F427279

General Info

Members Datasets Scaffolds Average Seq Length
376 221 752 413

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100128284|Ga0070698_1001282842
Length 436
Sequence MKVAVVGGGSTYTPELIDGFARLADQVAITEIVLVDPDQSRLAVVGPFSARIMGAYGHPAAVRWTSDLDEGLDGAGAVLLQLRIGGQAARHRDETWPLKCGSVGQETTGAGGFAKALRTVPVVLDIAERARAHALPDAWLIDFTNPVGIVTRALLDAGHRAIGLCNVAIGFQRIFAGMLGVEPDRVSLGHVGLNHLTWERAVLLDGTDVLPDLIAEHGEELAGLIELPLSVIERTHSIPSYYLRYFYAHDQVVSEQLAGPTRAEQVAEIERELLEMYADPALDHKPELLGQRGGAFYSEAAVALLASLVNDARDTQVVNVRNNGTMPFLPDEAVIEVPAVISSAGASPVSFAPLSPLMRGLTGHVSAYEELAVQAATLGGRDRVFDAMLAHPLIGQHDKAEQLTDLLLAENARFLPWAGGQDAGTDSSRSTNASGQ

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.91
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100128284 3300005471 Bacteria 2493
2 JGI24738J21930_10002358 3300002075 Bacteria 4974
3 JGI25406J46586_10001832 3300003203 Bacteria 9973
4 Ga0070658_10006816 3300005327 Bacteria 9238
5 Ga0070658_10055418 3300005327 Bacteria 3221
6 Ga0070683_100050421 3300005329 Bacteria 3853
7 Ga0070690_100020629 3300005330 Bacteria 4016
8 Ga0070666_10022317 3300005335 Bacteria 4110
9 Ga0070680_100030764 3300005336 Bacteria 4312
10 Ga0070680_100057114 3300005336 Bacteria 3190
11 Ga0068868_100034876 3300005338 Bacteria 3886
12 Ga0070660_100000770 3300005339 Bacteria 21264
13 Ga0070660_100024023 3300005339 Bacteria 4520
14 Ga0070689_100012969 3300005340 Bacteria 6019
15 Ga0070689_100049669 3300005340 Bacteria 3239
16 Ga0070661_100014016 3300005344 Bacteria 5637
17 Ga0070661_100016219 3300005344 Bacteria 5263
18 Ga0070661_100028565 3300005344 Bacteria 4023
19 Ga0070692_10028269 3300005345 Bacteria 2786
20 Ga0070668_100094702 3300005347 Bacteria 2358
21 Ga0070675_100072954 3300005354 Bacteria 2849
22 Ga0070659_100025756 3300005366 Bacteria 4523
23 Ga0070659_100103886 3300005366 Bacteria 2289
24 Ga0070667_100031866 3300005367 Bacteria 4394
25 Ga0070703_10009625 3300005406 Bacteria 2727
26 Ga0070714_100000491 3300005435 Bacteria 28628
27 Ga0070714_100124267 3300005435 Bacteria 2298
28 Ga0070713_100062083 3300005436 Bacteria 3129
29 Ga0070713_100064378 3300005436 Bacteria 3077
30 Ga0070710_10100099 3300005437 Bacteria 1724
31 Ga0070701_10054673 3300005438 Bacteria 2083
32 Ga0070705_100026952 3300005440 Bacteria 3132
33 Ga0070694_100031449 3300005444 Bacteria 3480
34 Ga0070681_10001129 3300005458 Bacteria 22933
35 Ga0070681_10011904 3300005458 Bacteria 8626
36 Ga0070681_10090277 3300005458 Bacteria 3014
37 Ga0070681_10095504 3300005458 Bacteria 2921
38 Ga0070706_100050753 3300005467 Bacteria 3828
39 Ga0070706_100079291 3300005467 Bacteria 3039
40 Ga0070706_100081510 3300005467 Bacteria 2996
41 Ga0070706_100093206 3300005467 Bacteria 2794
42 Ga0070706_100170695 3300005467 Bacteria 2031
43 Ga0070707_100028572 3300005468 Bacteria 5309
44 Ga0070707_100241640 3300005468 Bacteria 1757
45 Ga0070698_100038509 3300005471 Bacteria 4926
46 Ga0070698_100213243 3300005471 Bacteria 1865
47 Ga0070699_100000327 3300005518 Bacteria 45983
48 Ga0070699_100157500 3300005518 Bacteria 2010
49 Ga0070679_100013896 3300005530 Bacteria 7714
50 Ga0070679_100135534 3300005530 Bacteria 2443
51 Ga0070697_100011091 3300005536 Bacteria 7042
52 Ga0070686_100036935 3300005544 Bacteria 3028
53 Ga0070695_100017542 3300005545 Bacteria 4342
54 Ga0070696_100005304 3300005546 Bacteria 8593
55 Ga0070693_100007316 3300005547 Bacteria 5391
56 Ga0070704_100023194 3300005549 Bacteria 4048
57 Ga0068855_100005594 3300005563 Bacteria 15339
58 Ga0068855_100011209 3300005563 Bacteria 10824
59 Ga0068855_100026525 3300005563 Bacteria 6931
60 Ga0068855_100050316 3300005563 Bacteria 4911
61 Ga0068855_100066046 3300005563 Bacteria 4217
62 Ga0070664_100043535 3300005564 Bacteria 3788
63 Ga0068857_100022389 3300005577 Bacteria 5559
64 Ga0068857_100128137 3300005577 Bacteria 2287
65 Ga0068864_100038308 3300005618 Bacteria 4094
66 Ga0068863_100143091 3300005841 Bacteria 2286
67 Ga0068858_100083070 3300005842 Bacteria 2978
68 Ga0068860_100105825 3300005843 Bacteria 2687
69 Ga0081455_10031698 3300005937 Bacteria 4776
70 Ga0081540_1000058 3300005983 Bacteria 120635
71 Ga0081540_1003985 3300005983 Bacteria 11452
72 Ga0081539_10001044 3300005985 Bacteria 50691
73 Ga0070717_10078894 3300006028 Bacteria 2760
74 Ga0070715_10007786 3300006163 Bacteria 3702
75 Ga0070716_100035921 3300006173 Bacteria 2728
76 Ga0070716_100045155 3300006173 Bacteria 2472
77 Ga0070716_100053577 3300006173 Bacteria 2301
78 Ga0070712_100011218 3300006175 Bacteria 5673
79 Ga0070712_100011348 3300006175 Bacteria 5646
80 Ga0070712_100049284 3300006175 Bacteria 2924
81 Ga0068871_100096636 3300006358 Bacteria 2468
82 Ga0075428_100001395 3300006844 Bacteria 25714
83 Ga0075433_10001182 3300006852 Bacteria 18987
84 Ga0075434_100004475 3300006871 Bacteria 12610
85 Ga0075434_100114916 3300006871 Bacteria 2704
86 Ga0075435_100005002 3300007076 Bacteria 9198
87 Ga0099795_10022165 3300007788 Bacteria 2094
88 Ga0105251_10013283 3300009011 Bacteria 4613
89 Ga0105240_10019389 3300009093 Bacteria 9087
90 Ga0105240_10148521 3300009093 Bacteria 2794
91 Ga0105240_10321065 3300009093 Bacteria 1765
92 Ga0111539_10038181 3300009094 Bacteria 5793
93 Ga0111539_10048726 3300009094 Bacteria 5056
94 Ga0111539_10057670 3300009094 Bacteria 4610
95 Ga0111539_10072897 3300009094 Bacteria 4049
96 Ga0111539_10128309 3300009094 Bacteria 2971
97 Ga0105245_10032931 3300009098 Bacteria 4589
98 Ga0114129_10002164 3300009147 Bacteria 27071
99 Ga0114129_10110556 3300009147 Bacteria 3793
100 Ga0105243_10036632 3300009148 Bacteria 3809
101 Ga0105241_10040695 3300009174 Bacteria 3509
102 Ga0105242_10148435 3300009176 Bacteria 2042
103 Ga0105248_10132245 3300009177 Bacteria 2815
104 Ga0105238_10077251 3300009551 Bacteria 3321
105 Ga0105249_10013019 3300009553 Bacteria 7341
106 Ga0105249_10027970 3300009553 Bacteria 5089
107 Ga0157373_10011332 3300013100 Bacteria 6556
108 Ga0157373_10045641 3300013100 Bacteria 3127
109 Ga0157370_10006392 3300013104 Bacteria 13004
110 Ga0157369_10003787 3300013105 Bacteria 17966
111 Ga0157369_10013010 3300013105 Bacteria 9425
112 Ga0157369_10016084 3300013105 Bacteria 8418
113 Ga0157369_10018522 3300013105 Bacteria 7806
114 Ga0157374_10042769 3300013296 Bacteria 4181
115 Ga0163162_10175311 3300013306 Bacteria 2269
116 Ga0157372_10133906 3300013307 Bacteria 2853
117 Ga0157375_10077458 3300013308 Bacteria 3355
118 Ga0163163_10037524 3300014325 Bacteria 4715
119 Ga0206356_11848359 3300020070 Bacteria 2829
120 Ga0206354_10261730 3300020081 Bacteria 3848
121 Ga0206354_11377121 3300020081 Bacteria 2645
122 Ga0206353_10258743 3300020082 Bacteria 2633
123 Ga0206353_10970657 3300020082 Bacteria 6596
124 Ga0213875_10006007 3300021388 Bacteria 6429
125 Ga0224712_10009855 3300022467 Bacteria 2898
126 Ga0207653_10003314 3300025885 Bacteria 5081
127 Ga0207692_10008944 3300025898 Bacteria 4165
128 Ga0207692_10009616 3300025898 Bacteria 4045
129 Ga0207647_10041046 3300025904 Bacteria 2911
130 Ga0207685_10056424 3300025905 Bacteria 1537
131 Ga0207699_10008482 3300025906 Bacteria 5075
132 Ga0207699_10011380 3300025906 Bacteria 4492
133 Ga0207643_10011920 3300025908 Bacteria 4693
134 Ga0207705_10017069 3300025909 Bacteria 5200
135 Ga0207684_10074425 3300025910 Bacteria 2886
136 Ga0207684_10162239 3300025910 Bacteria 1925
137 Ga0207707_10008550 3300025912 Bacteria 8875
138 Ga0207707_10029109 3300025912 Bacteria 4827
139 Ga0207707_10065554 3300025912 Bacteria 3163
140 Ga0207695_10058844 3300025913 Bacteria 3988
141 Ga0207695_10099068 3300025913 Bacteria 2913
142 Ga0207693_10005771 3300025915 Bacteria 10266
143 Ga0207693_10034211 3300025915 Bacteria 4009
144 Ga0207693_10082276 3300025915 Bacteria 2521
145 Ga0207663_10002277 3300025916 Bacteria 9188
146 Ga0207660_10003765 3300025917 Bacteria 9879
147 Ga0207660_10053727 3300025917 Bacteria 2872
148 Ga0207660_10088742 3300025917 Bacteria 2287
149 Ga0207662_10004829 3300025918 Bacteria 7130
150 Ga0207657_10000416 3300025919 Bacteria 45222
151 Ga0207657_10002775 3300025919 Bacteria 18864
152 Ga0207657_10011244 3300025919 Bacteria 8893
153 Ga0207657_10055029 3300025919 Bacteria 3438
154 Ga0207649_10009061 3300025920 Bacteria 5438
155 Ga0207652_10045438 3300025921 Bacteria 3745
156 Ga0207652_10052239 3300025921 Bacteria 3507
157 Ga0207646_10006565 3300025922 Bacteria 12004
158 Ga0207646_10011624 3300025922 Bacteria 8512
159 Ga0207646_10052310 3300025922 Bacteria 3654
160 Ga0207659_10116599 3300025926 Bacteria 2039
161 Ga0207687_10031275 3300025927 Bacteria 3596
162 Ga0207700_10004931 3300025928 Bacteria 7928
163 Ga0207700_10070334 3300025928 Bacteria 2690
164 Ga0207664_10000682 3300025929 Bacteria 23338
165 Ga0207664_10052289 3300025929 Bacteria 3230
166 Ga0207690_10135638 3300025932 Bacteria 1807
167 Ga0207706_10051806 3300025933 Bacteria 3624
168 Ga0207709_10059953 3300025935 Bacteria 2371
169 Ga0207669_10110200 3300025937 Bacteria 1843
170 Ga0207665_10007562 3300025939 Bacteria 7178
171 Ga0207665_10089624 3300025939 Bacteria 2130
172 Ga0207665_10090599 3300025939 Bacteria 2119
173 Ga0207691_10113003 3300025940 Bacteria 2414
174 Ga0207711_10080916 3300025941 Bacteria 2838
175 Ga0207689_10064864 3300025942 Bacteria 3004
176 Ga0207661_10253534 3300025944 Bacteria 1565
177 Ga0207667_10025025 3300025949 Bacteria 6543
178 Ga0207667_10028294 3300025949 Bacteria 6090
179 Ga0207667_10091857 3300025949 Bacteria 3135
180 Ga0207712_10009382 3300025961 Bacteria 6191
181 Ga0207712_10058636 3300025961 Bacteria 2721
182 Ga0207658_10113831 3300025986 Bacteria 2144
183 Ga0207677_10019939 3300026023 Bacteria 4060
184 Ga0207677_10080959 3300026023 Bacteria 2328
185 Ga0207702_10008207 3300026078 Bacteria 8827
186 Ga0207702_10013668 3300026078 Bacteria 6742
187 Ga0207702_10055767 3300026078 Bacteria 3352
188 Ga0207641_10048902 3300026088 Bacteria 3571
189 Ga0207674_10006879 3300026116 Bacteria 13328
190 Ga0207674_10031297 3300026116 Bacteria 5590
191 Ga0207674_10270626 3300026116 Bacteria 1646
192 Ga0207675_100008063 3300026118 Bacteria 9923
193 Ga0207675_100064665 3300026118 Bacteria 3419
194 Ga0207683_10006677 3300026121 Bacteria 9873
195 Ga0207683_10119489 3300026121 Bacteria 2365
196 Ga0207698_10026917 3300026142 Bacteria 4074
197 Ga0207698_10100878 3300026142 Bacteria 2393
198 Ga0207428_10065610 3300027907 Bacteria 2863
199 Ga0207428_10073714 3300027907 Bacteria 2678
200 Ga0268264_10032922 3300028381 Bacteria 4254
201 Ga0265338_10192063 3300028800 Bacteria 1547
202 Ga0265340_10019814 3300031247 Bacteria 3461
203 Ga0307416_100052647 3300032002 Bacteria 3261
204 Ga0307415_100011040 3300032126 Bacteria 5147
205 Ga0307415_100251325 3300032126 Bacteria 1437
206 Ga0373930_0007033 3300034816 Bacteria 1923
207 Ga0373926_0000138 3300035083 Bacteria 15398
208 Ga0373929_0004797 3300035085 Bacteria 2424
209 Ga0373934_0015109 3300035086 Bacteria 2926
210 Ga0373944_0013354 3300035089 Bacteria 2276
211 Ga0373949_0017257 3300035090 Bacteria 1626
212 Ga0373923_0005825 3300035111 Bacteria 4205
213 Ga0373923_0014208 3300035111 Bacteria 2986
214 Ga0373932_0022246 3300035112 Bacteria 1682
215 Ga0373945_0000754 3300035116 Bacteria 9447
216 Ga0373945_0002740 3300035116 Bacteria 5531
217 Ga0373953_0004704 3300035117 Bacteria 4372
218 Ga0373943_0003601 3300035170 Bacteria 7049
219 Ga0373943_0004849 3300035170 Bacteria 6081
220 Ga0373946_0000230 3300035171 Bacteria 17527
221 Ga0373955_0010877 3300035172 Bacteria 4316
222 Ga0373942_0006509 3300035207 Bacteria 2698
223 Ga0373961_0024136 3300035241 Bacteria 1642
224 Ga0373924_0014999 3300035410 Bacteria 2936
225 Ga0373931_0005012 3300035691 Bacteria 6092
226 Ga0373935_0007993 3300035692 Bacteria 6341
227 Ga0373935_0030232 3300035692 Bacteria 3355
228 Ga0373927_0010637 3300035695 Bacteria 6129
229 Ga0373947_0002841 3300035725 Bacteria 10334
230 Ga0373947_0002865 3300035725 Bacteria 10303
231 Ga0373937_0105340 3300036401 Bacteria 2620
232 Ga0373925_0006267 3300037068 Bacteria 8769
233 Ga0373925_0013233 3300037068 Bacteria 5970
234 Ga0373925_0028256 3300037068 Bacteria 4109
235 Ga0373925_0036626 3300037068 Bacteria 3621
236 Ga0395899_0016475 3300037312 Bacteria 5636
237 Ga0395900_0008749 3300037418 Bacteria 10399
238 Ga0395900_0037178 3300037418 Bacteria 5021
239 Ga0395900_0073201 3300037418 Bacteria 3523
240 Ga0395900_0097511 3300037418 Bacteria 3020
241 Ga0395898_0007310 3300037466 Bacteria 11724
242 Ga0395898_0064574 3300037466 Bacteria 3550
243 Ga0395898_0075464 3300037466 Bacteria 3257
244 Ga0395898_0323712 3300037466 Bacteria 1470
245 Ga0395898_0406618 3300037466 Bacteria 1298
246 Ga0395905_0003200 3300037471 Bacteria 17633
247 Ga0395905_0003387 3300037471 Bacteria 17074
248 Ga0395905_0045804 3300037471 Bacteria 4103
249 Ga0436364_0306892 3300037853 Bacteria 3390
250 Ga0436364_0445401 3300037853 Bacteria 1749
251 Ga0436364_0612540 3300037853 Bacteria 12034
252 Ga0436364_1118549 3300037853 Bacteria 2637
253 Ga0436364_1317194 3300037853 Bacteria 5530
254 Ga0436364_1441197 3300037853 Bacteria 1686
255 Ga0395901_0003165 3300038443 Bacteria 16560
256 Ga0395901_0003604 3300038443 Bacteria 15622
257 Ga0395901_0006305 3300038443 Bacteria 12015
258 Ga0395901_0035126 3300038443 Bacteria 5180
259 Ga0395901_0068533 3300038443 Bacteria 3696
260 Ga0395901_0240176 3300038443 Bacteria 1890
261 Ga0436362_0279663 3300039453 Bacteria 1539
262 Ga0453683_0063507 3300044673 Bacteria 2309
263 Ga0466963_0019939 3300044694 Bacteria 4213
264 Ga0466963_0033922 3300044694 Bacteria 3319
265 Ga0466963_0051135 3300044694 Bacteria 2738
266 Ga0466964_0005528 3300044706 Bacteria 4693
267 Ga0466968_0022150 3300044735 Bacteria 2581
268 Ga0466960_0129435 3300044901 Bacteria 1330
269 Ga0451576_0008435 3300045051 Bacteria 12098
270 Ga0466967_0003245 3300045976 Bacteria 10526
271 Ga0466967_0030215 3300045976 Bacteria 4545
272 Ga0466967_0055054 3300045976 Bacteria 3503
273 Ga0466967_0061022 3300045976 Bacteria 3344
274 Ga0466967_0193861 3300045976 Bacteria 1921
275 Ga0495592_0195917 3300046454 Bacteria 1366
276 Ga0495603_0001720 3300046455 Bacteria 12892
277 Ga0495641_0004597 3300046461 Bacteria 9661
278 Ga0495641_0012002 3300046461 Bacteria 4882
279 Ga0495651_0009809 3300046462 Bacteria 7362
280 Ga0495651_0128318 3300046462 Bacteria 1854
281 Ga0495653_0006027 3300046463 Bacteria 9927
282 Ga0495582_0004422 3300046473 Bacteria 7906
283 Ga0495639_0000474 3300046475 Bacteria 19141
284 Ga0495662_0000516 3300046476 Bacteria 17630
285 Ga0495664_0001707 3300046477 Bacteria 11668
286 Ga0495664_0198322 3300046477 Bacteria 1216
287 Ga0495594_0011411 3300046499 Bacteria 4617
288 Ga0495618_0001697 3300046514 Bacteria 14634
289 Ga0495618_0029753 3300046514 Bacteria 3408
290 Ga0495618_0052251 3300046514 Bacteria 2583
291 Ga0495630_0002643 3300046517 Bacteria 12403
292 Ga0495652_0011274 3300046529 Bacteria 8087
293 Ga0495652_0053462 3300046529 Bacteria 3442
294 Ga0495652_0083179 3300046529 Bacteria 2636
295 Ga0495665_0016952 3300046531 Bacteria 3919
296 Ga0495665_0031889 3300046531 Bacteria 2819
297 Ga0495640_0003021 3300046533 Bacteria 13541
298 Ga0495640_0068715 3300046533 Bacteria 2383
299 Ga0495586_0011138 3300046535 Bacteria 4778
300 Ga0495587_0002189 3300046536 Bacteria 13069
301 Ga0495587_0047344 3300046536 Bacteria 2550
302 Ga0495622_0014387 3300046557 Bacteria 3675
303 Ga0495667_0005786 3300046559 Bacteria 8373
304 Ga0495667_0038251 3300046559 Bacteria 3195
305 Ga0495634_0006413 3300046642 Bacteria 8938
306 Ga0495635_0000707 3300046663 Bacteria 21524
307 Ga0495635_0001536 3300046663 Bacteria 15465
308 Ga0495657_0038518 3300046675 Bacteria 3289
309 Ga0495623_0011876 3300046679 Bacteria 5643
310 Ga0495658_0002726 3300046683 Bacteria 8883
311 Ga0495658_0027408 3300046683 Bacteria 3066
312 Ga0495613_0004967 3300046689 Bacteria 9986
313 Ga0495624_0007807 3300046690 Bacteria 7506
314 Ga0495600_0035187 3300046809 Bacteria 3252
315 Ga0495600_0043303 3300046809 Bacteria 2936
316 Ga0495581_0000404 3300047315 Bacteria 21732
317 Ga0495674_0033165 3300047319 Bacteria 4679
318 Ga0495674_0115498 3300047319 Bacteria 2272
319 Ga0495676_0002761 3300047321 Bacteria 15764
320 Ga0495676_0025196 3300047321 Bacteria 5139
321 Ga0495680_0018144 3300047322 Bacteria 5984
322 Ga0495680_0025164 3300047322 Bacteria 4930
323 Ga0495680_0044147 3300047322 Bacteria 3525
324 Ga0495680_0114649 3300047322 Bacteria 1994
325 Ga0495684_0000154 3300047471 Bacteria 50763
326 Ga0495684_0029191 3300047471 Bacteria 4233
327 Ga0495684_0041115 3300047471 Bacteria 3543
328 Ga0495593_0003042 3300047673 Bacteria 10105
329 Ga0495602_0091639 3300048088 Bacteria 2520
330 Ga0495602_0246821 3300048088 Bacteria 1332
331 Ga0495614_0001870 3300048089 Bacteria 9233
332 Ga0496101_0012532 3300048904 Bacteria 5660
333 Ga0496102_0023615 3300048905 Bacteria 5464
334 Ga0496102_0089824 3300048905 Bacteria 2842
335 Ga0496103_0015697 3300048906 Bacteria 4513
336 Ga0496104_0086229 3300048907 Bacteria 2997
337 Ga0496105_0004587 3300048908 Bacteria 10405
338 Ga0496105_0098788 3300048908 Bacteria 2410
339 Ga0496106_0164535 3300048909 Bacteria 1755
340 Ga0496106_0171551 3300048909 Bacteria 1719
341 Ga0496106_0218788 3300048909 Bacteria 1518
342 Ga0496106_0221335 3300048909 Bacteria 1510
343 Ga0496107_0030693 3300048910 Bacteria 3831
344 Ga0496108_0019548 3300048911 Bacteria 5563
345 Ga0496108_0026368 3300048911 Bacteria 4793
346 Ga0496109_0372712 3300048912 Bacteria 1348
347 Ga0496110_0049888 3300048913 Bacteria 3673
348 Ga0496110_0052585 3300048913 Bacteria 3579
349 Ga0496110_0126257 3300048913 Bacteria 2308
350 Ga0496110_0190520 3300048913 Bacteria 1862
351 Ga0496111_0011172 3300048914 Bacteria 6042
352 Ga0496112_0059348 3300048915 Bacteria 3769
353 Ga0496112_0076716 3300048915 Bacteria 3305
354 Ga0496112_0210915 3300048915 Bacteria 1899
355 Ga0496113_0060827 3300048916 Bacteria 2848
356 Ga0496113_0071682 3300048916 Bacteria 2635
357 Ga0496114_0012688 3300048917 Bacteria 6749
358 Ga0496126_0182186 3300048929 Bacteria 1784
359 Ga0501069_0029689 3300049585 Bacteria 3001
360 nmdc:mga05p37_119013_c2 3300050507 Bacteria 2643
361 nmdc:mga05p37_23233_c1 3300050507 Bacteria 7521
362 nmdc:mga05p37_9232_c1 3300050507 Bacteria 11653
363 nmdc:mga08y16_125652_c1 3300050511 Bacteria 2668
364 nmdc:mga08y16_15987_c1 3300050511 Bacteria 7888
365 nmdc:mga08y16_192509_c1 3300050511 Bacteria 2115
366 nmdc:mga08y16_213977_c1 3300050511 Bacteria 1996
367 nmdc:mga08y16_21966_c1 3300050511 Bacteria 6736
368 nmdc:mga0n895_13418_c1 3300050512 Bacteria 7390
369 nmdc:mga0n895_20411_c1 3300050512 Bacteria 6180
370 nmdc:mga0rr50_4626_c1 3300050513 Bacteria 8107
371 nmdc:mga0a205_3829_c1 3300050515 Bacteria 13479
372 Ga0495601_0003342 3300053077 Bacteria 9184
373 Ga0495601_0017501 3300053077 Bacteria 4352
374 Ga0495612_0006813 3300053078 Bacteria 4679
375 Ga0495619_0004404 3300053085 Bacteria 8983
376 Ga0495619_0041796 3300053085 Bacteria 3000
377 Ga0070698_100128284
378 JGI24738J21930_10002358
379 JGI25406J46586_10001832
380 Ga0070658_10006816
381 Ga0070658_10055418
382 Ga0070683_100050421
383 Ga0070690_100020629
384 Ga0070666_10022317
385 Ga0070680_100030764
386 Ga0070680_100057114
387 Ga0068868_100034876
388 Ga0070660_100000770
389 Ga0070660_100024023
390 Ga0070689_100012969
391 Ga0070689_100049669
392 Ga0070661_100014016
393 Ga0070661_100016219
394 Ga0070661_100028565
395 Ga0070692_10028269
396 Ga0070668_100094702
397 Ga0070675_100072954
398 Ga0070659_100025756
399 Ga0070659_100103886
400 Ga0070667_100031866
401 Ga0070703_10009625
402 Ga0070714_100000491
403 Ga0070714_100124267
404 Ga0070713_100062083
405 Ga0070713_100064378
406 Ga0070710_10100099
407 Ga0070701_10054673
408 Ga0070705_100026952
409 Ga0070694_100031449
410 Ga0070681_10001129
411 Ga0070681_10011904
412 Ga0070681_10090277
413 Ga0070681_10095504
414 Ga0070706_100050753
415 Ga0070706_100079291
416 Ga0070706_100081510
417 Ga0070706_100093206
418 Ga0070706_100170695
419 Ga0070707_100028572
420 Ga0070707_100241640
421 Ga0070698_100038509
422 Ga0070698_100213243
423 Ga0070699_100000327
424 Ga0070699_100157500
425 Ga0070679_100013896
426 Ga0070679_100135534
427 Ga0070697_100011091
428 Ga0070686_100036935
429 Ga0070695_100017542
430 Ga0070696_100005304
431 Ga0070693_100007316
432 Ga0070704_100023194
433 Ga0068855_100005594
434 Ga0068855_100011209
435 Ga0068855_100026525
436 Ga0068855_100050316
437 Ga0068855_100066046
438 Ga0070664_100043535
439 Ga0068857_100022389
440 Ga0068857_100128137
441 Ga0068864_100038308
442 Ga0068863_100143091
443 Ga0068858_100083070
444 Ga0068860_100105825
445 Ga0081455_10031698
446 Ga0081540_1000058
447 Ga0081540_1003985
448 Ga0081539_10001044
449 Ga0070717_10078894
450 Ga0070715_10007786
451 Ga0070716_100035921
452 Ga0070716_100045155
453 Ga0070716_100053577
454 Ga0070712_100011218
455 Ga0070712_100011348
456 Ga0070712_100049284
457 Ga0068871_100096636
458 Ga0075428_100001395
459 Ga0075433_10001182
460 Ga0075434_100004475
461 Ga0075434_100114916
462 Ga0075435_100005002
463 Ga0099795_10022165
464 Ga0105251_10013283
465 Ga0105240_10019389
466 Ga0105240_10148521
467 Ga0105240_10321065
468 Ga0111539_10038181
469 Ga0111539_10048726
470 Ga0111539_10057670
471 Ga0111539_10072897
472 Ga0111539_10128309
473 Ga0105245_10032931
474 Ga0114129_10002164
475 Ga0114129_10110556
476 Ga0105243_10036632
477 Ga0105241_10040695
478 Ga0105242_10148435
479 Ga0105248_10132245
480 Ga0105238_10077251
481 Ga0105249_10013019
482 Ga0105249_10027970
483 Ga0157373_10011332
484 Ga0157373_10045641
485 Ga0157370_10006392
486 Ga0157369_10003787
487 Ga0157369_10013010
488 Ga0157369_10016084
489 Ga0157369_10018522
490 Ga0157374_10042769
491 Ga0163162_10175311
492 Ga0157372_10133906
493 Ga0157375_10077458
494 Ga0163163_10037524
495 Ga0206356_11848359
496 Ga0206354_10261730
497 Ga0206354_11377121
498 Ga0206353_10258743
499 Ga0206353_10970657
500 Ga0213875_10006007
501 Ga0224712_10009855
502 Ga0207653_10003314
503 Ga0207692_10008944
504 Ga0207692_10009616
505 Ga0207647_10041046
506 Ga0207685_10056424
507 Ga0207699_10008482
508 Ga0207699_10011380
509 Ga0207643_10011920
510 Ga0207705_10017069
511 Ga0207684_10074425
512 Ga0207684_10162239
513 Ga0207707_10008550
514 Ga0207707_10029109
515 Ga0207707_10065554
516 Ga0207695_10058844
517 Ga0207695_10099068
518 Ga0207693_10005771
519 Ga0207693_10034211
520 Ga0207693_10082276
521 Ga0207663_10002277
522 Ga0207660_10003765
523 Ga0207660_10053727
524 Ga0207660_10088742
525 Ga0207662_10004829
526 Ga0207657_10000416
527 Ga0207657_10002775
528 Ga0207657_10011244
529 Ga0207657_10055029
530 Ga0207649_10009061
531 Ga0207652_10045438
532 Ga0207652_10052239
533 Ga0207646_10006565
534 Ga0207646_10011624
535 Ga0207646_10052310
536 Ga0207659_10116599
537 Ga0207687_10031275
538 Ga0207700_10004931
539 Ga0207700_10070334
540 Ga0207664_10000682
541 Ga0207664_10052289
542 Ga0207690_10135638
543 Ga0207706_10051806
544 Ga0207709_10059953
545 Ga0207669_10110200
546 Ga0207665_10007562
547 Ga0207665_10089624
548 Ga0207665_10090599
549 Ga0207691_10113003
550 Ga0207711_10080916
551 Ga0207689_10064864
552 Ga0207661_10253534
553 Ga0207667_10025025
554 Ga0207667_10028294
555 Ga0207667_10091857
556 Ga0207712_10009382
557 Ga0207712_10058636
558 Ga0207658_10113831
559 Ga0207677_10019939
560 Ga0207677_10080959
561 Ga0207702_10008207
562 Ga0207702_10013668
563 Ga0207702_10055767
564 Ga0207641_10048902
565 Ga0207674_10006879
566 Ga0207674_10031297
567 Ga0207674_10270626
568 Ga0207675_100008063
569 Ga0207675_100064665
570 Ga0207683_10006677
571 Ga0207683_10119489
572 Ga0207698_10026917
573 Ga0207698_10100878
574 Ga0207428_10065610
575 Ga0207428_10073714
576 Ga0268264_10032922
577 Ga0265338_10192063
578 Ga0265340_10019814
579 Ga0307416_100052647
580 Ga0307415_100011040
581 Ga0307415_100251325
582 Ga0373930_0007033
583 Ga0373926_0000138
584 Ga0373929_0004797
585 Ga0373934_0015109
586 Ga0373944_0013354
587 Ga0373949_0017257
588 Ga0373923_0005825
589 Ga0373923_0014208
590 Ga0373932_0022246
591 Ga0373945_0000754
592 Ga0373945_0002740
593 Ga0373953_0004704
594 Ga0373943_0003601
595 Ga0373943_0004849
596 Ga0373946_0000230
597 Ga0373955_0010877
598 Ga0373942_0006509
599 Ga0373961_0024136
600 Ga0373924_0014999
601 Ga0373931_0005012
602 Ga0373935_0007993
603 Ga0373935_0030232
604 Ga0373927_0010637
605 Ga0373947_0002841
606 Ga0373947_0002865
607 Ga0373937_0105340
608 Ga0373925_0006267
609 Ga0373925_0013233
610 Ga0373925_0028256
611 Ga0373925_0036626
612 Ga0395899_0016475
613 Ga0395900_0008749
614 Ga0395900_0037178
615 Ga0395900_0073201
616 Ga0395900_0097511
617 Ga0395898_0007310
618 Ga0395898_0064574
619 Ga0395898_0075464
620 Ga0395898_0323712
621 Ga0395898_0406618
622 Ga0395905_0003200
623 Ga0395905_0003387
624 Ga0395905_0045804
625 Ga0436364_0306892
626 Ga0436364_0445401
627 Ga0436364_0612540
628 Ga0436364_1118549
629 Ga0436364_1317194
630 Ga0436364_1441197
631 Ga0395901_0003165
632 Ga0395901_0003604
633 Ga0395901_0006305
634 Ga0395901_0035126
635 Ga0395901_0068533
636 Ga0395901_0240176
637 Ga0436362_0279663
638 Ga0453683_0063507
639 Ga0466963_0019939
640 Ga0466963_0033922
641 Ga0466963_0051135
642 Ga0466964_0005528
643 Ga0466968_0022150
644 Ga0466960_0129435
645 Ga0451576_0008435
646 Ga0466967_0003245
647 Ga0466967_0030215
648 Ga0466967_0055054
649 Ga0466967_0061022
650 Ga0466967_0193861
651 Ga0495592_0195917
652 Ga0495603_0001720
653 Ga0495641_0004597
654 Ga0495641_0012002
655 Ga0495651_0009809
656 Ga0495651_0128318
657 Ga0495653_0006027
658 Ga0495582_0004422
659 Ga0495639_0000474
660 Ga0495662_0000516
661 Ga0495664_0001707
662 Ga0495664_0198322
663 Ga0495594_0011411
664 Ga0495618_0001697
665 Ga0495618_0029753
666 Ga0495618_0052251
667 Ga0495630_0002643
668 Ga0495652_0011274
669 Ga0495652_0053462
670 Ga0495652_0083179
671 Ga0495665_0016952
672 Ga0495665_0031889
673 Ga0495640_0003021
674 Ga0495640_0068715
675 Ga0495586_0011138
676 Ga0495587_0002189
677 Ga0495587_0047344
678 Ga0495622_0014387
679 Ga0495667_0005786
680 Ga0495667_0038251
681 Ga0495634_0006413
682 Ga0495635_0000707
683 Ga0495635_0001536
684 Ga0495657_0038518
685 Ga0495623_0011876
686 Ga0495658_0002726
687 Ga0495658_0027408
688 Ga0495613_0004967
689 Ga0495624_0007807
690 Ga0495600_0035187
691 Ga0495600_0043303
692 Ga0495581_0000404
693 Ga0495674_0033165
694 Ga0495674_0115498
695 Ga0495676_0002761
696 Ga0495676_0025196
697 Ga0495680_0018144
698 Ga0495680_0025164
699 Ga0495680_0044147
700 Ga0495680_0114649
701 Ga0495684_0000154
702 Ga0495684_0029191
703 Ga0495684_0041115
704 Ga0495593_0003042
705 Ga0495602_0091639
706 Ga0495602_0246821
707 Ga0495614_0001870
708 Ga0496101_0012532
709 Ga0496102_0023615
710 Ga0496102_0089824
711 Ga0496103_0015697
712 Ga0496104_0086229
713 Ga0496105_0004587
714 Ga0496105_0098788
715 Ga0496106_0164535
716 Ga0496106_0171551
717 Ga0496106_0218788
718 Ga0496106_0221335
719 Ga0496107_0030693
720 Ga0496108_0019548
721 Ga0496108_0026368
722 Ga0496109_0372712
723 Ga0496110_0049888
724 Ga0496110_0052585
725 Ga0496110_0126257
726 Ga0496110_0190520
727 Ga0496111_0011172
728 Ga0496112_0059348
729 Ga0496112_0076716
730 Ga0496112_0210915
731 Ga0496113_0060827
732 Ga0496113_0071682
733 Ga0496114_0012688
734 Ga0496126_0182186
735 Ga0501069_0029689
736 nmdc:mga05p37_119013_c2
737 nmdc:mga05p37_23233_c1
738 nmdc:mga05p37_9232_c1
739 nmdc:mga08y16_125652_c1
740 nmdc:mga08y16_15987_c1
741 nmdc:mga08y16_192509_c1
742 nmdc:mga08y16_213977_c1
743 nmdc:mga08y16_21966_c1
744 nmdc:mga0n895_13418_c1
745 nmdc:mga0n895_20411_c1
746 nmdc:mga0rr50_4626_c1
747 nmdc:mga0a205_3829_c1
748 Ga0495601_0003342
749 Ga0495601_0017501
750 Ga0495612_0006813
751 Ga0495619_0004404
752 Ga0495619_0041796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02056

Glyco_hydro_4

Family 4 glycosyl hydrolase

2

181

0.96

PF11975

Glyco_hydro_4C

Family 4 glycosyl hydrolase C-terminal domain

190

394

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1up4-assembly2.cif.gz_E structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.85 angstrom resolution in the monoclinic form 0.9576 1 418
1up4-assembly1.cif.gz_B structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.85 angstrom resolution in the monoclinic form 0.9563 1 418
1up4-assembly1.cif.gz_A structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.85 angstrom resolution in the monoclinic form 0.9557 1 418
1up7-assembly1.cif.gz_D structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with nad and glucose-6-phosphate 0.9556 1 418
1up4-assembly1.cif.gz_D structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.85 angstrom resolution in the monoclinic form 0.9556 1 418
ID Description Score Start End Superfamily
1s6yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9558 1 162 3.40.50.720
1s6yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 1 162 3.40.50.720
1nrhX01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9334 2 160 3.40.50.720
1up6A02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.925 85 417 3.90.110.10
af_P31450_1_210_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9092 2 206 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A454VZ21-F1-model_v4 6-phospho-beta-glucosidase 0.992 1 127 GO:0004553
GO:0005975
AF-A0A6G3XTG8-F1-model_v4 6-phospho-beta-glucosidase 0.9915 1 144 GO:0004553
GO:0005975
AF-A0A6G2U6A9-F1-model_v4 6-phospho-beta-glucosidase 0.9913 1 422 GO:0004553
GO:0005975
GO:0016616
GO:0046872
AF-A0A6G2U6A9-F1-model_v4 6-phospho-beta-glucosidase 0.9889 1 422 GO:0004553
GO:0005975
GO:0016616
GO:0046872
AF-A0A6G3XTG8-F1-model_v4 6-phospho-beta-glucosidase 0.9847 1 144 GO:0004553
GO:0005975

Map