F427269

General Info

Members Datasets Scaffolds Average Seq Length
376 246 752 226

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100491665|Ga0070713_1004916652
Length 248
Sequence VLRGGLPPDKQLILDRAALITGGSSGIGLAIGRMLRDEGYELTLASRRPERVQAAAEELGAVAIAADVGNAEDCQRLVAEHRERFGRIDVLVNSAGIGIAGRVEDLPAKHFDLQVAVNLRGLFLVTQAAIPLLRESRGWIVNLASIAGTLPTPGLATYGATKAAVISLTRSLNEELDADGVRAVAICPGFVDTPMAEWSGLAGDEMIQPEDCAEVVRMLLCLSSRARIPQVVIERVGSTNGDVPVSGA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
129 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
132 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
133 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 9.04
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100491665 3300005436 Bacteria 1157
2 rootL2_10206479 3300003322 Bacteria 1341
3 Ga0068869_100532946 3300005334 Bacteria 984
4 Ga0070680_100138818 3300005336 Bacteria 2037
5 Ga0070680_100237567 3300005336 Bacteria 1540
6 Ga0070660_100002458 3300005339 Bacteria 12706
7 Ga0070660_100021777 3300005339 Bacteria 4731
8 Ga0070669_100086357 3300005353 Bacteria 2344
9 Ga0070675_100236591 3300005354 Bacteria 1595
10 Ga0070674_100031157 3300005356 Bacteria 3531
11 Ga0070673_100255780 3300005364 Bacteria 1528
12 Ga0070659_100401861 3300005366 Bacteria 1157
13 Ga0070659_100927782 3300005366 Bacteria 762
14 Ga0070703_10085442 3300005406 Bacteria 1084
15 Ga0070714_100011046 3300005435 Bacteria 7154
16 Ga0070714_100014958 3300005435 Bacteria 6237
17 Ga0070714_100084610 3300005435 Bacteria 2768
18 Ga0070713_100011866 3300005436 Bacteria 6368
19 Ga0070713_100067326 3300005436 Bacteria 3015
20 Ga0070713_100188516 3300005436 Bacteria 1857
21 Ga0070710_10003409 3300005437 Bacteria 7531
22 Ga0070711_100027387 3300005439 Bacteria 3742
23 Ga0070700_100215653 3300005441 Bacteria 1357
24 Ga0070662_100042501 3300005457 Bacteria 3247
25 Ga0070681_10018844 3300005458 Bacteria 6906
26 Ga0070681_10096807 3300005458 Bacteria 2899
27 Ga0070681_10109291 3300005458 Bacteria 2705
28 Ga0070681_10179061 3300005458 Bacteria 2041
29 Ga0070681_10378371 3300005458 Bacteria 1326
30 Ga0068867_100196693 3300005459 Bacteria 1612
31 Ga0068867_100502846 3300005459 Bacteria 1042
32 Ga0068867_100509220 3300005459 Bacteria 1036
33 Ga0070706_100373866 3300005467 Bacteria 1328
34 Ga0070707_100517774 3300005468 Bacteria 1155
35 Ga0070698_100160575 3300005471 Bacteria 2191
36 Ga0070698_100219030 3300005471 Bacteria 1837
37 Ga0070699_100118175 3300005518 Bacteria 2330
38 Ga0070699_100195943 3300005518 Bacteria 1796
39 Ga0070679_100124493 3300005530 Bacteria 2561
40 Ga0070679_100421245 3300005530 Bacteria 1280
41 Ga0070684_100018317 3300005535 Bacteria 5767
42 Ga0070684_100023709 3300005535 Bacteria 5137
43 Ga0068853_100378154 3300005539 Bacteria 1322
44 Ga0070672_100475941 3300005543 Bacteria 1078
45 Ga0070696_100135691 3300005546 Bacteria 1794
46 Ga0070696_100765942 3300005546 Bacteria 792
47 Ga0070665_100065167 3300005548 Bacteria 3655
48 Ga0070704_100038619 3300005549 Bacteria 3272
49 Ga0068855_100167899 3300005563 Bacteria 2487
50 Ga0068855_100311652 3300005563 Bacteria 1741
51 Ga0070664_100068412 3300005564 Bacteria 3036
52 Ga0068854_100041072 3300005578 Bacteria 3267
53 Ga0068856_100344540 3300005614 Bacteria 1508
54 Ga0068856_100438980 3300005614 Bacteria 1326
55 Ga0068852_100074865 3300005616 Bacteria 2984
56 Ga0068852_100613523 3300005616 Bacteria 1093
57 Ga0068851_10294400 3300005834 Bacteria 931
58 Ga0068863_100184048 3300005841 Bacteria 2006
59 Ga0070717_10001757 3300006028 Bacteria 15091
60 Ga0070717_10035759 3300006028 Bacteria 4024
61 Ga0070717_10062702 3300006028 Bacteria 3083
62 Ga0070717_10595669 3300006028 Bacteria 1003
63 Ga0075432_10061159 3300006058 Bacteria 1341
64 Ga0070716_100000830 3300006173 Bacteria 13319
65 Ga0070712_100032958 3300006175 Bacteria 3501
66 Ga0070712_100041206 3300006175 Bacteria 3170
67 Ga0070712_100042445 3300006175 Bacteria 3127
68 Ga0068865_100178844 3300006881 Bacteria 1632
69 Ga0075436_100055243 3300006914 Bacteria 2742
70 Ga0105240_10216077 3300009093 Bacteria 2237
71 Ga0111539_10024998 3300009094 Bacteria 7319
72 Ga0105245_10141101 3300009098 Bacteria 2269
73 Ga0105245_10171807 3300009098 Bacteria 2065
74 Ga0114129_10225203 3300009147 Bacteria 2528
75 Ga0105239_10006265 3300010375 Bacteria 13837
76 Ga0157371_10573387 3300013102 Bacteria 838
77 Ga0157370_10336282 3300013104 Bacteria 1392
78 Ga0157369_10086492 3300013105 Bacteria 3348
79 Ga0157374_10629965 3300013296 Bacteria 1083
80 Ga0163162_10246358 3300013306 Bacteria 1919
81 Ga0157372_10141459 3300013307 Bacteria 2772
82 Ga0163163_10433192 3300014325 Bacteria 1374
83 Ga0157380_10062244 3300014326 Bacteria 2988
84 Ga0157380_10111608 3300014326 Bacteria 2299
85 Ga0182008_10091476 3300014497 Bacteria 1500
86 Ga0206356_10385390 3300020070 Bacteria 3061
87 Ga0206354_11395182 3300020081 Bacteria 1333
88 Ga0206353_11494585 3300020082 Bacteria 1862
89 Ga0207688_10080730 3300025901 Bacteria 1857
90 Ga0207688_10089462 3300025901 Bacteria 1766
91 Ga0207699_10007757 3300025906 Bacteria 5255
92 Ga0207705_10258134 3300025909 Bacteria 1330
93 Ga0207654_10321895 3300025911 Bacteria 1057
94 Ga0207707_10062623 3300025912 Bacteria 3237
95 Ga0207707_10093956 3300025912 Bacteria 2620
96 Ga0207707_10150497 3300025912 Bacteria 2035
97 Ga0207707_10186281 3300025912 Bacteria 1811
98 Ga0207695_10130388 3300025913 Bacteria 2472
99 Ga0207695_10289868 3300025913 Bacteria 1529
100 Ga0207693_10005548 3300025915 Bacteria 10497
101 Ga0207693_10573770 3300025915 Bacteria 879
102 Ga0207663_10007473 3300025916 Bacteria 5669
103 Ga0207660_10392443 3300025917 Bacteria 1117
104 Ga0207657_10003276 3300025919 Bacteria 17325
105 Ga0207657_10003932 3300025919 Bacteria 15776
106 Ga0207649_10089536 3300025920 Bacteria 2012
107 Ga0207652_10178791 3300025921 Bacteria 1906
108 Ga0207652_10219433 3300025921 Bacteria 1713
109 Ga0207652_10723853 3300025921 Bacteria 887
110 Ga0207646_10732992 3300025922 Bacteria 883
111 Ga0207659_10150002 3300025926 Bacteria 1820
112 Ga0207687_10132445 3300025927 Bacteria 1881
113 Ga0207700_10022637 3300025928 Bacteria 4316
114 Ga0207664_10002009 3300025929 Bacteria 13400
115 Ga0207664_10003758 3300025929 Bacteria 10197
116 Ga0207664_10010008 3300025929 Bacteria 6682
117 Ga0207664_10013433 3300025929 Bacteria 5878
118 Ga0207690_10182895 3300025932 Bacteria 1580
119 Ga0207690_10356303 3300025932 Bacteria 1158
120 Ga0207706_10090300 3300025933 Bacteria 2694
121 Ga0207669_10041589 3300025937 Bacteria 2676
122 Ga0207704_10082162 3300025938 Bacteria 2086
123 Ga0207665_10000793 3300025939 Bacteria 21330
124 Ga0207691_10204899 3300025940 Bacteria 1715
125 Ga0207689_10595477 3300025942 Bacteria 930
126 Ga0207661_10269951 3300025944 Bacteria 1518
127 Ga0207661_10331198 3300025944 Bacteria 1370
128 Ga0207667_10187404 3300025949 Bacteria 2123
129 Ga0207640_10322582 3300025981 Bacteria 1230
130 Ga0207677_10487991 3300026023 Bacteria 1063
131 Ga0207708_10185321 3300026075 Bacteria 1654
132 Ga0207702_10100462 3300026078 Bacteria 2552
133 Ga0207648_10208343 3300026089 Bacteria 1735
134 Ga0207648_10237903 3300026089 Bacteria 1621
135 Ga0207675_100212097 3300026118 Bacteria 1863
136 Ga0207675_100371384 3300026118 Bacteria 1405
137 Ga0207683_10371843 3300026121 Bacteria 1313
138 Ga0207683_10701948 3300026121 Bacteria 938
139 Ga0207698_11116283 3300026142 Bacteria 801
140 Ga0268266_10104325 3300028379 Bacteria 2503
141 Ga0265326_10066087 3300028558 Bacteria 1022
142 Ga0265319_1003192 3300028563 Bacteria 8622
143 Ga0265334_10027739 3300028573 Bacteria 2279
144 Ga0265334_10028295 3300028573 Bacteria 2253
145 Ga0265318_10001532 3300028577 Bacteria 13453
146 Ga0265318_10003338 3300028577 Bacteria 8117
147 Ga0265338_10003714 3300028800 Bacteria 21233
148 Ga0265338_10014556 3300028800 Bacteria 8738
149 Ga0265338_10015430 3300028800 Bacteria 8392
150 Ga0265338_10027780 3300028800 Bacteria 5665
151 Ga0265338_10057492 3300028800 Bacteria 3440
152 Ga0265330_10230518 3300031235 Bacteria 781
153 Ga0265332_10051568 3300031238 Bacteria 1767
154 Ga0265328_10001734 3300031239 Bacteria 9988
155 Ga0265325_10004366 3300031241 Bacteria 8945
156 Ga0265325_10242469 3300031241 Bacteria 818
157 Ga0265329_10004213 3300031242 Bacteria 6051
158 Ga0265340_10016820 3300031247 Bacteria 3783
159 Ga0265339_10001965 3300031249 Bacteria 15100
160 Ga0265339_10022270 3300031249 Bacteria 3672
161 Ga0265327_10099607 3300031251 Bacteria 1404
162 Ga0265327_10136620 3300031251 Bacteria 1149
163 Ga0265316_10008588 3300031344 Bacteria 9466
164 Ga0265316_10010561 3300031344 Bacteria 8407
165 Ga0265316_10011381 3300031344 Bacteria 8028
166 Ga0265313_10003763 3300031595 Bacteria 12046
167 Ga0265314_10002877 3300031711 Bacteria 17091
168 Ga0265314_10013192 3300031711 Bacteria 6689
169 Ga0265314_10034197 3300031711 Bacteria 3717
170 Ga0265342_10013623 3300031712 Bacteria 5442
171 Ga0265342_10046163 3300031712 Bacteria 2619
172 Ga0265342_10170978 3300031712 Bacteria 1195
173 Ga0307410_10839289 3300031852 Bacteria 784
174 Ga0307412_10592291 3300031911 Bacteria 938
175 Ga0307409_100290948 3300031995 Bacteria 1515
176 Ga0307409_100293737 3300031995 Bacteria 1508
177 Ga0307416_100413856 3300032002 Bacteria 1390
178 Ga0307416_100745140 3300032002 Bacteria 1072
179 Ga0373926_0004191 3300035083 Bacteria 4705
180 Ga0373945_0019983 3300035116 Bacteria 2290
181 Ga0373943_0000485 3300035170 Bacteria 16976
182 Ga0373946_0044702 3300035171 Bacteria 1829
183 Ga0373924_0124003 3300035410 Unclassified 1122
184 Ga0373947_0002997 3300035725 Bacteria 10071
185 Ga0373925_0055024 3300037068 Bacteria 2977
186 Ga0395899_0243949 3300037312 Bacteria 1235
187 Ga0395900_0272729 3300037418 Bacteria 1686
188 Ga0395900_0972753 3300037418 Bacteria 769
189 Ga0395898_0337025 3300037466 Bacteria 1438
190 Ga0395905_0176728 3300037471 Bacteria 2004
191 Ga0395905_0330861 3300037471 Bacteria 1414
192 Ga0395901_0400637 3300038443 Bacteria 1410
193 Ga0395901_0596999 3300038443 Bacteria 1114
194 Ga0439438_030518 3300041405 Bacteria 1437
195 Ga0439461_0009938 3300041410 Bacteria 1736
196 Ga0439465_0227068 3300041413 Bacteria 686
197 Ga0439437_007027 3300042000 Bacteria 1253
198 Ga0439463_069645 3300042016 Bacteria 901
199 Ga0450920_002907 3300042122 Bacteria 2946
200 Ga0450920_017192 3300042122 Bacteria 1382
201 Ga0450898_055137 3300042134 Bacteria 774
202 Ga0450907_035031 3300042146 Bacteria 856
203 Ga0439446_0001906 3300042156 Bacteria 4906
204 Ga0439446_0044308 3300042156 Bacteria 1316
205 Ga0439434_0017773 3300042435 Bacteria 2128
206 Ga0450918_006948 3300042531 Bacteria 2012
207 Ga0466969_0000749 3300044656 Bacteria 17589
208 Ga0466966_0016983 3300044684 Bacteria 4810
209 Ga0466966_0043063 3300044684 Bacteria 2895
210 Ga0466961_0028244 3300044693 Bacteria 3607
211 Ga0466963_0000248 3300044694 Bacteria 23565
212 Ga0466963_0000355 3300044694 Bacteria 20745
213 Ga0466963_0000854 3300044694 Bacteria 15384
214 Ga0466964_0007686 3300044706 Bacteria 4035
215 Ga0466964_0008673 3300044706 Bacteria 3823
216 Ga0466964_0045295 3300044706 Bacteria 1790
217 Ga0466968_0058483 3300044735 Bacteria 1659
218 Ga0466968_0111635 3300044735 Bacteria 1229
219 Ga0466970_0006693 3300044765 Bacteria 5766
220 Ga0466957_0020759 3300044842 Bacteria 3865
221 Ga0466957_0036847 3300044842 Bacteria 2942
222 Ga0466959_0001794 3300045049 Bacteria 13421
223 Ga0466958_0001851 3300045836 Bacteria 10308
224 Ga0466958_0002821 3300045836 Bacteria 8844
225 Ga0466958_0100100 3300045836 Bacteria 1801
226 Ga0466967_0000219 3300045976 Bacteria 24460
227 Ga0466967_0008229 3300045976 Bacteria 7619
228 Ga0466967_0009549 3300045976 Bacteria 7207
229 Ga0466967_0111940 3300045976 Bacteria 2509
230 Ga0466967_0146585 3300045976 Bacteria 2202
231 Ga0466967_0212311 3300045976 Bacteria 1836
232 Ga0466967_0263789 3300045976 Bacteria 1648
233 Ga0495592_0002313 3300046454 Bacteria 13442
234 Ga0495592_0064794 3300046454 Bacteria 2677
235 Ga0495629_0017474 3300046459 Bacteria 5139
236 Ga0495629_0038381 3300046459 Bacteria 3373
237 Ga0495629_0060439 3300046459 Bacteria 2649
238 Ga0495641_0008094 3300046461 Bacteria 6458
239 Ga0495651_0328858 3300046462 Bacteria 1016
240 Ga0495653_0017311 3300046463 Bacteria 5862
241 Ga0495653_0018726 3300046463 Bacteria 5621
242 Ga0495653_0097335 3300046463 Bacteria 2138
243 Ga0495580_0064912 3300046472 Bacteria 2558
244 Ga0495582_0000560 3300046473 Bacteria 20576
245 Ga0495582_0193906 3300046473 Bacteria 1159
246 Ga0495639_0000517 3300046475 Bacteria 18127
247 Ga0495664_0035439 3300046477 Bacteria 2938
248 Ga0495664_0111488 3300046477 Unclassified 1651
249 Ga0495584_0013313 3300046491 Bacteria 4200
250 Ga0495596_0093656 3300046500 Bacteria 1166
251 Ga0495607_0041873 3300046501 Bacteria 2718
252 Ga0495607_0147756 3300046501 Bacteria 1206
253 Ga0495618_0016647 3300046514 Bacteria 4502
254 Ga0495628_0017025 3300046516 Bacteria 6056
255 Ga0495628_0352904 3300046516 Bacteria 1081
256 Ga0495630_0001418 3300046517 Bacteria 16580
257 Ga0495630_0226913 3300046517 Bacteria 1426
258 Ga0495630_0331467 3300046517 Bacteria 1164
259 Ga0495644_0059326 3300046523 Unclassified 1439
260 Ga0495663_0027836 3300046525 Bacteria 1661
261 Ga0495666_0000186 3300046526 Bacteria 26616
262 Ga0495652_0043635 3300046529 Bacteria 3861
263 Ga0495652_0046270 3300046529 Bacteria 3737
264 Ga0495652_0248469 3300046529 Bacteria 1319
265 Ga0495665_0001413 3300046531 Bacteria 12861
266 Ga0495586_0082731 3300046535 Bacteria 1765
267 Ga0495587_0020144 3300046536 Bacteria 4120
268 Ga0495667_0103452 3300046559 Bacteria 1842
269 Ga0495667_0223554 3300046559 Bacteria 1201
270 Ga0495667_0250673 3300046559 Bacteria 1127
271 Ga0495656_0075119 3300046615 Unclassified 1511
272 Ga0495635_0028916 3300046663 Bacteria 3853
273 Ga0495635_0094068 3300046663 Bacteria 2049
274 Ga0495635_0377450 3300046663 Bacteria 943
275 Ga0495659_0105542 3300046664 Unclassified 1095
276 Ga0495661_0077068 3300046665 Bacteria 1933
277 Ga0495657_0238771 3300046675 Bacteria 1097
278 Ga0495599_0065142 3300046678 Bacteria 2276
279 Ga0495623_0028486 3300046679 Bacteria 3593
280 Ga0495647_0000811 3300046681 Bacteria 9345
281 Ga0495658_0001241 3300046683 Bacteria 13401
282 Ga0495624_0008189 3300046690 Bacteria 7311
283 Ga0495624_0025947 3300046690 Bacteria 3844
284 Ga0495589_0052904 3300046794 Bacteria 2005
285 Ga0495581_0003648 3300047315 Bacteria 8866
286 Ga0495674_0234006 3300047319 Bacteria 1515
287 Ga0495680_0215661 3300047322 Bacteria 1372
288 Ga0495680_0257505 3300047322 Bacteria 1235
289 Ga0495680_0295490 3300047322 Bacteria 1138
290 Ga0495684_0214760 3300047471 Bacteria 1412
291 Ga0495593_0000358 3300047673 Bacteria 25227
292 Ga0495602_0229529 3300048088 Bacteria 1396
293 Ga0495614_0012164 3300048089 Bacteria 3778
294 Ga0496100_0012541 3300048903 Bacteria 4861
295 Ga0496101_0043442 3300048904 Bacteria 3212
296 Ga0496102_0064128 3300048905 Bacteria 3365
297 Ga0496102_0507208 3300048905 Bacteria 1128
298 Ga0496103_0005447 3300048906 Bacteria 7613
299 Ga0496103_0129755 3300048906 Bacteria 1609
300 Ga0496104_0141581 3300048907 Bacteria 2310
301 Ga0496106_0014103 3300048909 Bacteria 5905
302 Ga0496106_0016966 3300048909 Bacteria 5389
303 Ga0496107_0003668 3300048910 Bacteria 10322
304 Ga0496107_0022333 3300048910 Bacteria 4471
305 Ga0496108_0079447 3300048911 Bacteria 2778
306 Ga0496108_0081841 3300048911 Bacteria 2737
307 Ga0496108_0083005 3300048911 Bacteria 2717
308 Ga0496109_0029190 3300048912 Bacteria 4939
309 Ga0496109_0033442 3300048912 Bacteria 4626
310 Ga0496109_0349913 3300048912 Bacteria 1396
311 Ga0496110_0022481 3300048913 Bacteria 5355
312 Ga0496110_0053221 3300048913 Bacteria 3558
313 Ga0496110_0056200 3300048913 Bacteria 3463
314 Ga0496111_0013124 3300048914 Bacteria 5629
315 Ga0496111_0013313 3300048914 Bacteria 5594
316 Ga0496111_0086334 3300048914 Bacteria 2296
317 Ga0496111_0451239 3300048914 Bacteria 949
318 Ga0496112_0003989 3300048915 Bacteria 12369
319 Ga0496112_0026580 3300048915 Bacteria 5573
320 Ga0496112_0056922 3300048915 Bacteria 3849
321 Ga0496112_0115474 3300048915 Bacteria 2655
322 Ga0496112_0138094 3300048915 Bacteria 2407
323 Ga0496113_0165496 3300048916 Bacteria 1750
324 Ga0496113_0422611 3300048916 Bacteria 1070
325 Ga0496114_0008480 3300048917 Bacteria 8145
326 Ga0496115_0289027 3300048918 Bacteria 1345
327 Ga0496115_0301671 3300048918 Bacteria 1312
328 Ga0501032_0017425 3300049569 Bacteria 5045
329 Ga0501033_0038108 3300049570 Bacteria 3596
330 Ga0501034_0237536 3300049571 Bacteria 1769
331 Ga0501037_0027245 3300049573 Bacteria 4221
332 Ga0501038_0012676 3300049574 Bacteria 7704
333 Ga0501039_0008489 3300049575 Bacteria 7832
334 Ga0501040_0052959 3300049576 Bacteria 2778
335 Ga0501041_0078614 3300049577 Bacteria 2030
336 Ga0501042_0012806 3300049578 Bacteria 5693
337 Ga0501043_0107239 3300049579 Bacteria 2193
338 Ga0501046_0025746 3300049580 Bacteria 4811
339 Ga0501047_0166705 3300049581 Bacteria 2073
340 Ga0501048_0007474 3300049582 Bacteria 8279
341 Ga0501067_0065214 3300049583 Bacteria 2016
342 Ga0501067_0249617 3300049583 Bacteria 988
343 Ga0501068_0002374 3300049584 Bacteria 10012
344 Ga0501069_0031341 3300049585 Bacteria 2923
345 Ga0501069_0056497 3300049585 Bacteria 2187
346 Ga0501069_0158453 3300049585 Bacteria 1303
347 Ga0501070_0048152 3300049586 Bacteria 3541
348 Ga0501070_0094786 3300049586 Bacteria 2470
349 Ga0501071_0114434 3300049587 Bacteria 1995
350 Ga0501072_0131411 3300049588 Bacteria 1995
351 Ga0501073_0021376 3300049589 Bacteria 4664
352 Ga0501074_0087510 3300049590 Bacteria 2231
353 Ga0501074_0338661 3300049590 Bacteria 1068
354 Ga0501075_0128675 3300049591 Bacteria 1928
355 Ga0501076_0180552 3300049592 Bacteria 1720
356 Ga0501079_0241074 3300049741 Bacteria 1412
357 Ga0501081_0137127 3300049743 Bacteria 1752
358 Ga0501081_0299497 3300049743 Bacteria 1179
359 Ga0501083_0059901 3300049744 Bacteria 2545
360 Ga0501044_0071342 3300049823 Bacteria 3532
361 Ga0501045_0151975 3300049824 Bacteria 1722
362 nmdc:mga03683_94584_c1 3300050489 Bacteria 1306
363 nmdc:mga05p37_538666_c1 3300050507 Bacteria 1331
364 nmdc:mga08y16_12328_c1 3300050511 Bacteria 8989
365 nmdc:mga0n895_268354_c1 3300050512 Bacteria 1731
366 Ga0495601_0047793 3300053077 Bacteria 2694
367 Ga0495601_0293498 3300053077 Bacteria 1059
368 Ga0495612_0004427 3300053078 Bacteria 5825
369 Ga0495595_0011603 3300053084 Bacteria 3687
370 Ga0500566_0033184 3300053094 Bacteria 3009
371 Ga0590075_028235 3300059424 Bacteria 1417
372 Ga0590077_012512 3300059426 Bacteria 1761
373 Ga0501082_0114227 3300060353 Bacteria 2338
374 Ga0466962_0004857 3300061719 Bacteria 6471
375 Ga0530510_0165985 3300061734 Bacteria 1634
376 Ga0530510_0351560 3300061734 Bacteria 1107
377 Ga0070713_100491665
378 rootL2_10206479
379 Ga0068869_100532946
380 Ga0070680_100138818
381 Ga0070680_100237567
382 Ga0070660_100002458
383 Ga0070660_100021777
384 Ga0070669_100086357
385 Ga0070675_100236591
386 Ga0070674_100031157
387 Ga0070673_100255780
388 Ga0070659_100401861
389 Ga0070659_100927782
390 Ga0070703_10085442
391 Ga0070714_100011046
392 Ga0070714_100014958
393 Ga0070714_100084610
394 Ga0070713_100011866
395 Ga0070713_100067326
396 Ga0070713_100188516
397 Ga0070710_10003409
398 Ga0070711_100027387
399 Ga0070700_100215653
400 Ga0070662_100042501
401 Ga0070681_10018844
402 Ga0070681_10096807
403 Ga0070681_10109291
404 Ga0070681_10179061
405 Ga0070681_10378371
406 Ga0068867_100196693
407 Ga0068867_100502846
408 Ga0068867_100509220
409 Ga0070706_100373866
410 Ga0070707_100517774
411 Ga0070698_100160575
412 Ga0070698_100219030
413 Ga0070699_100118175
414 Ga0070699_100195943
415 Ga0070679_100124493
416 Ga0070679_100421245
417 Ga0070684_100018317
418 Ga0070684_100023709
419 Ga0068853_100378154
420 Ga0070672_100475941
421 Ga0070696_100135691
422 Ga0070696_100765942
423 Ga0070665_100065167
424 Ga0070704_100038619
425 Ga0068855_100167899
426 Ga0068855_100311652
427 Ga0070664_100068412
428 Ga0068854_100041072
429 Ga0068856_100344540
430 Ga0068856_100438980
431 Ga0068852_100074865
432 Ga0068852_100613523
433 Ga0068851_10294400
434 Ga0068863_100184048
435 Ga0070717_10001757
436 Ga0070717_10035759
437 Ga0070717_10062702
438 Ga0070717_10595669
439 Ga0075432_10061159
440 Ga0070716_100000830
441 Ga0070712_100032958
442 Ga0070712_100041206
443 Ga0070712_100042445
444 Ga0068865_100178844
445 Ga0075436_100055243
446 Ga0105240_10216077
447 Ga0111539_10024998
448 Ga0105245_10141101
449 Ga0105245_10171807
450 Ga0114129_10225203
451 Ga0105239_10006265
452 Ga0157371_10573387
453 Ga0157370_10336282
454 Ga0157369_10086492
455 Ga0157374_10629965
456 Ga0163162_10246358
457 Ga0157372_10141459
458 Ga0163163_10433192
459 Ga0157380_10062244
460 Ga0157380_10111608
461 Ga0182008_10091476
462 Ga0206356_10385390
463 Ga0206354_11395182
464 Ga0206353_11494585
465 Ga0207688_10080730
466 Ga0207688_10089462
467 Ga0207699_10007757
468 Ga0207705_10258134
469 Ga0207654_10321895
470 Ga0207707_10062623
471 Ga0207707_10093956
472 Ga0207707_10150497
473 Ga0207707_10186281
474 Ga0207695_10130388
475 Ga0207695_10289868
476 Ga0207693_10005548
477 Ga0207693_10573770
478 Ga0207663_10007473
479 Ga0207660_10392443
480 Ga0207657_10003276
481 Ga0207657_10003932
482 Ga0207649_10089536
483 Ga0207652_10178791
484 Ga0207652_10219433
485 Ga0207652_10723853
486 Ga0207646_10732992
487 Ga0207659_10150002
488 Ga0207687_10132445
489 Ga0207700_10022637
490 Ga0207664_10002009
491 Ga0207664_10003758
492 Ga0207664_10010008
493 Ga0207664_10013433
494 Ga0207690_10182895
495 Ga0207690_10356303
496 Ga0207706_10090300
497 Ga0207669_10041589
498 Ga0207704_10082162
499 Ga0207665_10000793
500 Ga0207691_10204899
501 Ga0207689_10595477
502 Ga0207661_10269951
503 Ga0207661_10331198
504 Ga0207667_10187404
505 Ga0207640_10322582
506 Ga0207677_10487991
507 Ga0207708_10185321
508 Ga0207702_10100462
509 Ga0207648_10208343
510 Ga0207648_10237903
511 Ga0207675_100212097
512 Ga0207675_100371384
513 Ga0207683_10371843
514 Ga0207683_10701948
515 Ga0207698_11116283
516 Ga0268266_10104325
517 Ga0265326_10066087
518 Ga0265319_1003192
519 Ga0265334_10027739
520 Ga0265334_10028295
521 Ga0265318_10001532
522 Ga0265318_10003338
523 Ga0265338_10003714
524 Ga0265338_10014556
525 Ga0265338_10015430
526 Ga0265338_10027780
527 Ga0265338_10057492
528 Ga0265330_10230518
529 Ga0265332_10051568
530 Ga0265328_10001734
531 Ga0265325_10004366
532 Ga0265325_10242469
533 Ga0265329_10004213
534 Ga0265340_10016820
535 Ga0265339_10001965
536 Ga0265339_10022270
537 Ga0265327_10099607
538 Ga0265327_10136620
539 Ga0265316_10008588
540 Ga0265316_10010561
541 Ga0265316_10011381
542 Ga0265313_10003763
543 Ga0265314_10002877
544 Ga0265314_10013192
545 Ga0265314_10034197
546 Ga0265342_10013623
547 Ga0265342_10046163
548 Ga0265342_10170978
549 Ga0307410_10839289
550 Ga0307412_10592291
551 Ga0307409_100290948
552 Ga0307409_100293737
553 Ga0307416_100413856
554 Ga0307416_100745140
555 Ga0373926_0004191
556 Ga0373945_0019983
557 Ga0373943_0000485
558 Ga0373946_0044702
559 Ga0373924_0124003
560 Ga0373947_0002997
561 Ga0373925_0055024
562 Ga0395899_0243949
563 Ga0395900_0272729
564 Ga0395900_0972753
565 Ga0395898_0337025
566 Ga0395905_0176728
567 Ga0395905_0330861
568 Ga0395901_0400637
569 Ga0395901_0596999
570 Ga0439438_030518
571 Ga0439461_0009938
572 Ga0439465_0227068
573 Ga0439437_007027
574 Ga0439463_069645
575 Ga0450920_002907
576 Ga0450920_017192
577 Ga0450898_055137
578 Ga0450907_035031
579 Ga0439446_0001906
580 Ga0439446_0044308
581 Ga0439434_0017773
582 Ga0450918_006948
583 Ga0466969_0000749
584 Ga0466966_0016983
585 Ga0466966_0043063
586 Ga0466961_0028244
587 Ga0466963_0000248
588 Ga0466963_0000355
589 Ga0466963_0000854
590 Ga0466964_0007686
591 Ga0466964_0008673
592 Ga0466964_0045295
593 Ga0466968_0058483
594 Ga0466968_0111635
595 Ga0466970_0006693
596 Ga0466957_0020759
597 Ga0466957_0036847
598 Ga0466959_0001794
599 Ga0466958_0001851
600 Ga0466958_0002821
601 Ga0466958_0100100
602 Ga0466967_0000219
603 Ga0466967_0008229
604 Ga0466967_0009549
605 Ga0466967_0111940
606 Ga0466967_0146585
607 Ga0466967_0212311
608 Ga0466967_0263789
609 Ga0495592_0002313
610 Ga0495592_0064794
611 Ga0495629_0017474
612 Ga0495629_0038381
613 Ga0495629_0060439
614 Ga0495641_0008094
615 Ga0495651_0328858
616 Ga0495653_0017311
617 Ga0495653_0018726
618 Ga0495653_0097335
619 Ga0495580_0064912
620 Ga0495582_0000560
621 Ga0495582_0193906
622 Ga0495639_0000517
623 Ga0495664_0035439
624 Ga0495664_0111488
625 Ga0495584_0013313
626 Ga0495596_0093656
627 Ga0495607_0041873
628 Ga0495607_0147756
629 Ga0495618_0016647
630 Ga0495628_0017025
631 Ga0495628_0352904
632 Ga0495630_0001418
633 Ga0495630_0226913
634 Ga0495630_0331467
635 Ga0495644_0059326
636 Ga0495663_0027836
637 Ga0495666_0000186
638 Ga0495652_0043635
639 Ga0495652_0046270
640 Ga0495652_0248469
641 Ga0495665_0001413
642 Ga0495586_0082731
643 Ga0495587_0020144
644 Ga0495667_0103452
645 Ga0495667_0223554
646 Ga0495667_0250673
647 Ga0495656_0075119
648 Ga0495635_0028916
649 Ga0495635_0094068
650 Ga0495635_0377450
651 Ga0495659_0105542
652 Ga0495661_0077068
653 Ga0495657_0238771
654 Ga0495599_0065142
655 Ga0495623_0028486
656 Ga0495647_0000811
657 Ga0495658_0001241
658 Ga0495624_0008189
659 Ga0495624_0025947
660 Ga0495589_0052904
661 Ga0495581_0003648
662 Ga0495674_0234006
663 Ga0495680_0215661
664 Ga0495680_0257505
665 Ga0495680_0295490
666 Ga0495684_0214760
667 Ga0495593_0000358
668 Ga0495602_0229529
669 Ga0495614_0012164
670 Ga0496100_0012541
671 Ga0496101_0043442
672 Ga0496102_0064128
673 Ga0496102_0507208
674 Ga0496103_0005447
675 Ga0496103_0129755
676 Ga0496104_0141581
677 Ga0496106_0014103
678 Ga0496106_0016966
679 Ga0496107_0003668
680 Ga0496107_0022333
681 Ga0496108_0079447
682 Ga0496108_0081841
683 Ga0496108_0083005
684 Ga0496109_0029190
685 Ga0496109_0033442
686 Ga0496109_0349913
687 Ga0496110_0022481
688 Ga0496110_0053221
689 Ga0496110_0056200
690 Ga0496111_0013124
691 Ga0496111_0013313
692 Ga0496111_0086334
693 Ga0496111_0451239
694 Ga0496112_0003989
695 Ga0496112_0026580
696 Ga0496112_0056922
697 Ga0496112_0115474
698 Ga0496112_0138094
699 Ga0496113_0165496
700 Ga0496113_0422611
701 Ga0496114_0008480
702 Ga0496115_0289027
703 Ga0496115_0301671
704 Ga0501032_0017425
705 Ga0501033_0038108
706 Ga0501034_0237536
707 Ga0501037_0027245
708 Ga0501038_0012676
709 Ga0501039_0008489
710 Ga0501040_0052959
711 Ga0501041_0078614
712 Ga0501042_0012806
713 Ga0501043_0107239
714 Ga0501046_0025746
715 Ga0501047_0166705
716 Ga0501048_0007474
717 Ga0501067_0065214
718 Ga0501067_0249617
719 Ga0501068_0002374
720 Ga0501069_0031341
721 Ga0501069_0056497
722 Ga0501069_0158453
723 Ga0501070_0048152
724 Ga0501070_0094786
725 Ga0501071_0114434
726 Ga0501072_0131411
727 Ga0501073_0021376
728 Ga0501074_0087510
729 Ga0501074_0338661
730 Ga0501075_0128675
731 Ga0501076_0180552
732 Ga0501079_0241074
733 Ga0501081_0137127
734 Ga0501081_0299497
735 Ga0501083_0059901
736 Ga0501044_0071342
737 Ga0501045_0151975
738 nmdc:mga03683_94584_c1
739 nmdc:mga05p37_538666_c1
740 nmdc:mga08y16_12328_c1
741 nmdc:mga0n895_268354_c1
742 Ga0495601_0047793
743 Ga0495601_0293498
744 Ga0495612_0004427
745 Ga0495595_0011603
746 Ga0500566_0033184
747 Ga0590075_028235
748 Ga0590077_012512
749 Ga0501082_0114227
750 Ga0466962_0004857
751 Ga0530510_0165985
752 Ga0530510_0351560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

16

201

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

22

228

0.93

PF08659

KR

KR domain

17

193

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

18

188

0.84

PF23441

11

209

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xew-assembly1.cif.gz_A structure of serratia marcescens 2,3-butanediol dehydrogenase 0.9372 3 206
6ihi-assembly1.cif.gz_A crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9295 3 206
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9292 3 206
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9287 3 217
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9271 1 218
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 6 47 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.932 3 184 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9312 1 218 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9287 3 217 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9271 1 218 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A538E9C5-F1-model_v4 SDR family oxidoreductase 0.9836 3 223 GO:0005829
GO:0016491
AF-A0A538E9C5-F1-model_v4 SDR family oxidoreductase 0.9706 3 223 GO:0005829
GO:0016491
AF-A0A349D8L2-F1-model_v4 Short chain dehydrogenase 0.9648 3 178 GO:0016491
AF-A0A538I9J2-F1-model_v4 SDR family oxidoreductase 0.9643 3 175 GO:0005829
GO:0016491
AF-A0A1F2Q3T7-F1-model_v4 deleted 0.9634 3 162

Map