F427177

General Info

Members Datasets Scaffolds Average Seq Length
375 199 371 129

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0774859|Ga0496126_0774859_238_660
Length 140
Sequence VARDWLWVTVEVAMAAHAEQLAEHGGGEGVRDSELLHSAMAPPQNLAVYGQPDAAALAAAYAYGIARNHPFVDGNKRTAAVVSETFLVLNGRALDATDAELTVAFLASLRGNWRNWKWPTGSGRISPKTANKPEIAPTSP

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
3 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
163 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
164 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
165 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
166 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
169 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
170 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
171 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
172 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
173 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
176 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
177 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
178 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
179 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
180 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
192 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
195 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.2
Nodule 0
Rhizoplane 1.6
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1012196 3300001976 Bacteria 1124
2 JGI24751J29686_10009680 3300002459 Bacteria 1985
3 Ga0070658_10000002 3300005327 Bacteria 637290
4 Ga0070658_10083718 3300005327 Bacteria 2622
5 Ga0070658_10150602 3300005327 Bacteria 1947
6 Ga0070658_10260239 3300005327 Bacteria 1473
7 Ga0070683_100499935 3300005329 Bacteria 1161
8 Ga0070683_100555682 3300005329 Bacteria 1098
9 Ga0070670_100020279 3300005331 Bacteria 5712
10 Ga0070670_100099214 3300005331 Bacteria 2506
11 Ga0070677_10194271 3300005333 Bacteria 975
12 Ga0070677_10305986 3300005333 Bacteria 809
13 Ga0070666_10000171 3300005335 Bacteria 44565
14 Ga0070666_10007696 3300005335 Bacteria 6650
15 Ga0070680_100588115 3300005336 Bacteria 955
16 Ga0070660_100004628 3300005339 Bacteria 9524
17 Ga0070660_100026532 3300005339 Bacteria 4314
18 Ga0070660_100301588 3300005339 Bacteria 1313
19 Ga0070660_100663090 3300005339 Bacteria 874
20 Ga0070660_101017177 3300005339 Bacteria 700
21 Ga0070660_101046677 3300005339 Bacteria 690
22 Ga0070661_100035509 3300005344 Bacteria 3620
23 Ga0070661_100093796 3300005344 Bacteria 2224
24 Ga0070692_10120800 3300005345 Bacteria 1461
25 Ga0070668_101950271 3300005347 Bacteria 541
26 Ga0070669_100000001 3300005353 Bacteria 537589
27 Ga0070669_100053481 3300005353 Bacteria 2956
28 Ga0070669_101120817 3300005353 Bacteria 678
29 Ga0070675_100172200 3300005354 Bacteria 1867
30 Ga0070675_101459615 3300005354 Bacteria 631
31 Ga0070671_100000007 3300005355 Bacteria 250397
32 Ga0070671_100435757 3300005355 Bacteria 1123
33 Ga0070671_100694322 3300005355 Bacteria 882
34 Ga0070673_100133111 3300005364 Bacteria 2089
35 Ga0070659_100015286 3300005366 Bacteria 5746
36 Ga0070659_100060772 3300005366 Bacteria 2985
37 Ga0070659_100072796 3300005366 Bacteria 2735
38 Ga0070659_100501205 3300005366 Bacteria 1035
39 Ga0070659_101780242 3300005366 Bacteria 551
40 Ga0070659_102010811 3300005366 Bacteria 519
41 Ga0070667_100000278 3300005367 Bacteria 58278
42 Ga0070667_100034589 3300005367 Bacteria 4228
43 Ga0070667_100059889 3300005367 Bacteria 3222
44 Ga0070714_100382719 3300005435 Unclassified 1327
45 Ga0070705_100000876 3300005440 Bacteria 16841
46 Ga0070708_100025502 3300005445 Bacteria 5054
47 Ga0070662_100075323 3300005457 Bacteria 2499
48 Ga0070662_100090875 3300005457 Bacteria 2292
49 Ga0070662_100286794 3300005457 Bacteria 1334
50 Ga0070679_100098388 3300005530 Bacteria 2913
51 Ga0070679_100122181 3300005530 Bacteria 2588
52 Ga0070679_100687717 3300005530 Bacteria 966
53 Ga0068853_100147732 3300005539 Bacteria 2114
54 Ga0070672_100002989 3300005543 Bacteria 10891
55 Ga0070693_100198305 3300005547 Bacteria 1302
56 Ga0070665_100007476 3300005548 Bacteria 11108
57 Ga0070665_100093446 3300005548 Bacteria 3013
58 Ga0070665_100143309 3300005548 Bacteria 2392
59 Ga0068855_100071229 3300005563 Bacteria 4043
60 Ga0068855_100081423 3300005563 Bacteria 3752
61 Ga0068855_100097195 3300005563 Bacteria 3392
62 Ga0070664_100067149 3300005564 Bacteria 3064
63 Ga0070664_100287522 3300005564 Bacteria 1484
64 Ga0068857_100273137 3300005577 Bacteria 1554
65 Ga0068857_100568114 3300005577 Unclassified 1070
66 Ga0068854_100486321 3300005578 Bacteria 1037
67 Ga0068854_100842639 3300005578 Bacteria 802
68 Ga0068856_100375864 3300005614 Unclassified 1440
69 Ga0068856_102267233 3300005614 Bacteria 551
70 Ga0068859_100000847 3300005617 Bacteria 31136
71 Ga0068859_100005948 3300005617 Bacteria 12385
72 Ga0068861_100017197 3300005719 Bacteria 5127
73 Ga0068861_101745172 3300005719 Bacteria 616
74 Ga0068851_10742579 3300005834 Bacteria 607
75 Ga0068863_100000670 3300005841 Bacteria 34540
76 Ga0068863_100002654 3300005841 Bacteria 17693
77 Ga0068863_100467699 3300005841 Bacteria 1239
78 Ga0068858_100000212 3300005842 Bacteria 62654
79 Ga0068858_100002325 3300005842 Bacteria 19223
80 Ga0068858_100044043 3300005842 Bacteria 4138
81 Ga0068858_100090327 3300005842 Bacteria 2850
82 Ga0068858_100901944 3300005842 Bacteria 864
83 Ga0068860_100000007 3300005843 Bacteria 429329
84 Ga0068860_100000379 3300005843 Bacteria 58278
85 Ga0068860_100006333 3300005843 Bacteria 11885
86 Ga0068862_100000468 3300005844 Bacteria 43578
87 Ga0075364_10006299 3300006051 Bacteria 6968
88 Ga0075362_10000012 3300006177 Bacteria 106760
89 Ga0075369_10006498 3300006186 Bacteria 4421
90 Ga0075366_10008389 3300006195 Bacteria 5742
91 Ga0075366_10040866 3300006195 Bacteria 2744
92 Ga0075370_10000002 3300006353 Bacteria 142637
93 Ga0075430_100007354 3300006846 Bacteria 9302
94 Ga0097620_100000847 3300006931 Bacteria 31136
95 Ga0097620_100005948 3300006931 Bacteria 12385
96 Ga0105240_10028843 3300009093 Bacteria 7239
97 Ga0105240_10032726 3300009093 Bacteria 6728
98 Ga0105240_11400430 3300009093 Bacteria 735
99 Ga0105247_10005360 3300009101 Bacteria 8084
100 Ga0105241_10022953 3300009174 Bacteria 4625
101 Ga0105241_10092383 3300009174 Bacteria 2389
102 Ga0105248_10001007 3300009177 Bacteria 31154
103 Ga0105248_10017876 3300009177 Bacteria 7824
104 Ga0105248_10130844 3300009177 Bacteria 2831
105 Ga0105248_10159486 3300009177 Bacteria 2545
106 Ga0105248_10163032 3300009177 Bacteria 2514
107 Ga0105248_10216098 3300009177 Bacteria 2159
108 Ga0105238_10125269 3300009551 Bacteria 2548
109 Ga0105238_10256914 3300009551 Bacteria 1726
110 Ga0105249_10099231 3300009553 Bacteria 2736
111 Ga0105249_10929990 3300009553 Bacteria 937
112 Ga0105239_10026931 3300010375 Bacteria 6328
113 Ga0105239_10277128 3300010375 Bacteria 1887
114 Ga0105239_11534800 3300010375 Bacteria 770
115 Ga0157373_10022181 3300013100 Bacteria 4607
116 Ga0157373_10177437 3300013100 Bacteria 1500
117 Ga0157371_10048155 3300013102 Bacteria 3030
118 Ga0157370_10000095 3300013104 Bacteria 100727
119 Ga0157370_10026369 3300013104 Bacteria 5739
120 Ga0157370_11595041 3300013104 Bacteria 586
121 Ga0157369_10061148 3300013105 Bacteria 4061
122 Ga0157369_10511510 3300013105 Bacteria 1242
123 Ga0163162_10005892 3300013306 Bacteria 11856
124 Ga0163162_10011507 3300013306 Bacteria 8629
125 Ga0163162_10083188 3300013306 Bacteria 3274
126 Ga0157372_10006546 3300013307 Bacteria 12392
127 Ga0157372_10730233 3300013307 Bacteria 1152
128 Ga0157375_10054583 3300013308 Bacteria 3935
129 Ga0163163_10029453 3300014325 Bacteria 5281
130 Ga0163163_10370749 3300014325 Bacteria 1489
131 Ga0157380_10265572 3300014326 Bacteria 1561
132 Ga0157376_11246407 3300014969 Bacteria 773
133 Ga0163161_11792642 3300017792 Bacteria 545
134 Ga0213876_10000231 3300021384 Bacteria 54874
135 Ga0207697_10001100 3300025315 Bacteria 14913
136 Ga0207697_10099631 3300025315 Bacteria 1238
137 Ga0207656_10019329 3300025321 Bacteria 2694
138 Ga0207682_10107679 3300025893 Bacteria 1224
139 Ga0207710_10015239 3300025900 Bacteria 3246
140 Ga0207680_10000731 3300025903 Bacteria 15461
141 Ga0207680_10268334 3300025903 Bacteria 1183
142 Ga0207647_10366012 3300025904 Bacteria 815
143 Ga0207705_10000008 3300025909 Bacteria 589717
144 Ga0207705_10003200 3300025909 Bacteria 12469
145 Ga0207705_10231744 3300025909 Bacteria 1405
146 Ga0207705_10273547 3300025909 Bacteria 1292
147 Ga0207705_10370012 3300025909 Bacteria 1106
148 Ga0207705_11367542 3300025909 Bacteria 539
149 Ga0207695_10009384 3300025913 Bacteria 12102
150 Ga0207695_10019950 3300025913 Bacteria 7697
151 Ga0207671_10030702 3300025914 Bacteria 4005
152 Ga0207657_10000231 3300025919 Bacteria 58585
153 Ga0207657_10036493 3300025919 Bacteria 4399
154 Ga0207657_10157434 3300025919 Bacteria 1847
155 Ga0207657_10286508 3300025919 Bacteria 1307
156 Ga0207657_10567182 3300025919 Bacteria 887
157 Ga0207649_10012220 3300025920 Bacteria 4756
158 Ga0207649_10089369 3300025920 Bacteria 2014
159 Ga0207649_10966398 3300025920 Bacteria 669
160 Ga0207652_10073263 3300025921 Bacteria 2979
161 Ga0207652_10102569 3300025921 Bacteria 2529
162 Ga0207681_10000002 3300025923 Bacteria 985597
163 Ga0207681_10050638 3300025923 Bacteria 2811
164 Ga0207681_10318280 3300025923 Bacteria 1236
165 Ga0207681_10647221 3300025923 Bacteria 876
166 Ga0207694_10115465 3300025924 Bacteria 2139
167 Ga0207694_10224177 3300025924 Bacteria 1534
168 Ga0207650_10001084 3300025925 Bacteria 20152
169 Ga0207650_10019024 3300025925 Bacteria 4827
170 Ga0207650_10046524 3300025925 Bacteria 3195
171 Ga0207644_10000002 3300025931 Bacteria 942221
172 Ga0207644_10033498 3300025931 Bacteria 3590
173 Ga0207644_10536907 3300025931 Bacteria 967
174 Ga0207690_10001144 3300025932 Bacteria 16872
175 Ga0207690_10004588 3300025932 Bacteria 8164
176 Ga0207690_10131543 3300025932 Bacteria 1832
177 Ga0207690_10393770 3300025932 Bacteria 1103
178 Ga0207690_10442730 3300025932 Bacteria 1043
179 Ga0207706_10051323 3300025933 Bacteria 3642
180 Ga0207706_10321638 3300025933 Bacteria 1346
181 Ga0207706_10401993 3300025933 Bacteria 1187
182 Ga0207706_10597380 3300025933 Bacteria 948
183 Ga0207691_10053144 3300025940 Bacteria 3699
184 Ga0207711_10022744 3300025941 Bacteria 5244
185 Ga0207711_10144300 3300025941 Bacteria 2144
186 Ga0207711_10209597 3300025941 Bacteria 1780
187 Ga0207711_10642631 3300025941 Bacteria 990
188 Ga0207711_11686405 3300025941 Bacteria 577
189 Ga0207661_10449679 3300025944 Bacteria 1173
190 Ga0207661_10766846 3300025944 Bacteria 888
191 Ga0207679_10113141 3300025945 Bacteria 2146
192 Ga0207679_10547711 3300025945 Bacteria 1038
193 Ga0207667_10048980 3300025949 Bacteria 4465
194 Ga0207667_10066057 3300025949 Bacteria 3771
195 Ga0207667_10131889 3300025949 Bacteria 2574
196 Ga0207651_10824298 3300025960 Bacteria 823
197 Ga0207712_10004139 3300025961 Bacteria 9159
198 Ga0207712_11678797 3300025961 Bacteria 569
199 Ga0207668_10002056 3300025972 Bacteria 11724
200 Ga0207640_10383490 3300025981 Bacteria 1139
201 Ga0207658_10000487 3300025986 Bacteria 36563
202 Ga0207658_10014887 3300025986 Bacteria 5330
203 Ga0207658_10071149 3300025986 Bacteria 2633
204 Ga0207658_10087778 3300025986 Bacteria 2402
205 Ga0207658_10151310 3300025986 Bacteria 1891
206 Ga0207703_10000359 3300026035 Bacteria 49036
207 Ga0207703_10012001 3300026035 Bacteria 6748
208 Ga0207703_10055012 3300026035 Bacteria 3238
209 Ga0207703_10081266 3300026035 Bacteria 2701
210 Ga0207703_11443249 3300026035 Bacteria 662
211 Ga0207639_10007476 3300026041 Bacteria 7453
212 Ga0207639_10023636 3300026041 Bacteria 4439
213 Ga0207639_10043897 3300026041 Bacteria 3359
214 Ga0207678_10203437 3300026067 Bacteria 1693
215 Ga0207678_10579584 3300026067 Bacteria 983
216 Ga0207702_10341510 3300026078 Unclassified 1430
217 Ga0207641_10000042 3300026088 Bacteria 186384
218 Ga0207641_10001465 3300026088 Bacteria 23138
219 Ga0207641_10139918 3300026088 Bacteria 2182
220 Ga0207641_10462734 3300026088 Bacteria 1227
221 Ga0207676_10114677 3300026095 Bacteria 2261
222 Ga0207674_10103018 3300026116 Bacteria 2834
223 Ga0207674_10160969 3300026116 Bacteria 2199
224 Ga0207674_10378182 3300026116 Bacteria 1369
225 Ga0207675_100003316 3300026118 Bacteria 15757
226 Ga0207675_101834981 3300026118 Bacteria 625
227 Ga0207698_10033575 3300026142 Bacteria 3730
228 Ga0268266_10011250 3300028379 Bacteria 7788
229 Ga0268266_10037840 3300028379 Bacteria 4108
230 Ga0268265_10001875 3300028380 Bacteria 16712
231 Ga0268264_10000039 3300028381 Bacteria 376641
232 Ga0268264_10000134 3300028381 Bacteria 179475
233 Ga0268264_10000288 3300028381 Bacteria 84755
234 Ga0307517_10018168 3300028786 Bacteria 9112
235 Ga0307408_100091844 3300031548 Bacteria 2293
236 Ga0307408_100336977 3300031548 Bacteria 1275
237 Ga0307408_100564766 3300031548 Bacteria 1006
238 Ga0307405_11956837 3300031731 Unclassified 524
239 Ga0307413_10400665 3300031824 Bacteria 1075
240 Ga0307413_10542097 3300031824 Bacteria 942
241 Ga0307410_10352547 3300031852 Bacteria 1176
242 Ga0307406_10077809 3300031901 Bacteria 2195
243 Ga0307406_10122557 3300031901 Bacteria 1810
244 Ga0307406_10165315 3300031901 Bacteria 1595
245 Ga0307406_10595567 3300031901 Bacteria 911
246 Ga0307406_11669774 3300031901 Bacteria 564
247 Ga0307407_10505014 3300031903 Bacteria 887
248 Ga0307412_10038508 3300031911 Bacteria 3079
249 Ga0307412_10333569 3300031911 Bacteria 1211
250 Ga0307412_10681659 3300031911 Bacteria 880
251 Ga0307409_100281922 3300031995 Bacteria 1536
252 Ga0307409_100419428 3300031995 Bacteria 1283
253 Ga0307409_100971941 3300031995 Bacteria 866
254 Ga0307416_100015025 3300032002 Bacteria 5330
255 Ga0307416_100016362 3300032002 Bacteria 5153
256 Ga0307416_100051662 3300032002 Bacteria 3285
257 Ga0307416_101764175 3300032002 Bacteria 723
258 Ga0307414_10461818 3300032004 Bacteria 1116
259 Ga0307411_10144971 3300032005 Bacteria 1756
260 Ga0307411_11450602 3300032005 Bacteria 629
261 Ga0307415_100219917 3300032126 Bacteria 1522
262 Ga0307415_100271376 3300032126 Bacteria 1390
263 Ga0307415_100748881 3300032126 Bacteria 887
264 Ga0307510_10471450 3300033180 Bacteria 697
265 Ga0373948_0012221 3300034817 Bacteria 1530
266 Ga0373932_0080648 3300035112 Bacteria 1027
267 Ga0373946_0667812 3300035171 Bacteria 542
268 Ga0373931_0005630 3300035691 Bacteria 5812
269 Ga0373927_0735246 3300035695 Unclassified 652
270 Ga0373947_0895497 3300035725 Bacteria 606
271 Ga0395899_0047898 3300037312 Bacteria 3181
272 Ga0395899_0099730 3300037312 Bacteria 2098
273 Ga0395899_0109271 3300037312 Bacteria 1990
274 Ga0395900_0138385 3300037418 Unclassified 2494
275 Ga0395900_0247995 3300037418 Bacteria 1783
276 Ga0395900_0370863 3300037418 Bacteria 1401
277 Ga0395898_0025421 3300037466 Bacteria 5966
278 Ga0395898_0368860 3300037466 Bacteria 1369
279 Ga0395905_0019876 3300037471 Bacteria 6364
280 Ga0395905_0059546 3300037471 Unclassified 3570
281 Ga0395905_0085326 3300037471 Bacteria 2959
282 Ga0395901_0098514 3300038443 Bacteria 3065
283 Ga0395901_0272171 3300038443 Bacteria 1761
284 Ga0436365_1799730 3300039437 Bacteria 37517
285 Ga0439448_0263459 3300042005 Bacteria 609
286 Ga0466965_0302574 3300044683 Bacteria 868
287 Ga0466963_0054167 3300044694 Bacteria 2665
288 Ga0466957_0228301 3300044842 Bacteria 1232
289 Ga0466967_0001258 3300045976 Bacteria 14335
290 Ga0495629_0494499 3300046459 Bacteria 825
291 Ga0495665_0665843 3300046531 Bacteria 517
292 Ga0495597_0018431 3300046542 Bacteria 3276
293 Ga0495668_0024562 3300046616 Bacteria 3428
294 Ga0495668_0865416 3300046616 Unclassified 501
295 Ga0495669_0053689 3300046684 Bacteria 1813
296 Ga0495649_0441564 3300046694 Bacteria 650
297 Ga0495673_0051064 3300047469 Unclassified 1812
298 Ga0495686_0000124 3300047472 Bacteria 159708
299 Ga0495686_0018788 3300047472 Bacteria 4629
300 Ga0496102_0001152 3300048905 Bacteria 24155
301 Ga0496103_0010377 3300048906 Bacteria 5512
302 Ga0496103_0163997 3300048906 Bacteria 1426
303 Ga0496109_0072720 3300048912 Bacteria 3159
304 Ga0496112_0353252 3300048915 Bacteria 1412
305 Ga0496114_0077779 3300048917 Bacteria 2798
306 Ga0496116_0016572 3300048919 Bacteria 5759
307 Ga0496117_0004644 3300048920 Bacteria 14954
308 Ga0496117_0031867 3300048920 Bacteria 4017
309 Ga0496117_0164078 3300048920 Bacteria 1298
310 Ga0496117_0187925 3300048920 Bacteria 1180
311 Ga0496117_0250377 3300048920 Bacteria 967
312 Ga0496118_0008102 3300048921 Bacteria 10951
313 Ga0496118_0034462 3300048921 Bacteria 4129
314 Ga0496118_0048241 3300048921 Bacteria 3292
315 Ga0496118_0050358 3300048921 Bacteria 3198
316 Ga0496118_0055518 3300048921 Bacteria 2988
317 Ga0496120_0169717 3300048923 Bacteria 1080
318 Ga0496121_0000038 3300048924 Bacteria 351739
319 Ga0496121_0000196 3300048924 Bacteria 135812
320 Ga0496121_0002140 3300048924 Bacteria 31024
321 Ga0496121_0004045 3300048924 Bacteria 20145
322 Ga0496121_0137589 3300048924 Bacteria 1817
323 Ga0496122_0184690 3300048925 Bacteria 1239
324 Ga0496123_0179658 3300048926 Bacteria 1107
325 Ga0496124_0206458 3300048927 Bacteria 1490
326 Ga0496126_0004002 3300048929 Bacteria 17973
327 Ga0496126_0044109 3300048929 Bacteria 4109
328 Ga0496126_0424260 3300048929 Bacteria 1075
329 Ga0496126_0774859 3300048929 Bacteria 738
330 Ga0501290_007118 3300049513 Bacteria 1399
331 Ga0501292_000062 3300049515 Bacteria 21818
332 Ga0501202_035177 3300049652 Bacteria 1062
333 Ga0501206_006471 3300049653 Bacteria 1524
334 Ga0501222_008238 3300049662 Bacteria 1383
335 Ga0501223_010592 3300049663 Bacteria 1852
336 Ga0501224_008656 3300049664 Bacteria 1484
337 Ga0501227_019973 3300049665 Bacteria 1532
338 Ga0501235_024135 3300049669 Bacteria 1357
339 Ga0501257_050069 3300049686 Bacteria 1040
340 Ga0501259_006329 3300049688 Bacteria 1882
341 Ga0501261_003099 3300049690 Bacteria 2041
342 Ga0501225_0008636 3300049705 Bacteria 2920
343 Ga0501245_072899 3300049708 Bacteria 650
344 Ga0501279_000013 3300049775 Bacteria 78551
345 Ga0501280_000105 3300049776 Bacteria 22016
346 Ga0501281_01163 3300049777 Bacteria 2099
347 Ga0501282_000186 3300049778 Bacteria 7581
348 Ga0501283_010750 3300049779 Bacteria 1351
349 Ga0501044_0434810 3300049823 Bacteria 1221
350 Ga0501044_1162685 3300049823 Bacteria 640
351 nmdc:mga03683_35_c1 3300050489 Bacteria 65966
352 nmdc:mga03n38_713_c1 3300050490 Bacteria 8728
353 nmdc:mga00v17_5822_c1 3300050491 Bacteria 6507
354 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
355 nmdc:mga0k408_73481_c1 3300050493 Bacteria 1997
356 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
357 nmdc:mga0sz30_1223_c1 3300050516 Bacteria 9170
358 Ga0500583_0366019 3300053092 Bacteria 696
359 Ga0500651_0000538 3300053093 Bacteria 19288
360 Ga0500651_0147786 3300053093 Bacteria 1413
361 Ga0500641_0002349 3300053096 Bacteria 6704
362 Ga0500642_0001907 3300053130 Bacteria 6031
363 Ga0500655_001003 3300053133 Bacteria 5455
364 Ga0500559_0021777 3300053136 Bacteria 2718
365 Ga0500564_385867 3300053138 Unclassified 511
366 Ga0500590_000427 3300053148 Bacteria 14144
367 Ga0500616_0205265 3300053153 Bacteria 870
368 Ga0500622_0018428 3300053156 Bacteria 3712
369 Ga0500636_0136797 3300053177 Bacteria 1360
370 Ga0500636_0282426 3300053177 Bacteria 828
371 Ga0500570_000470 3300053724 Bacteria 15608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_101780242 Ga0070659_1017802421 111
2 3300048924 Ga0496121_0002140 Ga0496121_0002140_17648_17992 114
3 3300005354 Ga0070675_101459615 Ga0070675_1014596151 116
4 3300037418 Ga0395900_0138385 Ga0395900_0138385_1062_1448 116
5 3300037471 Ga0395905_0059546 Ga0395905_0059546_1163_1549 116
6 3300025961 Ga0207712_11678797 Ga0207712_116787972 117
7 3300013307 Ga0157372_10730233 Ga0157372_107302332 118
8 3300026035 Ga0207703_11443249 Ga0207703_114432492 118
9 3300031548 Ga0307408_100336977 Ga0307408_1003369771 118
10 3300031824 Ga0307413_10542097 Ga0307413_105420972 118
11 3300031901 Ga0307406_10122557 Ga0307406_101225572 118
12 3300031911 Ga0307412_10333569 Ga0307412_103335692 118
13 3300032002 Ga0307416_100016362 Ga0307416_1000163622 118
14 3300032005 Ga0307411_11450602 Ga0307411_114506022 118
15 3300005842 Ga0068858_100090327 Ga0068858_1000903272 122
16 3300026035 Ga0207703_10081266 Ga0207703_100812663 122
17 3300037466 Ga0395898_0368860 Ga0395898_0368860_473_844 122
18 3300042005 Ga0439448_0263459 Ga0439448_0263459_115_489 122
19 3300013306 Ga0163162_10083188 Ga0163162_100831881 123
20 3300034817 Ga0373948_0012221 Ga0373948_0012221_898_1278 125
21 iso_pu_bacteria 2582581305 2585259786 125
22 iso_pu_bacteria 2775507255 2778126070 125
23 iso_pu_bacteria 2882806704 2882806874 125
24 3300005327 Ga0070658_10150602 Ga0070658_101506023 126
25 3300005339 Ga0070660_100663090 Ga0070660_1006630902 126
26 3300025909 Ga0207705_10231744 Ga0207705_102317442 126
27 3300048929 Ga0496126_0774859 Ga0496126_0774859_238_660 126
28 3300005841 Ga0068863_100002654 Ga0068863_10000265413 127
29 3300006846 Ga0075430_100007354 Ga0075430_10000735415 127
30 3300026088 Ga0207641_10001465 Ga0207641_100014656 127
31 3300031901 Ga0307406_10595567 Ga0307406_105955671 127
32 3300031901 Ga0307406_11669774 Ga0307406_116697742 127
33 3300032002 Ga0307416_101764175 Ga0307416_1017641752 127
34 3300032126 Ga0307415_100748881 Ga0307415_1007488811 127
35 3300037312 Ga0395899_0047898 Ga0395899_0047898_1858_2253 127
36 3300037466 Ga0395898_0025421 Ga0395898_0025421_2288_2683 127
37 3300038443 Ga0395901_0098514 Ga0395901_0098514_988_1383 127
38 3300047469 Ga0495673_0051064 Ga0495673_0051064_562_945 127
39 3300047472 Ga0495686_0000124 Ga0495686_0000124_115090_115473 127
40 3300048924 Ga0496121_0002140 Ga0496121_0002140_896_1306 127
41 3300005339 Ga0070660_101046677 Ga0070660_1010466771 128
42 3300005347 Ga0070668_101950271 Ga0070668_1019502711 128
43 3300005366 Ga0070659_100015286 Ga0070659_1000152866 128
44 3300005435 Ga0070714_100382719 Ga0070714_1003827192 128
45 3300005548 Ga0070665_100143309 Ga0070665_1001433095 128
46 3300005614 Ga0068856_100375864 Ga0068856_1003758643 128
47 3300005614 Ga0068856_102267233 Ga0068856_1022672331 128
48 3300005617 Ga0068859_100000847 Ga0068859_10000084730 128
49 3300005719 Ga0068861_100017197 Ga0068861_1000171975 128
50 3300005842 Ga0068858_100002325 Ga0068858_1000023253 128
51 3300005843 Ga0068860_100006333 Ga0068860_1000063333 128
52 3300005844 Ga0068862_100000468 Ga0068862_10000046814 128
53 3300006931 Ga0097620_100000847 Ga0097620_10000084730 128
54 3300009093 Ga0105240_10028843 Ga0105240_100288437 128
55 3300009093 Ga0105240_10032726 Ga0105240_100327268 128
56 3300009101 Ga0105247_10005360 Ga0105247_100053607 128
57 3300009177 Ga0105248_10017876 Ga0105248_100178766 128
58 3300009553 Ga0105249_10099231 Ga0105249_100992313 128
59 3300013104 Ga0157370_10000095 Ga0157370_1000009597 128
60 3300013104 Ga0157370_11595041 Ga0157370_115950412 128
61 3300013105 Ga0157369_10061148 Ga0157369_100611485 128
62 3300013306 Ga0163162_10011507 Ga0163162_1001150712 128
63 3300014325 Ga0163163_10029453 Ga0163163_100294536 128
64 3300014326 Ga0157380_10265572 Ga0157380_102655723 128
65 3300025315 Ga0207697_10001100 Ga0207697_100011003 128
66 3300025900 Ga0207710_10015239 Ga0207710_100152395 128
67 3300025903 Ga0207680_10000731 Ga0207680_1000073114 128
68 3300025909 Ga0207705_11367542 Ga0207705_113675421 128
69 3300025913 Ga0207695_10019950 Ga0207695_1001995011 128
70 3300025919 Ga0207657_10567182 Ga0207657_105671822 128
71 3300025923 Ga0207681_10000002 Ga0207681_10000002989 128
72 3300025925 Ga0207650_10001084 Ga0207650_1000108421 128
73 3300025931 Ga0207644_10000002 Ga0207644_10000002929 128
74 3300025932 Ga0207690_10004588 Ga0207690_100045887 128
75 3300025961 Ga0207712_10004139 Ga0207712_100041392 128
76 3300025972 Ga0207668_10002056 Ga0207668_1000205614 128
77 3300025986 Ga0207658_10087778 Ga0207658_100877783 128
78 3300026035 Ga0207703_10012001 Ga0207703_100120015 128
79 3300026041 Ga0207639_10007476 Ga0207639_100074765 128
80 3300026078 Ga0207702_10341510 Ga0207702_103415102 128
81 3300026088 Ga0207641_10139918 Ga0207641_101399181 128
82 3300026116 Ga0207674_10160969 Ga0207674_101609692 128
83 3300026118 Ga0207675_100003316 Ga0207675_10000331614 128
84 3300028379 Ga0268266_10037840 Ga0268266_100378403 128
85 3300028380 Ga0268265_10001875 Ga0268265_100018753 128
86 3300028381 Ga0268264_10000288 Ga0268264_1000028810 128
87 3300028786 Ga0307517_10018168 Ga0307517_100181686 128
88 3300031731 Ga0307405_11956837 Ga0307405_119568371 128
89 3300033180 Ga0307510_10471450 Ga0307510_104714501 128
90 3300037471 Ga0395905_0085326 Ga0395905_0085326_1752_2138 128
91 3300044683 Ga0466965_0302574 Ga0466965_0302574_347_736 128
92 3300044694 Ga0466963_0054167 Ga0466963_0054167_2004_2390 128
93 3300044842 Ga0466957_0228301 Ga0466957_0228301_576_965 128
94 3300045976 Ga0466967_0001258 Ga0466967_0001258_13087_13473 128
95 3300047472 Ga0495686_0018788 Ga0495686_0018788_766_1152 128
96 3300048920 Ga0496117_0031867 Ga0496117_0031867_3063_3452 128
97 3300048920 Ga0496117_0164078 Ga0496117_0164078_837_1235 128
98 3300048920 Ga0496117_0187925 Ga0496117_0187925_251_646 128
99 3300048921 Ga0496118_0008102 Ga0496118_0008102_977_1372 128
100 3300048921 Ga0496118_0048241 Ga0496118_0048241_238_627 128
101 3300048923 Ga0496120_0169717 Ga0496120_0169717_582_971 128
102 3300048924 Ga0496121_0000038 Ga0496121_0000038_179447_179845 128
103 3300048924 Ga0496121_0137589 Ga0496121_0137589_521_910 128
104 3300048925 Ga0496122_0184690 Ga0496122_0184690_317_703 128
105 3300048926 Ga0496123_0179658 Ga0496123_0179658_30_416 128
106 3300048927 Ga0496124_0206458 Ga0496124_0206458_756_1142 128
107 3300048929 Ga0496126_0004002 Ga0496126_0004002_13207_13605 128
108 3300053138 Ga0500564_385867 Ga0500564_385867_77_463 128
109 3300001976 JGI24752J21851_1012196 JGI24752J21851_10121963 129
110 3300002459 JGI24751J29686_10009680 JGI24751J29686_100096803 129
111 3300005327 Ga0070658_10000002 Ga0070658_10000002582 129
112 3300005327 Ga0070658_10083718 Ga0070658_100837183 129
113 3300005327 Ga0070658_10260239 Ga0070658_102602392 129
114 3300005329 Ga0070683_100499935 Ga0070683_1004999352 129
115 3300005329 Ga0070683_100555682 Ga0070683_1005556822 129
116 3300005331 Ga0070670_100020279 Ga0070670_1000202796 129
117 3300005331 Ga0070670_100099214 Ga0070670_1000992143 129
118 3300005333 Ga0070677_10194271 Ga0070677_101942711 129
119 3300005333 Ga0070677_10305986 Ga0070677_103059862 129
120 3300005335 Ga0070666_10000171 Ga0070666_1000017146 129
121 3300005335 Ga0070666_10007696 Ga0070666_100076968 129
122 3300005336 Ga0070680_100588115 Ga0070680_1005881152 129
123 3300005339 Ga0070660_100004628 Ga0070660_10000462811 129
124 3300005339 Ga0070660_100026532 Ga0070660_1000265325 129
125 3300005339 Ga0070660_100301588 Ga0070660_1003015883 129
126 3300005339 Ga0070660_101017177 Ga0070660_1010171772 129
127 3300005344 Ga0070661_100035509 Ga0070661_1000355093 129
128 3300005344 Ga0070661_100093796 Ga0070661_1000937963 129
129 3300005345 Ga0070692_10120800 Ga0070692_101208002 129
130 3300005353 Ga0070669_100000001 Ga0070669_10000000114 129
131 3300005353 Ga0070669_100053481 Ga0070669_1000534813 129
132 3300005353 Ga0070669_101120817 Ga0070669_1011208172 129
133 3300005354 Ga0070675_100172200 Ga0070675_1001722002 129
134 3300005355 Ga0070671_100000007 Ga0070671_100000007254 129
135 3300005355 Ga0070671_100435757 Ga0070671_1004357573 129
136 3300005355 Ga0070671_100694322 Ga0070671_1006943222 129
137 3300005364 Ga0070673_100133111 Ga0070673_1001331112 129
138 3300005366 Ga0070659_100060772 Ga0070659_1000607725 129
139 3300005366 Ga0070659_100072796 Ga0070659_1000727962 129
140 3300005366 Ga0070659_100501205 Ga0070659_1005012053 129
141 3300005366 Ga0070659_102010811 Ga0070659_1020108111 129
142 3300005367 Ga0070667_100000278 Ga0070667_10000027827 129
143 3300005367 Ga0070667_100034589 Ga0070667_1000345894 129
144 3300005367 Ga0070667_100059889 Ga0070667_1000598893 129
145 3300005440 Ga0070705_100000876 Ga0070705_1000008763 129
146 3300005445 Ga0070708_100025502 Ga0070708_1000255022 129
147 3300005457 Ga0070662_100075323 Ga0070662_1000753232 129
148 3300005457 Ga0070662_100090875 Ga0070662_1000908754 129
149 3300005457 Ga0070662_100286794 Ga0070662_1002867942 129
150 3300005530 Ga0070679_100098388 Ga0070679_1000983881 129
151 3300005530 Ga0070679_100122181 Ga0070679_1001221813 129
152 3300005530 Ga0070679_100687717 Ga0070679_1006877171 129
153 3300005539 Ga0068853_100147732 Ga0068853_1001477322 129
154 3300005543 Ga0070672_100002989 Ga0070672_10000298911 129
155 3300005547 Ga0070693_100198305 Ga0070693_1001983052 129
156 3300005548 Ga0070665_100007476 Ga0070665_1000074762 129
157 3300005548 Ga0070665_100093446 Ga0070665_1000934463 129
158 3300005563 Ga0068855_100071229 Ga0068855_1000712292 129
159 3300005563 Ga0068855_100081423 Ga0068855_1000814238 129
160 3300005563 Ga0068855_100097195 Ga0068855_1000971956 129
161 3300005564 Ga0070664_100067149 Ga0070664_1000671494 129
162 3300005564 Ga0070664_100287522 Ga0070664_1002875223 129
163 3300005577 Ga0068857_100273137 Ga0068857_1002731372 129
164 3300005577 Ga0068857_100568114 Ga0068857_1005681141 129
165 3300005578 Ga0068854_100486321 Ga0068854_1004863212 129
166 3300005578 Ga0068854_100842639 Ga0068854_1008426392 129
167 3300005617 Ga0068859_100005948 Ga0068859_1000059484 129
168 3300005719 Ga0068861_101745172 Ga0068861_1017451722 129
169 3300005834 Ga0068851_10742579 Ga0068851_107425791 129
170 3300005841 Ga0068863_100000670 Ga0068863_1000006706 129
171 3300005841 Ga0068863_100467699 Ga0068863_1004676993 129
172 3300005842 Ga0068858_100000212 Ga0068858_10000021237 129
173 3300005842 Ga0068858_100044043 Ga0068858_1000440433 129
174 3300005842 Ga0068858_100901944 Ga0068858_1009019442 129
175 3300005843 Ga0068860_100000007 Ga0068860_100000007263 129
176 3300005843 Ga0068860_100000379 Ga0068860_10000037927 129
177 3300006051 Ga0075364_10006299 Ga0075364_100062993 129
178 3300006177 Ga0075362_10000012 Ga0075362_1000001296 129
179 3300006186 Ga0075369_10006498 Ga0075369_100064983 129
180 3300006195 Ga0075366_10008389 Ga0075366_100083896 129
181 3300006195 Ga0075366_10040866 Ga0075366_100408663 129
182 3300006353 Ga0075370_10000002 Ga0075370_1000000229 129
183 3300006931 Ga0097620_100005948 Ga0097620_10000594810 129
184 3300009093 Ga0105240_11400430 Ga0105240_114004301 129
185 3300009174 Ga0105241_10022953 Ga0105241_100229532 129
186 3300009174 Ga0105241_10092383 Ga0105241_100923834 129
187 3300009177 Ga0105248_10001007 Ga0105248_1000100727 129
188 3300009177 Ga0105248_10130844 Ga0105248_101308444 129
189 3300009177 Ga0105248_10159486 Ga0105248_101594864 129
190 3300009177 Ga0105248_10163032 Ga0105248_101630323 129
191 3300009177 Ga0105248_10216098 Ga0105248_102160982 129
192 3300009551 Ga0105238_10125269 Ga0105238_101252693 129
193 3300009551 Ga0105238_10256914 Ga0105238_102569143 129
194 3300009553 Ga0105249_10929990 Ga0105249_109299902 129
195 3300010375 Ga0105239_10026931 Ga0105239_100269315 129
196 3300010375 Ga0105239_10277128 Ga0105239_102771284 129
197 3300010375 Ga0105239_11534800 Ga0105239_115348002 129
198 3300013100 Ga0157373_10022181 Ga0157373_100221814 129
199 3300013100 Ga0157373_10177437 Ga0157373_101774371 129
200 3300013102 Ga0157371_10048155 Ga0157371_100481552 129
201 3300013104 Ga0157370_10026369 Ga0157370_100263694 129
202 3300013105 Ga0157369_10511510 Ga0157369_105115102 129
203 3300013306 Ga0163162_10005892 Ga0163162_100058925 129
204 3300013307 Ga0157372_10006546 Ga0157372_1000654613 129
205 3300013308 Ga0157375_10054583 Ga0157375_100545832 129
206 3300014325 Ga0163163_10370749 Ga0163163_103707492 129
207 3300014969 Ga0157376_11246407 Ga0157376_112464071 129
208 3300017792 Ga0163161_11792642 Ga0163161_117926422 129
209 3300021384 Ga0213876_10000231 Ga0213876_1000023135 129
210 3300025315 Ga0207697_10099631 Ga0207697_100996312 129
211 3300025321 Ga0207656_10019329 Ga0207656_100193297 129
212 3300025893 Ga0207682_10107679 Ga0207682_101076792 129
213 3300025903 Ga0207680_10268334 Ga0207680_102683343 129
214 3300025904 Ga0207647_10366012 Ga0207647_103660122 129
215 3300025909 Ga0207705_10000008 Ga0207705_10000008208 129
216 3300025909 Ga0207705_10003200 Ga0207705_1000320011 129
217 3300025909 Ga0207705_10273547 Ga0207705_102735473 129
218 3300025909 Ga0207705_10370012 Ga0207705_103700122 129
219 3300025913 Ga0207695_10009384 Ga0207695_100093843 129
220 3300025914 Ga0207671_10030702 Ga0207671_100307021 129
221 3300025919 Ga0207657_10000231 Ga0207657_1000023128 129
222 3300025919 Ga0207657_10036493 Ga0207657_100364934 129
223 3300025919 Ga0207657_10157434 Ga0207657_101574342 129
224 3300025919 Ga0207657_10286508 Ga0207657_102865082 129
225 3300025920 Ga0207649_10012220 Ga0207649_100122204 129
226 3300025920 Ga0207649_10089369 Ga0207649_100893693 129
227 3300025920 Ga0207649_10966398 Ga0207649_109663981 129
228 3300025921 Ga0207652_10073263 Ga0207652_100732635 129
229 3300025921 Ga0207652_10102569 Ga0207652_101025693 129
230 3300025923 Ga0207681_10050638 Ga0207681_100506383 129
231 3300025923 Ga0207681_10318280 Ga0207681_103182803 129
232 3300025923 Ga0207681_10647221 Ga0207681_106472212 129
233 3300025924 Ga0207694_10115465 Ga0207694_101154654 129
234 3300025924 Ga0207694_10224177 Ga0207694_102241772 129
235 3300025925 Ga0207650_10019024 Ga0207650_100190246 129
236 3300025925 Ga0207650_10046524 Ga0207650_100465243 129
237 3300025931 Ga0207644_10033498 Ga0207644_100334983 129
238 3300025931 Ga0207644_10536907 Ga0207644_105369072 129
239 3300025932 Ga0207690_10001144 Ga0207690_100011444 129
240 3300025932 Ga0207690_10131543 Ga0207690_101315433 129
241 3300025932 Ga0207690_10393770 Ga0207690_103937702 129
242 3300025932 Ga0207690_10442730 Ga0207690_104427301 129
243 3300025933 Ga0207706_10051323 Ga0207706_100513234 129
244 3300025933 Ga0207706_10321638 Ga0207706_103216383 129
245 3300025933 Ga0207706_10401993 Ga0207706_104019932 129
246 3300025933 Ga0207706_10597380 Ga0207706_105973802 129
247 3300025940 Ga0207691_10053144 Ga0207691_100531442 129
248 3300025941 Ga0207711_10022744 Ga0207711_100227443 129
249 3300025941 Ga0207711_10144300 Ga0207711_101443003 129
250 3300025941 Ga0207711_10209597 Ga0207711_102095974 129
251 3300025941 Ga0207711_10642631 Ga0207711_106426313 129
252 3300025941 Ga0207711_11686405 Ga0207711_116864052 129
253 3300025944 Ga0207661_10449679 Ga0207661_104496792 129
254 3300025944 Ga0207661_10766846 Ga0207661_107668461 129
255 3300025945 Ga0207679_10113141 Ga0207679_101131412 129
256 3300025945 Ga0207679_10547711 Ga0207679_105477112 129
257 3300025949 Ga0207667_10048980 Ga0207667_100489806 129
258 3300025949 Ga0207667_10066057 Ga0207667_100660574 129
259 3300025949 Ga0207667_10131889 Ga0207667_101318893 129
260 3300025960 Ga0207651_10824298 Ga0207651_108242981 129
261 3300025981 Ga0207640_10383490 Ga0207640_103834901 129
262 3300025986 Ga0207658_10000487 Ga0207658_1000048721 129
263 3300025986 Ga0207658_10014887 Ga0207658_100148874 129
264 3300025986 Ga0207658_10071149 Ga0207658_100711493 129
265 3300025986 Ga0207658_10151310 Ga0207658_101513102 129
266 3300026035 Ga0207703_10000359 Ga0207703_1000035930 129
267 3300026035 Ga0207703_10055012 Ga0207703_100550123 129
268 3300026041 Ga0207639_10023636 Ga0207639_100236365 129
269 3300026041 Ga0207639_10043897 Ga0207639_100438974 129
270 3300026067 Ga0207678_10203437 Ga0207678_102034373 129
271 3300026067 Ga0207678_10579584 Ga0207678_105795842 129
272 3300026088 Ga0207641_10000042 Ga0207641_10000042159 129
273 3300026088 Ga0207641_10462734 Ga0207641_104627343 129
274 3300026095 Ga0207676_10114677 Ga0207676_101146774 129
275 3300026116 Ga0207674_10103018 Ga0207674_101030183 129
276 3300026116 Ga0207674_10378182 Ga0207674_103781822 129
277 3300026118 Ga0207675_101834981 Ga0207675_1018349812 129
278 3300026142 Ga0207698_10033575 Ga0207698_100335754 129
279 3300028379 Ga0268266_10011250 Ga0268266_100112502 129
280 3300028381 Ga0268264_10000039 Ga0268264_10000039363 129
281 3300028381 Ga0268264_10000134 Ga0268264_10000134152 129
282 3300031548 Ga0307408_100091844 Ga0307408_1000918442 129
283 3300031548 Ga0307408_100564766 Ga0307408_1005647662 129
284 3300031824 Ga0307413_10400665 Ga0307413_104006652 129
285 3300031852 Ga0307410_10352547 Ga0307410_103525472 129
286 3300031901 Ga0307406_10077809 Ga0307406_100778092 129
287 3300031901 Ga0307406_10165315 Ga0307406_101653152 129
288 3300031903 Ga0307407_10505014 Ga0307407_105050142 129
289 3300031911 Ga0307412_10038508 Ga0307412_100385083 129
290 3300031911 Ga0307412_10681659 Ga0307412_106816591 129
291 3300031995 Ga0307409_100281922 Ga0307409_1002819222 129
292 3300031995 Ga0307409_100419428 Ga0307409_1004194282 129
293 3300031995 Ga0307409_100971941 Ga0307409_1009719412 129
294 3300032002 Ga0307416_100015025 Ga0307416_1000150255 129
295 3300032002 Ga0307416_100051662 Ga0307416_1000516623 129
296 3300032004 Ga0307414_10461818 Ga0307414_104618182 129
297 3300032005 Ga0307411_10144971 Ga0307411_101449712 129
298 3300032126 Ga0307415_100219917 Ga0307415_1002199173 129
299 3300032126 Ga0307415_100271376 Ga0307415_1002713764 129
300 3300035112 Ga0373932_0080648 Ga0373932_0080648_165_557 129
301 3300035171 Ga0373946_0667812 Ga0373946_0667812_93_482 129
302 3300035691 Ga0373931_0005630 Ga0373931_0005630_2495_2887 129
303 3300035695 Ga0373927_0735246 Ga0373927_0735246_247_636 129
304 3300035725 Ga0373947_0895497 Ga0373947_0895497_153_542 129
305 3300037312 Ga0395899_0099730 Ga0395899_0099730_385_780 129
306 3300037312 Ga0395899_0109271 Ga0395899_0109271_696_1094 129
307 3300037418 Ga0395900_0247995 Ga0395900_0247995_1015_1413 129
308 3300037418 Ga0395900_0370863 Ga0395900_0370863_318_713 129
309 3300037471 Ga0395905_0019876 Ga0395905_0019876_4157_4555 129
310 3300038443 Ga0395901_0272171 Ga0395901_0272171_931_1329 129
311 3300039437 Ga0436365_1799730 Ga0436365_1799730_1702_2094 129
312 3300046459 Ga0495629_0494499 Ga0495629_0494499_387_782 129
313 3300046531 Ga0495665_0665843 Ga0495665_0665843_22_417 129
314 3300046542 Ga0495597_0018431 Ga0495597_0018431_228_617 129
315 3300046616 Ga0495668_0024562 Ga0495668_0024562_1546_1935 129
316 3300046616 Ga0495668_0865416 Ga0495668_0865416_88_477 129
317 3300046684 Ga0495669_0053689 Ga0495669_0053689_107_502 129
318 3300046694 Ga0495649_0441564 Ga0495649_0441564_110_499 129
319 3300048905 Ga0496102_0001152 Ga0496102_0001152_23348_23755 129
320 3300048906 Ga0496103_0010377 Ga0496103_0010377_3710_4117 129
321 3300048906 Ga0496103_0163997 Ga0496103_0163997_654_1043 129
322 3300048912 Ga0496109_0072720 Ga0496109_0072720_2082_2477 129
323 3300048915 Ga0496112_0353252 Ga0496112_0353252_86_481 129
324 3300048917 Ga0496114_0077779 Ga0496114_0077779_1920_2315 129
325 3300048919 Ga0496116_0016572 Ga0496116_0016572_459_866 129
326 3300048920 Ga0496117_0004644 Ga0496117_0004644_3537_3944 129
327 3300048920 Ga0496117_0250377 Ga0496117_0250377_40_429 129
328 3300048921 Ga0496118_0034462 Ga0496118_0034462_3634_4041 129
329 3300048921 Ga0496118_0050358 Ga0496118_0050358_1926_2315 129
330 3300048921 Ga0496118_0055518 Ga0496118_0055518_1579_1968 129
331 3300048924 Ga0496121_0000196 Ga0496121_0000196_39636_40025 129
332 3300048924 Ga0496121_0004045 Ga0496121_0004045_17025_17414 129
333 3300048929 Ga0496126_0044109 Ga0496126_0044109_1138_1527 129
334 3300048929 Ga0496126_0424260 Ga0496126_0424260_551_940 129
335 3300049513 Ga0501290_007118 Ga0501290_007118_354_743 129
336 3300049515 Ga0501292_000062 Ga0501292_000062_20737_21126 129
337 3300049652 Ga0501202_035177 Ga0501202_035177_601_990 129
338 3300049653 Ga0501206_006471 Ga0501206_006471_599_988 129
339 3300049662 Ga0501222_008238 Ga0501222_008238_389_778 129
340 3300049663 Ga0501223_010592 Ga0501223_010592_1163_1552 129
341 3300049664 Ga0501224_008656 Ga0501224_008656_752_1141 129
342 3300049665 Ga0501227_019973 Ga0501227_019973_463_852 129
343 3300049669 Ga0501235_024135 Ga0501235_024135_482_871 129
344 3300049686 Ga0501257_050069 Ga0501257_050069_167_556 129
345 3300049688 Ga0501259_006329 Ga0501259_006329_661_1050 129
346 3300049690 Ga0501261_003099 Ga0501261_003099_941_1330 129
347 3300049705 Ga0501225_0008636 Ga0501225_0008636_336_725 129
348 3300049708 Ga0501245_072899 Ga0501245_072899_28_417 129
349 3300049775 Ga0501279_000013 Ga0501279_000013_22399_22788 129
350 3300049776 Ga0501280_000105 Ga0501280_000105_18798_19187 129
351 3300049777 Ga0501281_01163 Ga0501281_01163_1038_1427 129
352 3300049778 Ga0501282_000186 Ga0501282_000186_666_1055 129
353 3300049779 Ga0501283_010750 Ga0501283_010750_257_646 129
354 3300049823 Ga0501044_0434810 Ga0501044_0434810_619_1008 129
355 3300049823 Ga0501044_1162685 Ga0501044_1162685_50_439 129
356 3300050489 nmdc:mga03683_35_c1 nmdc:mga03683_35_c1_31296_31688 129
357 3300050490 nmdc:mga03n38_713_c1 nmdc:mga03n38_713_c1_2104_2496 129
358 3300050491 nmdc:mga00v17_5822_c1 nmdc:mga00v17_5822_c1_1286_1678 129
359 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_230602_230994 129
360 3300050493 nmdc:mga0k408_73481_c1 nmdc:mga0k408_73481_c1_1435_1827 129
361 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_141554_141946 129
362 3300050516 nmdc:mga0sz30_1223_c1 nmdc:mga0sz30_1223_c1_3336_3728 129
363 3300053092 Ga0500583_0366019 Ga0500583_0366019_160_549 129
364 3300053093 Ga0500651_0000538 Ga0500651_0000538_3285_3674 129
365 3300053093 Ga0500651_0147786 Ga0500651_0147786_458_847 129
366 3300053096 Ga0500641_0002349 Ga0500641_0002349_4776_5165 129
367 3300053130 Ga0500642_0001907 Ga0500642_0001907_5314_5703 129
368 3300053133 Ga0500655_001003 Ga0500655_001003_1556_1945 129
369 3300053136 Ga0500559_0021777 Ga0500559_0021777_1400_1789 129
370 3300053148 Ga0500590_000427 Ga0500590_000427_9740_10129 129
371 3300053153 Ga0500616_0205265 Ga0500616_0205265_125_514 129
372 3300053156 Ga0500622_0018428 Ga0500622_0018428_1270_1659 129
373 3300053177 Ga0500636_0136797 Ga0500636_0136797_249_653 129
374 3300053177 Ga0500636_0282426 Ga0500636_0282426_290_679 129
375 3300053724 Ga0500570_000470 Ga0500570_000470_8648_9037 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02661

Fic

Fic/DOC family

7

87

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.9274 6 127
3dd7-assembly1.cif.gz_A structure of doch66y in complex with the c-terminal domain of phd 0.9251 6 127
3kh2-assembly2.cif.gz_C crystal structure of the p1 bacteriophage doc toxin (f68s) in complex with the phd antitoxin (l17m/v39a). northeast structural genomics targets er385-er386 0.9177 6 125
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.9131 6 127
3k33-assembly1.cif.gz_A-2 crystal structure of the phd-doc complex 0.9124 6 128
ID Description Score Start End Superfamily
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.9274 6 127 1.20.120.1870
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.9131 6 127 1.20.120.1870
3dd9D01 Mainly Alpha;Orthogonal Bundle;PTS-regulatory domain, PRD; 0.7798 69 129 1.10.1790.50
5jj6B02 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7465 7 125 1.10.3290.10
1nh1A01 Mainly Alpha;Orthogonal Bundle;Fic-like fold; 0.699 9 126 1.10.3290.20
ID Description Score Start End GO Terms
AF-A0A0E9MRJ2-F1-model_v4 Putative death on curing protein 0.9972 4 127 GO:0016301
AF-A0A527FUN2-F1-model_v4 deleted 0.9906 4 91
AF-A0A849SJI6-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9894 3 127 GO:0016301
AF-A0A2A4VA31-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9868 3 127 GO:0016301
AF-A0A1Y6B873-F1-model_v4 Death on curing protein 0.9858 3 128 GO:0016301

Feature Viewer

pLDDT pTM Quality
94.03 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map