724 Bacteria 3584
147 Ga0373933_0054324 3300035724 Unclassified 2400
148 Ga0373947_0050021 3300035725 Bacteria 2512
149 Ga0373937_0051451 3300036401 Bacteria 3776
150 Ga0373937_0065193 3300036401 Bacteria 3352
151 Ga0373937_0129704 3300036401 Bacteria 2354
152 Ga0373937_0162710 3300036401 Unclassified 2092
153 Ga0373937_0504525 3300036401 Bacteria 1149
154 Ga0373925_0013489 3300037068 Bacteria 5915
155 Ga0373925_0369528 3300037068 Unclassified 1167
156 Ga0436360_0369386 3300039438 Bacteria 929
157 Ga0436361_0106249 3300039447 Unclassified 1828
158 Ga0436363_0311639 3300039450 Bacteria 1253
159 Ga0436362_1023807 3300039453 Unclassified 898
160 Ga0495592_0112133 3300046454 Bacteria 1928
161 Ga0495592_0173929 3300046454 Bacteria 1472
162 Ga0495603_0004701 3300046455 Bacteria 8153
163 Ga0495603_0005462 3300046455 Bacteria 7587
164 Ga0495603_0076594 3300046455 Unclassified 1963
165 Ga0495590_0015424 3300046457 Bacteria 2773
166 Ga0495590_0017268 3300046457 Bacteria 2599
167 Ga0495629_0000016 3300046459 Bacteria 171453
168 Ga0495629_0001611 3300046459 Bacteria 17731
169 Ga0495638_0010477 3300046460 Bacteria 6430
170 Ga0495641_0018703 3300046461 Bacteria 3568
171 Ga0495641_0019777 3300046461 Bacteria 3434
172 Ga0495653_0001372 3300046463 Bacteria 18922
173 Ga0495653_0018682 3300046463 Bacteria 5627
174 Ga0495653_0044864 3300046463 Bacteria 3429
175 Ga0495653_0089968 3300046463 Bacteria 2247
176 Ga0495650_0023461 3300046471 Bacteria 2937
177 Ga0495580_0005558 3300046472 Bacteria 10393
178 Ga0495580_0007139 3300046472 Bacteria 8995
179 Ga0495580_0118032 3300046472 Bacteria 1842
180 Ga0495582_0004252 3300046473 Bacteria 8051
181 Ga0495582_0026372 3300046473 Bacteria 3185
182 Ga0495582_0092943 3300046473 Bacteria 1683
183 Ga0495605_0004128 3300046474 Bacteria 8560
184 Ga0495605_0006147 3300046474 Bacteria 6921
185 Ga0495639_0001343 3300046475 Bacteria 11040
186 Ga0495662_0018490 3300046476 Bacteria 3374
187 Ga0495662_0100890 3300046476 Bacteria 1412
188 Ga0495664_0000442 3300046477 Bacteria 20390
189 Ga0495664_0004298 3300046477 Bacteria 7779
190 Ga0495664_0016257 3300046477 Bacteria 4238
191 Ga0495664_0051743 3300046477 Bacteria 2439
192 Ga0495664_0204162 3300046477 Bacteria 1197
193 Ga0495594_0021225 3300046499 Bacteria 3465
194 Ga0495594_0167132 3300046499 Bacteria 1251
195 Ga0495596_0023537 3300046500 Bacteria 2498
196 Ga0495583_0005454 3300046506 Bacteria 8640
197 Ga0495608_0001161 3300046511 Bacteria 18628
198 Ga0495608_0197270 3300046511 Bacteria 1269
199 Ga0495616_0052406 3300046513 Bacteria 2032
200 Ga0495618_0003801 3300046514 Bacteria 9342
201 Ga0495618_0094483 3300046514 Bacteria 1912
202 Ga0495618_0106622 3300046514 Bacteria 1794
203 Ga0495620_0002983 3300046515 Bacteria 9739
204 Ga0495628_0012784 3300046516 Bacteria 7068
205 Ga0495628_0067333 3300046516 Bacteria 2796
206 Ga0495628_0069368 3300046516 Bacteria 2749
207 Ga0495628_0256241 3300046516 Bacteria 1305
208 Ga0495630_0019707 3300046517 Bacteria 4962
209 Ga0495630_0028415 3300046517 Bacteria 4155
210 Ga0495644_0078393 3300046523 Bacteria 1245
211 Ga0495648_0001256 3300046524 Bacteria 25317
212 Ga0495648_0028436 3300046524 Bacteria 3724
213 Ga0495648_0058383 3300046524 Bacteria 2307
214 Ga0495648_0078194 3300046524 Bacteria 1892
215 Ga0495648_0180991 3300046524 Bacteria 1071
216 Ga0495666_0004954 3300046526 Bacteria 6745
217 Ga0495666_0007106 3300046526 Bacteria 5627
218 Ga0495666_0007385 3300046526 Bacteria 5507
219 Ga0495666_0009316 3300046526 Bacteria 4911
220 Ga0495666_0016238 3300046526 Bacteria 3708
221 Ga0495652_0053360 3300046529 Bacteria 3445
222 Ga0495652_0281653 3300046529 Bacteria 1217
223 Ga0495665_0000520 3300046531 Bacteria 19479
224 Ga0495665_0008622 3300046531 Bacteria 5533
225 Ga0495665_0031138 3300046531 Bacteria 2855
226 Ga0495640_0070995 3300046533 Bacteria 2337
227 Ga0495640_0136486 3300046533 Bacteria 1584
228 Ga0495640_0178975 3300046533 Bacteria 1352
229 Ga0495586_0020606 3300046535 Bacteria 3510
230 Ga0495586_0074378 3300046535 Bacteria 1859
231 Ga0495587_0005180 3300046536 Bacteria 8520
232 Ga0495587_0020763 3300046536 Bacteria 4051
233 Ga0495598_0015313 3300046537 Bacteria 1934
234 Ga0495621_0122725 3300046539 Bacteria 1005
235 Ga0495597_0077019 3300046542 Bacteria 1430
236 Ga0495597_0107417 3300046542 Bacteria 1172
237 Ga0495645_0000905 3300046543 Bacteria 20186
238 Ga0495645_0001742 3300046543 Bacteria 14783
239 Ga0495645_0123846 3300046543 Bacteria 1818
240 Ga0495622_0001172 3300046557 Bacteria 13567
241 Ga0495622_0003505 3300046557 Bacteria 7396
242 Ga0495622_0022424 3300046557 Bacteria 2942
243 Ga0495667_0008239 3300046559 Bacteria 7067
244 Ga0495667_0027771 3300046559 Bacteria 3811
245 Ga0495634_0003522 3300046642 Bacteria 12540
246 Ga0495634_0097986 3300046642 Bacteria 1897
247 Ga0495634_0149667 3300046642 Bacteria 1477
248 Ga0495611_0066662 3300046648 Bacteria 1642
249 Ga0495635_0001391 3300046663 Bacteria 16138
250 Ga0495635_0006243 3300046663 Bacteria 8302
251 Ga0495661_0036391 3300046665 Bacteria 3083
252 Ga0495661_0061056 3300046665 Bacteria 2238
253 Ga0495588_0030449 3300046674 Bacteria 2713
254 Ga0495588_0077814 3300046674 Bacteria 1730
255 Ga0495599_0019712 3300046678 Bacteria 4204
256 Ga0495599_0166603 3300046678 Bacteria 1361
257 Ga0495623_0159549 3300046679 Bacteria 1326
258 Ga0495646_0002047 3300046680 Bacteria 12230
259 Ga0495646_0008468 3300046680 Bacteria 6530
260 Ga0495646_0029725 3300046680 Bacteria 3414
261 Ga0495646_0132873 3300046680 Bacteria 1400
262 Ga0495646_0174622 3300046680 Unclassified 1182
263 Ga0495613_0001179 3300046689 Bacteria 19959
264 Ga0495613_0053535 3300046689 Bacteria 2970
265 Ga0495613_0089325 3300046689 Bacteria 2232
266 Ga0495624_0004556 3300046690 Bacteria 10120
267 Ga0495624_0009308 3300046690 Bacteria 6806
268 Ga0495624_0021117 3300046690 Bacteria 4323
269 Ga0495670_0000914 3300046691 Bacteria 14240
270 Ga0495649_0003969 3300046694 Bacteria 9766
271 Ga0495589_0035503 3300046794 Bacteria 2500
272 Ga0495589_0154853 3300046794 Bacteria 1093
273 Ga0495600_0017411 3300046809 Bacteria 4571
274 Ga0495600_0055822 3300046809 Bacteria 2579
275 Ga0495660_0061439 3300046810 Bacteria 2016
276 Ga0495660_0172252 3300046810 Bacteria 1053
277 Ga0495581_0020295 3300047315 Bacteria 3857
278 Ga0495581_0038879 3300047315 Bacteria 2754
279 Ga0495604_0011936 3300047317 Bacteria 6907
280 Ga0495604_0030289 3300047317 Bacteria 4298
281 Ga0495674_0005448 3300047319 Bacteria 12229
282 Ga0495674_0015731 3300047319 Bacteria 7062
283 Ga0495674_0023927 3300047319 Bacteria 5621
284 Ga0495674_0031961 3300047319 Bacteria 4777
285 Ga0495674_0217240 3300047319 Bacteria 1581
286 Ga0495672_0001085 3300047320 Bacteria 27644
287 Ga0495672_0089532 3300047320 Bacteria 1693
288 Ga0495676_0008407 3300047321 Bacteria 9462
289 Ga0495676_0119338 3300047321 Bacteria 1921
290 Ga0495676_0161263 3300047321 Bacteria 1586
291 Ga0495680_0003626 3300047322 Bacteria 15101
292 Ga0495680_0007194 3300047322 Bacteria 10253
293 Ga0495680_0090259 3300047322 Bacteria 2299
294 Ga0495680_0120541 3300047322 Bacteria 1937
295 Ga0495683_0002558 3300047323 Bacteria 10928
296 Ga0495675_0002597 3300047444 Bacteria 10823
297 Ga0495675_0008546 3300047444 Bacteria 6346
298 Ga0495675_0059952 3300047444 Bacteria 2413
299 Ga0495675_0075900 3300047444 Bacteria 2118
300 Ga0495675_0167418 3300047444 Bacteria 1351
301 Ga0495679_000099 3300047446 Bacteria 79098
302 Ga0495679_000151 3300047446 Bacteria 62606
303 Ga0495673_0028844 3300047469 Bacteria 2624
304 Ga0495673_0042038 3300047469 Bacteria 2054
305 Ga0495686_0018293 3300047472 Bacteria 4706
306 Ga0495593_0019711 3300047673 Bacteria 3780
307 Ga0495593_0030807 3300047673 Bacteria 2933
308 Ga0495593_0042007 3300047673 Bacteria 2455
309 Ga0495602_0003328 3300048088 Bacteria 16594
310 Ga0495602_0012525 3300048088 Bacteria 8709
311 Ga0495602_0064768 3300048088 Bacteria 3157
312 Ga0495602_0093738 3300048088 Bacteria 2483
313 Ga0495602_0113257 3300048088 Bacteria 2199
314 Ga0495602_0175746 3300048088 Bacteria 1657
315 Ga0495602_0260893 3300048088 Bacteria 1285
316 Ga0495614_0003400 3300048089 Bacteria 7118
317 Ga0495626_0011202 3300048091 Bacteria 4750
318 Ga0495626_0032196 3300048091 Bacteria 2519
319 Ga0495626_0078544 3300048091 Bacteria 1470
320 Ga0496100_0005225 3300048903 Bacteria 6972
321 Ga0496100_0354591 3300048903 Bacteria 1108
322 Ga0496101_0000577 3300048904 Bacteria 22443
323 Ga0496101_0018267 3300048904 Bacteria 4767
324 Ga0496102_0107986 3300048905 Bacteria 2592
325 Ga0496102_0288993 3300048905 Bacteria 1545
326 Ga0496103_0008724 3300048906 Bacteria 6016
327 Ga0496104_0062270 3300048907 Bacteria 3537
328 Ga0496105_0000553 3300048908 Bacteria 24709
329 Ga0496106_0000001 3300048909 Bacteria 497458
330 Ga0496106_0014890 3300048909 Bacteria 5754
331 Ga0496106_0177906 3300048909 Bacteria 1688
332 Ga0496107_0174215 3300048910 Bacteria 1597
333 Ga0496108_0049638 3300048911 Bacteria 3510
334 Ga0496108_0139817 3300048911 Bacteria 2086
335 Ga0496109_0069693 3300048912 Bacteria 3226
336 Ga0496109_0207611 3300048912 Unclassified 1842
337 Ga0496110_0002737 3300048913 Bacteria 13310
338 Ga0496110_0019248 3300048913 Bacteria 5741
339 Ga0496110_0041608 3300048913 Bacteria 4010
340 Ga0496111_0015265 3300048914 Bacteria 5269
341 Ga0496112_0214060 3300048915 Bacteria 1884
342 Ga0496113_0079936 3300048916 Bacteria 2503
343 Ga0496113_0123690 3300048916 Unclassified 2025
344 Ga0496114_0053534 3300048917 Bacteria 3364
345 Ga0496114_0132400 3300048917 Unclassified 2154
346 Ga0496115_0120534 3300048918 Bacteria 2158
347 Ga0496117_0002712 3300048920 Bacteria 21807
348 Ga0496117_0004600 3300048920 Bacteria 15073
349 Ga0496117_0053781 3300048920 Bacteria 2826
350 Ga0496118_0001184 3300048921 Bacteria 40277
351 Ga0496118_0005141 3300048921 Bacteria 15010
352 Ga0496118_0038701 3300048921 Bacteria 3818
353 Ga0496119_0168817 3300048922 Bacteria 1157
354 Ga0496121_0001975 3300048924 Bacteria 32578
355 Ga0496121_0015069 3300048924 Bacteria 8134
356 Ga0496122_0160179 3300048925 Bacteria 1374
357 Ga0496126_0000105 3300048929 Bacteria 198893
358 Ga0496126_0343580 3300048929 Bacteria 1222
359 Ga0495682_0016812 3300049460 Bacteria 2767
360 nmdc:mga05p37_465866_c1 3300050507 Bacteria 1459
361 nmdc:mga05p37_46704_c2 3300050507 Bacteria 4826
362 nmdc:mga09592_178538_c1 3300050508 Bacteria 1836
363 nmdc:mga06r32_211827_c1 3300050510 Bacteria 1925
364 nmdc:mga06r32_253882_c1 3300050510 Bacteria 1746
365 nmdc:mga06r32_85464_c1 3300050510 Bacteria 3076
366 nmdc:mga08y16_390990_c1 3300050511 Bacteria 1425
367 Ga0495601_0000930 3300053077 Bacteria 15922
368 Ga0495612_0000701 3300053078 Bacteria 13554
369 Ga0495595_0130462 3300053084 Bacteria 1228
370 Ga0495619_0060305 3300053085 Bacteria 2521
371 Ga0495619_0134612 3300053085 Bacteria 1699
372 Ga0500651_0027659 3300053093 Unclassified 3567
373 2563057173 2562617112 Bacteria 10918404
374 2713474102 2711768613 Bacteria 11048459
375 2746085176 2744054900 Bacteria 8399525
376 2746096572 2744054901 Bacteria 8397047
377 2753566774 2751185846 Bacteria 7242164
378 Ga0075428_100083911
379 JGI24739J22299_10026429
380 rootH2_10018765
381 rootL2_10110157
382 rootH1_10053916
383 Ga0070670_100129209
384 Ga0070666_10012445
385 Ga0068868_100179239
386 Ga0070669_100193808
387 Ga0070675_100011462
388 Ga0070673_100341928
389 Ga0070673_100400584
390 Ga0070667_100038073
391 Ga0070667_100075269
392 Ga0070714_100008764
393 Ga0070713_100020623
394 Ga0070711_100126500
395 Ga0070678_100002243
396 Ga0070678_100009553
397 Ga0070678_100023316
398 Ga0068867_100104766
399 Ga0068867_100317736
400 Ga0070706_100064084
401 Ga0070706_100343356
402 Ga0070684_100259923
403 Ga0070672_100016271
404 Ga0070672_100115199
405 Ga0070665_100006367
406 Ga0070665_100045436
407 Ga0070665_100249690
408 Ga0070665_100321713
409 Ga0068864_100121272
410 Ga0068864_100326740
411 Ga0068863_100059724
412 Ga0068858_100366456
413 Ga0081538_10026042
414 Ga0070717_10182445
415 Ga0097621_100128524
416 Ga0068871_100015139
417 Ga0068871_100023268
418 Ga0068871_100171421
419 Ga0068871_100262057
420 Ga0075428_100026600
421 Ga0075428_100051803
422 Ga0075428_100102686
423 Ga0075430_100219164
424 Ga0075431_100048896
425 Ga0075431_100235987
426 Ga0075431_100323831
427 Ga0075431_100347717
428 Ga0075433_10430399
429 Ga0075429_100464675
430 Ga0111539_10080601
431 Ga0105245_10224668
432 Ga0105243_10031030
433 Ga0105242_10018088
434 Ga0105242_10162787
435 Ga0105242_10329823
436 Ga0157374_10225035
437 Ga0163162_10033626
438 Ga0163162_10037600
439 Ga0163162_10173868
440 Ga0157375_10045549
441 Ga0157375_10175839
442 Ga0157375_10342897
443 Ga0163163_10114299
444 Ga0182008_10001476
445 Ga0157376_10000322
446 Ga0157376_10111537
447 Ga0157376_10145119
448 Ga0157376_10195177
449 Ga0157376_10268296
450 Ga0182006_1026381
451 Ga0182007_10004515
452 Ga0163161_10170018
453 Ga0209759_1010877
454 Ga0207692_10037333
455 Ga0207688_10057547
456 Ga0207680_10031974
457 Ga0207647_10013760
458 Ga0207699_10012247
459 Ga0207645_10033860
460 Ga0207681_10189669
461 Ga0207687_10383973
462 Ga0207664_10084484
463 Ga0207686_10196891
464 Ga0207709_10415311
465 Ga0207669_10382215
466 Ga0207665_10107880
467 Ga0207691_10013882
468 Ga0207691_10034604
469 Ga0207691_10072626
470 Ga0207691_10091411
471 Ga0207689_10130425
472 Ga0207651_10439945
473 Ga0207668_10030699
474 Ga0207658_10052820
475 Ga0207658_10062136
476 Ga0207658_10089799
477 Ga0207677_10246887
478 Ga0207703_10053019
479 Ga0207703_10349525
480 Ga0207641_10100614
481 Ga0207641_10121431
482 Ga0207641_10169627
483 Ga0207648_10107264
484 Ga0207648_10163794
485 Ga0207683_10002843
486 Ga0207683_10010346
487 Ga0207683_10032926
488 Ga0207683_10129430
489 Ga0268266_10020437
490 Ga0268266_10239428
491 Ga0268266_10242682
492 Ga0265318_10025413
493 Ga0265330_10000948
494 Ga0265332_10020669
495 Ga0265328_10012659
496 Ga0265325_10033852
497 Ga0265329_10002504
498 Ga0265331_10001617
499 Ga0265327_10008991
500 Ga0265316_10049040
501 Ga0265316_10291351
502 Ga0316575_10007274
503 Ga0265314_10007319
504 Ga0265342_10031895
505 Ga0373953_0057589
506 Ga0373954_0017719
507 Ga0373954_0130492
508 Ga0373954_0165810
509 Ga0373956_0018967
510 Ga0373956_0118917
511 Ga0373943_0017113
512 Ga0373955_0025812
513 Ga0316574_0007812
514 Ga0316574_0165512
515 Ga0373924_0017462
516 Ga0373924_0112364
517 Ga0373935_0141014
518 Ga0373927_0002649
519 Ga0373927_0038032
520 Ga0373927_0196628
521 Ga0373927_0242314
522 Ga0373933_0022590
523 Ga0373933_0054324
524 Ga0373947_0050021
525 Ga0373937_0051451
526 Ga0373937_0065193
527 Ga0373937_0129704
528 Ga0373937_0162710
529 Ga0373937_0504525
530 Ga0373925_0013489
531 Ga0373925_0369528
532 Ga0436360_0369386
533 Ga0436361_0106249
534 Ga0436363_0311639
535 Ga0436362_1023807
536 Ga0495592_0112133
537 Ga0495592_0173929
538 Ga0495603_0004701
539 Ga0495603_0005462
540 Ga0495603_0076594
541 Ga0495590_0015424
542 Ga0495590_0017268
543 Ga0495629_0000016
544 Ga0495629_0001611
545 Ga0495638_0010477
546 Ga0495641_0018703
547 Ga0495641_0019777
548 Ga0495653_0001372
549 Ga0495653_0018682
550 Ga0495653_0044864
551 Ga0495653_0089968
552 Ga0495650_0023461
553 Ga0495580_0005558
554 Ga0495580_0007139
555 Ga0495580_0118032
556 Ga0495582_0004252
557 Ga0495582_0026372
558 Ga0495582_0092943
559 Ga0495605_0004128
560 Ga0495605_0006147
561 Ga0495639_0001343
562 Ga0495662_0018490
563 Ga0495662_0100890
564 Ga0495664_0000442
565 Ga0495664_0004298
566 Ga0495664_0016257
567 Ga0495664_0051743
568 Ga0495664_0204162
569 Ga0495594_0021225
570 Ga0495594_0167132
571 Ga0495596_0023537
572 Ga0495583_0005454
573 Ga0495608_0001161
574 Ga0495608_0197270
575 Ga0495616_0052406
576 Ga0495618_0003801
577 Ga0495618_0094483
578 Ga0495618_0106622
579 Ga0495620_0002983
580 Ga0495628_0012784
581 Ga0495628_0067333
582 Ga0495628_0069368
583 Ga0495628_0256241
584 Ga0495630_0019707
585 Ga0495630_0028415
586 Ga0495644_0078393
587 Ga0495648_0001256
588 Ga0495648_0028436
589 Ga0495648_0058383
590 Ga0495648_0078194
591 Ga0495648_0180991
592 Ga0495666_0004954
593 Ga0495666_0007106
594 Ga0495666_0007385
595 Ga0495666_0009316
596 Ga0495666_0016238
597 Ga0495652_0053360
598 Ga0495652_0281653
599 Ga0495665_0000520
600 Ga0495665_0008622
601 Ga0495665_0031138
602 Ga0495640_0070995
603 Ga0495640_0136486
604 Ga0495640_0178975
605 Ga0495586_0020606
606 Ga0495586_0074378
607 Ga0495587_0005180
608 Ga0495587_0020763
609 Ga0495598_0015313
610 Ga0495621_0122725
611 Ga0495597_0077019
612 Ga0495597_0107417
613 Ga0495645_0000905
614 Ga0495645_0001742
615 Ga0495645_0123846
616 Ga0495622_0001172
617 Ga0495622_0003505
618 Ga0495622_0022424
619 Ga0495667_0008239
620 Ga0495667_0027771
621 Ga0495634_0003522
622 Ga0495634_0097986
623 Ga0495634_0149667
624 Ga0495611_0066662
625 Ga0495635_0001391
626 Ga0495635_0006243
627 Ga0495661_0036391
628 Ga0495661_0061056
629 Ga0495588_0030449
630 Ga0495588_0077814
631 Ga0495599_0019712
632 Ga0495599_0166603
633 Ga0495623_0159549
634 Ga0495646_0002047
635 Ga0495646_0008468
636 Ga0495646_0029725
637 Ga0495646_0132873
638 Ga0495646_0174622
639 Ga0495613_0001179
640 Ga0495613_0053535
641 Ga0495613_0089325
642 Ga0495624_0004556
643 Ga0495624_0009308
644 Ga0495624_0021117
645 Ga0495670_0000914
646 Ga0495649_0003969
647 Ga0495589_0035503
648 Ga0495589_0154853
649 Ga0495600_0017411
650 Ga0495600_0055822
651 Ga0495660_0061439
652 Ga0495660_0172252
653 Ga0495581_0020295
654 Ga0495581_0038879
655 Ga0495604_0011936
656 Ga0495604_0030289
657 Ga0495674_0005448
658 Ga0495674_0015731
659 Ga0495674_0023927
660 Ga0495674_0031961
661 Ga0495674_0217240
662 Ga0495672_0001085
663 Ga0495672_0089532
664 Ga0495676_0008407
665 Ga0495676_0119338
666 Ga0495676_0161263
667 Ga0495680_0003626
668 Ga0495680_0007194
669 Ga0495680_0090259
670 Ga0495680_0120541
671 Ga0495683_0002558
672 Ga0495675_0002597
673 Ga0495675_0008546
674 Ga0495675_0059952
675 Ga0495675_0075900
676 Ga0495675_0167418
677 Ga0495679_000099
678 Ga0495679_000151
679 Ga0495673_0028844
680 Ga0495673_0042038
681 Ga0495686_0018293
682 Ga0495593_0019711
683 Ga0495593_0030807
684 Ga0495593_0042007
685 Ga0495602_0003328
686 Ga0495602_0012525
687 Ga0495602_0064768
688 Ga0495602_0093738
689 Ga0495602_0113257
690 Ga0495602_0175746
691 Ga0495602_0260893
692 Ga0495614_0003400
693 Ga0495626_0011202
694 Ga0495626_0032196
695 Ga0495626_0078544
696 Ga0496100_0005225
697 Ga0496100_0354591
698 Ga0496101_0000577
699 Ga0496101_0018267
700 Ga0496102_0107986
701 Ga0496102_0288993
702 Ga0496103_0008724
703 Ga0496104_0062270
704 Ga0496105_0000553
705 Ga0496106_0000001
706 Ga0496106_0014890
707 Ga0496106_0177906
708 Ga0496107_0174215
709 Ga0496108_0049638
710 Ga0496108_0139817
711 Ga0496109_0069693
712 Ga0496109_0207611
713 Ga0496110_0002737
714 Ga0496110_0019248
715 Ga0496110_0041608
716 Ga0496111_0015265
717 Ga0496112_0214060
718 Ga0496113_0079936
719 Ga0496113_0123690
720 Ga0496114_0053534
721 Ga0496114_0132400
722 Ga0496115_0120534
723 Ga0496117_0002712
724 Ga0496117_0004600
725 Ga0496117_0053781
726 Ga0496118_0001184
727 Ga0496118_0005141
728 Ga0496118_0038701
729 Ga0496119_0168817
730 Ga0496121_0001975
731 Ga0496121_0015069
732 Ga0496122_0160179
733 Ga0496126_0000105
734 Ga0496126_0343580
735 Ga0495682_0016812
736 nmdc:mga05p37_465866_c1
737 nmdc:mga05p37_46704_c2
738 nmdc:mga09592_178538_c1
739 nmdc:mga06r32_211827_c1
740 nmdc:mga06r32_253882_c1
741 nmdc:mga06r32_85464_c1
742 nmdc:mga08y16_390990_c1
743 Ga0495601_0000930
744 Ga0495612_0000701
745 Ga0495595_0130462
746 Ga0495619_0060305
747 Ga0495619_0134612
748 Ga0500651_0027659
749 2563057173
750 2713474102
751 2746085176
752 2746096572
753 2753566774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09865

DUF2092

Predicted periplasmic protein (DUF2092)

86

297

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mxt-assembly1.cif.gz_A-2 crystal structure of an outer-membrane lipoprotein carrier protein (bacuni_04723) from bacteroides uniformis atcc 8492 at 1.40 a resolution 0.7448 57 266
4mxt-assembly1.cif.gz_A-2 crystal structure of an outer-membrane lipoprotein carrier protein (bacuni_04723) from bacteroides uniformis atcc 8492 at 1.40 a resolution 0.7203 57 266
4ki3-assembly4.cif.gz_J 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.71 57 266
6u3s-assembly1.cif.gz_A solution nmr structure of the dnajb6b deltast variant (aligned on the ctd domain) 0.7066 179 225
4ki3-assembly4.cif.gz_L 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.6989 57 266
ID Description Score Start End Superfamily
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7971 57 266 2.50.20.10
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7696 57 266 2.50.20.10
af_Q9VAI0_12_173_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7537 206 227 3.40.630.30
4mxtA00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7359 57 266 2.50.20.10
4mxtA00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7148 57 266 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A5S4EJL8-F1-model_v4 Outer membrane protein 0.9581 61 211
AF-A0A536XJH2-F1-model_v4 DUF2092 domain-containing protein 0.9516 64 251
AF-A0A6A7LWV1-F1-model_v4 DUF2092 domain-containing protein 0.9462 75 272
AF-A0A5S4EJL8-F1-model_v4 Outer membrane protein 0.9459 61 211
AF-A0A0J6SBN5-F1-model_v4 DUF2092 domain-containing protein 0.9338 53 270

Map