F427137

General Info

Members Datasets Scaffolds Average Seq Length
375 243 750 306

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_000916|Ga0495627_000916_7357_8334
Length 325
Sequence MSAAAAPRPDAGPAGSDLAAPDLAVDVRGLDKSFGDKHVVQDLSIQVGTGKITGFLGPNGSGKTTTLRMLCGLLTPDGGEGEVLGLDFRRHADAIKRQTGYMTQKFSLYEDLSIRENLDFVVQIYGLDRRRARVSEALERLGLAGRQKQLAGSLSGGWKQRLALAACILHEPRLLLLDEPTAGVDPQARREFWDEIHALSAEGLTVMVSTHYMDEAERCHDIAYIAYGKLMARGTLPEVIAGSGLVTFRAEGPGADRLGRDLAKAPGVVMAAPFGAALHVSGEDRAALEAAIKPYRRAPFTWTEVSPTLEDVFIRLMATSRDNFQ

Samples

Sample ID Description Type Environment
1 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
202 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
203 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
204 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
205 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
206 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
207 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
208 2643221583 Caulobacter sp. Root655 Isolate Unclassified
209 2643221584 Caulobacter sp. Root656 Isolate Unclassified
210 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
211 2818991435 Caulobacter henricii 536 Isolate Unclassified
212 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
213 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
214 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
215 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
216 2849560528 Caulobacter zeae 410 Isolate Unclassified
217 2851153111 Caulobacter radicis 736 Isolate Unclassified
218 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
219 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
220 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
221 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
222 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
223 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
224 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
225 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
226 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
227 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
228 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
229 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
230 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
231 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
232 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
233 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
234 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
235 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
236 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
237 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
238 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
239 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
240 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
241 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
242 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
243 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.8
Metatranscriptomes 0
Isolates 11.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 5.6
Rhizoplane 2.4
Rhizosphere 70.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495627_000916 3300046453 Bacteria 20444
2 JGI25153J46596_10000121 3300003215 Bacteria 89230
3 Ga0055528_1007842 3300003790 Bacteria 4662
4 Ga0055531_10005031 3300003794 Bacteria 7837
5 Ga0065165_1000798 3300005262 Bacteria 42059
6 Ga0070658_10000939 3300005327 Bacteria 24952
7 Ga0070658_10131118 3300005327 Bacteria 2089
8 Ga0070658_10241313 3300005327 Bacteria 1532
9 Ga0070658_10323370 3300005327 Bacteria 1317
10 Ga0070683_100008947 3300005329 Bacteria 8534
11 Ga0070683_100049654 3300005329 Bacteria 3881
12 Ga0070683_100050979 3300005329 Bacteria 3833
13 Ga0070680_100000844 3300005336 Bacteria 21683
14 Ga0070680_100004400 3300005336 Bacteria 10603
15 Ga0070660_100000495 3300005339 Bacteria 26212
16 Ga0070660_100014192 3300005339 Bacteria 5737
17 Ga0070660_100114957 3300005339 Bacteria 2144
18 Ga0070691_10002731 3300005341 Bacteria 7858
19 Ga0070661_100000286 3300005344 Bacteria 40815
20 Ga0070661_100003869 3300005344 Bacteria 10305
21 Ga0070661_100054513 3300005344 Bacteria 2928
22 Ga0070661_100110976 3300005344 Bacteria 2048
23 Ga0070692_10194095 3300005345 Bacteria 1185
24 Ga0070671_100376749 3300005355 Bacteria 1213
25 Ga0070674_100251737 3300005356 Bacteria 1388
26 Ga0070673_100001939 3300005364 Bacteria 12457
27 Ga0070659_100001037 3300005366 Bacteria 20318
28 Ga0070659_100063219 3300005366 Bacteria 2928
29 Ga0070713_100114646 3300005436 Bacteria 2355
30 Ga0070678_100066654 3300005456 Bacteria 2677
31 Ga0070662_100000071 3300005457 Bacteria 55762
32 Ga0070681_10002538 3300005458 Bacteria 16743
33 Ga0070681_10238096 3300005458 Bacteria 1734
34 Ga0070698_100003783 3300005471 Bacteria 16627
35 Ga0070699_100020569 3300005518 Bacteria 5694
36 Ga0070679_100001065 3300005530 Bacteria 23946
37 Ga0070679_100229365 3300005530 Bacteria 1817
38 Ga0070679_100232007 3300005530 Bacteria 1805
39 Ga0070684_100022040 3300005535 Bacteria 5308
40 Ga0070684_100149995 3300005535 Bacteria 2111
41 Ga0068853_100000412 3300005539 Bacteria 29460
42 Ga0068853_100019175 3300005539 Bacteria 5669
43 Ga0068853_100076197 3300005539 Bacteria 2928
44 Ga0068853_100261177 3300005539 Bacteria 1592
45 Ga0070693_100083858 3300005547 Bacteria 1906
46 Ga0070665_100017459 3300005548 Bacteria 7205
47 Ga0070665_100020129 3300005548 Bacteria 6699
48 Ga0070665_100041031 3300005548 Bacteria 4651
49 Ga0068855_100000970 3300005563 Bacteria 35729
50 Ga0068855_100023172 3300005563 Bacteria 7439
51 Ga0068855_100036194 3300005563 Bacteria 5877
52 Ga0068855_100263555 3300005563 Bacteria 1919
53 Ga0068855_100433030 3300005563 Bacteria 1437
54 Ga0070664_100000432 3300005564 Bacteria 31391
55 Ga0070664_100002540 3300005564 Bacteria 14721
56 Ga0070664_100040870 3300005564 Bacteria 3911
57 Ga0068857_100006750 3300005577 Bacteria 9871
58 Ga0068857_100049005 3300005577 Bacteria 3748
59 Ga0068857_100114271 3300005577 Bacteria 2428
60 Ga0068857_100163667 3300005577 Bacteria 2019
61 Ga0068857_100240689 3300005577 Bacteria 1657
62 Ga0068854_100003391 3300005578 Bacteria 9927
63 Ga0068856_100377145 3300005614 Bacteria 1437
64 Ga0068852_100033210 3300005616 Bacteria 4282
65 Ga0068852_100352493 3300005616 Bacteria 1437
66 Ga0068859_100182078 3300005617 Bacteria 2184
67 Ga0068851_10005875 3300005834 Bacteria 5589
68 Ga0081455_10000027 3300005937 Bacteria 156832
69 Ga0081455_10026505 3300005937 Bacteria 5327
70 Ga0081540_1001204 3300005983 Bacteria 22677
71 Ga0081539_10047327 3300005985 Bacteria 2457
72 Ga0075362_10004532 3300006177 Bacteria 5006
73 Ga0075367_10004201 3300006178 Bacteria 6988
74 Ga0075367_10041126 3300006178 Bacteria 2702
75 Ga0075367_10247861 3300006178 Bacteria 1117
76 Ga0075369_10071360 3300006186 Bacteria 1528
77 Ga0075366_10049021 3300006195 Bacteria 2505
78 Ga0075370_10092479 3300006353 Bacteria 1746
79 Ga0097620_100182086 3300006931 Bacteria 2184
80 Ga0105240_10000679 3300009093 Bacteria 62613
81 Ga0105240_10107715 3300009093 Bacteria 3378
82 Ga0105240_10434623 3300009093 Bacteria 1472
83 Ga0111539_10192664 3300009094 Bacteria 2378
84 Ga0114129_10422841 3300009147 Bacteria 1752
85 Ga0105241_10018405 3300009174 Bacteria 5139
86 Ga0105241_10075719 3300009174 Bacteria 2623
87 Ga0105237_10116137 3300009545 Bacteria 2669
88 Ga0157373_10003748 3300013100 Bacteria 11499
89 Ga0157371_10001293 3300013102 Bacteria 26356
90 Ga0157371_10041528 3300013102 Bacteria 3281
91 Ga0157370_10000991 3300013104 Bacteria 35836
92 Ga0157370_10055853 3300013104 Bacteria 3759
93 Ga0157370_10287869 3300013104 Bacteria 1518
94 Ga0157370_10304186 3300013104 Bacteria 1472
95 Ga0157369_10000812 3300013105 Bacteria 39918
96 Ga0157378_10030544 3300013297 Bacteria 4762
97 Ga0157372_10000946 3300013307 Bacteria 31733
98 Ga0157372_10085124 3300013307 Bacteria 3585
99 Ga0157372_10122598 3300013307 Bacteria 2987
100 Ga0157379_10674557 3300014968 Bacteria 969
101 Ga0213875_10003442 3300021388 Bacteria 9012
102 Ga0209565_1000179 3300025263 Bacteria 79300
103 Ga0209673_1002861 3300025273 Bacteria 11015
104 Ga0209675_1002580 3300025291 Bacteria 9192
105 Ga0209564_1014862 3300025295 Bacteria 3207
106 Ga0209758_1000202 3300025297 Bacteria 132401
107 Ga0209758_1000824 3300025297 Bacteria 43428
108 Ga0209758_1004711 3300025297 Bacteria 11129
109 Ga0209050_1003002 3300025298 Bacteria 13099
110 Ga0209256_1006897 3300025299 Bacteria 5818
111 Ga0209256_1009053 3300025299 Bacteria 4451
112 Ga0209257_1000544 3300025304 Bacteria 64793
113 Ga0209257_1000632 3300025304 Bacteria 56381
114 Ga0207647_10004019 3300025904 Bacteria 10981
115 Ga0207645_10086328 3300025907 Bacteria 2016
116 Ga0207705_10001252 3300025909 Bacteria 20427
117 Ga0207705_10001620 3300025909 Bacteria 17865
118 Ga0207705_10023594 3300025909 Bacteria 4387
119 Ga0207705_10192000 3300025909 Bacteria 1545
120 Ga0207705_10414275 3300025909 Bacteria 1043
121 Ga0207654_10017289 3300025911 Bacteria 3766
122 Ga0207654_10108272 3300025911 Bacteria 1724
123 Ga0207707_10005677 3300025912 Bacteria 10920
124 Ga0207695_10005231 3300025913 Bacteria 17342
125 Ga0207695_10021036 3300025913 Bacteria 7452
126 Ga0207671_10045862 3300025914 Bacteria 3233
127 Ga0207660_10000725 3300025917 Bacteria 21933
128 Ga0207660_10041344 3300025917 Bacteria 3230
129 Ga0207657_10000025 3300025919 Bacteria 143407
130 Ga0207657_10012330 3300025919 Bacteria 8447
131 Ga0207657_10013705 3300025919 Bacteria 7940
132 Ga0207649_10000361 3300025920 Bacteria 34078
133 Ga0207649_10003579 3300025920 Bacteria 8492
134 Ga0207649_10044262 3300025920 Bacteria 2725
135 Ga0207652_10001306 3300025921 Bacteria 22181
136 Ga0207652_10123325 3300025921 Bacteria 2307
137 Ga0207652_10348811 3300025921 Bacteria 1336
138 Ga0207652_10373855 3300025921 Bacteria 1286
139 Ga0207694_10145550 3300025924 Bacteria 1907
140 Ga0207694_10273707 3300025924 Bacteria 1385
141 Ga0207644_10131984 3300025931 Bacteria 1913
142 Ga0207690_10000374 3300025932 Bacteria 29664
143 Ga0207690_10001763 3300025932 Bacteria 13292
144 Ga0207690_10044269 3300025932 Bacteria 2933
145 Ga0207706_10000035 3300025933 Bacteria 138894
146 Ga0207706_10009500 3300025933 Bacteria 8930
147 Ga0207669_10128697 3300025937 Bacteria 1735
148 Ga0207661_10007431 3300025944 Bacteria 7799
149 Ga0207661_10089147 3300025944 Bacteria 2565
150 Ga0207661_10289002 3300025944 Bacteria 1467
151 Ga0207679_10003334 3300025945 Bacteria 9922
152 Ga0207679_10003742 3300025945 Bacteria 9432
153 Ga0207679_10012461 3300025945 Bacteria 5545
154 Ga0207667_10000472 3300025949 Bacteria 53717
155 Ga0207667_10028003 3300025949 Bacteria 6124
156 Ga0207667_10068557 3300025949 Bacteria 3693
157 Ga0207640_10069550 3300025981 Bacteria 2364
158 Ga0207640_10094283 3300025981 Bacteria 2082
159 Ga0207640_10167727 3300025981 Bacteria 1632
160 Ga0207703_10178577 3300026035 Bacteria 1872
161 Ga0207639_10000432 3300026041 Bacteria 28949
162 Ga0207639_10011766 3300026041 Bacteria 6087
163 Ga0207639_10032433 3300026041 Bacteria 3845
164 Ga0207639_10064714 3300026041 Bacteria 2836
165 Ga0207639_10127176 3300026041 Bacteria 2104
166 Ga0207678_10125693 3300026067 Bacteria 2188
167 Ga0207702_10015991 3300026078 Bacteria 6212
168 Ga0207702_10019145 3300026078 Bacteria 5664
169 Ga0207648_10515115 3300026089 Bacteria 1096
170 Ga0207676_10510653 3300026095 Bacteria 1143
171 Ga0207674_10019465 3300026116 Bacteria 7351
172 Ga0207674_10023894 3300026116 Bacteria 6539
173 Ga0207674_10048254 3300026116 Bacteria 4358
174 Ga0207674_10069352 3300026116 Bacteria 3546
175 Ga0207674_10093169 3300026116 Bacteria 3001
176 Ga0207674_10141957 3300026116 Bacteria 2361
177 Ga0207698_10002323 3300026142 Bacteria 11262
178 Ga0207698_10006191 3300026142 Bacteria 7447
179 Ga0207698_10114295 3300026142 Bacteria 2270
180 Ga0207698_10180477 3300026142 Bacteria 1869
181 Ga0268266_10018717 3300028379 Bacteria 5900
182 Ga0268266_10037936 3300028379 Bacteria 4103
183 Ga0265337_1017692 3300028556 Bacteria 2280
184 Ga0265334_10009456 3300028573 Bacteria 4123
185 Ga0307515_10104795 3300028794 Bacteria 3374
186 Ga0265338_10112169 3300028800 Bacteria 2193
187 Ga0265324_10020467 3300029957 Bacteria 2377
188 Ga0307512_10067056 3300030522 Bacteria 2705
189 Ga0265328_10033644 3300031239 Bacteria 1900
190 Ga0265340_10028015 3300031247 Bacteria 2836
191 Ga0265340_10039899 3300031247 Bacteria 2314
192 Ga0265339_10017091 3300031249 Bacteria 4302
193 Ga0265327_10030734 3300031251 Bacteria 3030
194 Ga0265316_10364903 3300031344 Bacteria 1044
195 Ga0307513_10225933 3300031456 Bacteria 1689
196 Ga0307508_10156988 3300031616 Bacteria 1879
197 Ga0307412_10122634 3300031911 Bacteria 1874
198 Ga0307409_100256780 3300031995 Bacteria 1601
199 Ga0307416_100348288 3300032002 Bacteria 1498
200 Ga0307416_100851378 3300032002 Bacteria 1010
201 Ga0373937_0081222 3300036401 Bacteria 2999
202 Ga0395899_0003728 3300037312 Bacteria 12058
203 Ga0395899_0009434 3300037312 Bacteria 7494
204 Ga0395899_0059862 3300037312 Bacteria 2807
205 Ga0395900_0028772 3300037418 Bacteria 5696
206 Ga0395900_0035534 3300037418 Bacteria 5132
207 Ga0395900_0308392 3300037418 Bacteria 1566
208 Ga0395898_0002866 3300037466 Bacteria 19674
209 Ga0395898_0003487 3300037466 Bacteria 17569
210 Ga0395905_0132169 3300037471 Bacteria 2347
211 Ga0395905_0147845 3300037471 Bacteria 2211
212 Ga0436364_1152526 3300037853 Bacteria 12419
213 Ga0436364_1200019 3300037853 Bacteria 3557
214 Ga0436360_0484195 3300039438 Bacteria 24366
215 Ga0436361_0986855 3300039447 Bacteria 9336
216 Ga0436363_0800604 3300039450 Bacteria 2378
217 Ga0439462_0007504 3300042015 Bacteria 2731
218 Ga0451577_0190685 3300042876 Bacteria 1849
219 Ga0466969_0074832 3300044656 Bacteria 1624
220 Ga0466966_0101544 3300044684 Bacteria 1778
221 Ga0466963_0021768 3300044694 Bacteria 4049
222 Ga0466963_0069293 3300044694 Bacteria 2370
223 Ga0466963_0314859 3300044694 Bacteria 1101
224 Ga0453684_0133147 3300044712 Bacteria 2981
225 Ga0466957_0185225 3300044842 Bacteria 1361
226 Ga0466959_0036766 3300045049 Bacteria 3617
227 Ga0466958_0084222 3300045836 Bacteria 1961
228 Ga0466967_0027489 3300045976 Bacteria 4733
229 Ga0495638_0001807 3300046460 Bacteria 18608
230 Ga0495638_0009517 3300046460 Bacteria 6812
231 Ga0495638_0017375 3300046460 Bacteria 4798
232 Ga0495638_0021067 3300046460 Bacteria 4300
233 Ga0495650_0000024 3300046471 Bacteria 496674
234 Ga0495650_0052778 3300046471 Bacteria 1667
235 Ga0495596_0001044 3300046500 Bacteria 16452
236 Ga0495583_0000025 3300046506 Bacteria 263775
237 Ga0495606_0005222 3300046507 Bacteria 12533
238 Ga0495606_0026632 3300046507 Bacteria 4119
239 Ga0495610_0000154 3300046512 Bacteria 76596
240 Ga0495610_0000983 3300046512 Bacteria 26313
241 Ga0495610_0003955 3300046512 Bacteria 11213
242 Ga0495616_0000186 3300046513 Bacteria 52285
243 Ga0495631_0078231 3300046518 Bacteria 1428
244 Ga0495632_0002681 3300046519 Bacteria 13333
245 Ga0495637_0047490 3300046520 Bacteria 1812
246 Ga0495648_0048383 3300046524 Bacteria 2618
247 Ga0495642_0032431 3300046528 Bacteria 2096
248 Ga0495654_0000153 3300046530 Bacteria 70297
249 Ga0495668_0000040 3300046616 Bacteria 230681
250 Ga0495625_0000043 3300046660 Bacteria 205715
251 Ga0495625_0007590 3300046660 Bacteria 9416
252 Ga0495625_0011365 3300046660 Bacteria 7265
253 Ga0495625_0021126 3300046660 Bacteria 5016
254 Ga0495625_0092643 3300046660 Bacteria 2087
255 Ga0495589_0106835 3300046794 Bacteria 1352
256 Ga0495660_0008083 3300046810 Bacteria 6179
257 Ga0495672_0001086 3300047320 Bacteria 27612
258 Ga0495679_066663 3300047446 Bacteria 1044
259 Ga0495673_0000102 3300047469 Bacteria 173343
260 Ga0495673_0003223 3300047469 Bacteria 10889
261 Ga0495681_0090060 3300047470 Bacteria 1356
262 Ga0495686_0012194 3300047472 Bacteria 6023
263 Ga0495686_0030471 3300047472 Bacteria 3503
264 Ga0495686_0055508 3300047472 Bacteria 2476
265 Ga0495686_0058261 3300047472 Bacteria 2408
266 Ga0495626_0000763 3300048091 Bacteria 29683
267 Ga0496102_0054560 3300048905 Bacteria 3645
268 Ga0496103_0024933 3300048906 Bacteria 3611
269 Ga0496107_0000029 3300048910 Bacteria 102345
270 Ga0496109_0278382 3300048912 Bacteria 1577
271 Ga0496110_0165149 3300048913 Bacteria 2008
272 Ga0496110_0284903 3300048913 Bacteria 1505
273 Ga0496111_0265962 3300048914 Bacteria 1272
274 Ga0496114_0002020 3300048917 Bacteria 15449
275 Ga0496121_0005375 3300048924 Bacteria 16457
276 Ga0496126_0100012 3300048929 Bacteria 2539
277 Ga0496126_0137117 3300048929 Bacteria 2110
278 Ga0501034_0449319 3300049571 Bacteria 1207
279 Ga0501036_0292761 3300049572 Bacteria 1362
280 Ga0501037_0167015 3300049573 Bacteria 1566
281 Ga0501047_0023245 3300049581 Bacteria 5952
282 Ga0501047_0388849 3300049581 Bacteria 1228
283 Ga0501067_0018921 3300049583 Bacteria 3810
284 Ga0501068_0007675 3300049584 Bacteria 5970
285 Ga0501070_0013703 3300049586 Bacteria 6827
286 Ga0501070_0158671 3300049586 Bacteria 1865
287 Ga0501070_0306559 3300049586 Bacteria 1293
288 Ga0501073_0036220 3300049589 Bacteria 3506
289 Ga0501238_007694 3300049671 Bacteria 1405
290 Ga0501080_0013533 3300049742 Bacteria 7509
291 Ga0501083_0027240 3300049744 Bacteria 3944
292 Ga0501035_0080490 3300049822 Bacteria 2876
293 Ga0501035_0199255 3300049822 Bacteria 1718
294 Ga0501044_0022318 3300049823 Bacteria 6746
295 Ga0501044_0146287 3300049823 Bacteria 2348
296 Ga0501044_0199346 3300049823 Bacteria 1961
297 Ga0501044_0310269 3300049823 Bacteria 1504
298 nmdc:mga03683_2102_c1 3300050489 Bacteria 4075
299 nmdc:mga03683_770_c1 3300050489 Bacteria 9200
300 nmdc:mga0yw44_301864_c1 3300050492 Bacteria 1073
301 nmdc:mga0k408_138232_c1 3300050493 Bacteria 1448
302 nmdc:mga06z11_22233_c1 3300050494 Bacteria 2959
303 nmdc:mga06z11_5808_c1 3300050494 Bacteria 4977
304 nmdc:mga07m45_117440_c1 3300050496 Bacteria 1535
305 nmdc:mga07m45_33855_c1 3300050496 Bacteria 2838
306 nmdc:mga05p37_371825_c1 3300050507 Bacteria 1677
307 nmdc:mga08y16_149693_c1 3300050511 Bacteria 2426
308 nmdc:mga0sz30_184_c1 3300050516 Bacteria 23368
309 nmdc:mga0sz30_2936_c1 3300050516 Bacteria 6107
310 nmdc:mga0sz30_86619_c1 3300050516 Bacteria 1360
311 Ga0500578_0113848 3300053086 Bacteria 1704
312 Ga0500643_007835 3300053087 Bacteria 4255
313 Ga0500643_032127 3300053087 Bacteria 1596
314 Ga0500644_0051587 3300053088 Bacteria 1413
315 Ga0500651_0115904 3300053093 Bacteria 1631
316 Ga0500641_0000272 3300053096 Bacteria 19343
317 Ga0500641_0019247 3300053096 Bacteria 2579
318 Ga0500556_0000846 3300053104 Bacteria 17483
319 Ga0500562_000754 3300053108 Bacteria 7869
320 Ga0500572_000252 3300053111 Bacteria 19253
321 Ga0500618_001024 3300053125 Bacteria 14003
322 Ga0500642_0000463 3300053130 Bacteria 12868
323 Ga0500559_0000098 3300053136 Bacteria 69305
324 Ga0500559_0015336 3300053136 Bacteria 3236
325 Ga0500577_0028063 3300053142 Bacteria 1935
326 Ga0500616_0000493 3300053153 Bacteria 50877
327 Ga0500616_0019731 3300053153 Bacteria 3796
328 Ga0500620_016498 3300053155 Bacteria 2113
329 Ga0500622_0009285 3300053156 Bacteria 5451
330 Ga0500627_0021619 3300053158 Bacteria 2599
331 Ga0500611_026441 3300053727 Bacteria 1160
332 Ga0500645_002409 3300053730 Bacteria 8379
333 Ga0500609_000567 3300053731 Bacteria 5585
334 2585155138 2582581280 Bacteria 5994497
335 2585194819 2582581293 Bacteria 5907401
336 2599104762 2597490356 Bacteria 7030811
337 2599938927 2599185301 Bacteria 6161860
338 2643747384 2643221545 Bacteria 5083237
339 2643780921 2643221552 Bacteria 5708754
340 2643924608 2643221583 Bacteria 5218014
341 2643929832 2643221584 Bacteria 5511711
342 2644507417 2643221691 Bacteria 5093099
343 2819538469 2818991435 Bacteria 5433759
344 2819648086 2818991454 Bacteria 5563326
345 2846953558 2846952575 Bacteria 6587527
346 2847673533 2847670302 Bacteria 6165597
347 2848860286 2848858292 Bacteria 7391279
348 2849564158 2849560528 Bacteria 5393480
349 2851155289 2851153111 Bacteria 5542585
350 2856318998 2856314179 Bacteria 6477897
351 2856367777 2856364286 Bacteria 6939991
352 2857506087 2857504554 Bacteria 5369913
353 2869289903 2869285874 Bacteria 6901219
354 2871432271 2871429161 Bacteria 6547891
355 2874152065 2874146452 Bacteria 7533118
356 2874158741 2874155637 Bacteria 6724144
357 2876418065 2876413966 Bacteria 6831344
358 2878039342 2878035449 Bacteria 6555736
359 2878749048 2878745973 Bacteria 6867388
360 2884963490 2884960567 Bacteria 5437054
361 2897808103 2897803580 Bacteria 7000062
362 2898334083 2898329390 Bacteria 5168154
363 2903505171 2903492973 Bacteria 13473544
364 2906311373 2906308376 Bacteria 6841989
365 2906324135 2906321335 Bacteria 6579571
366 2906419069 2906414383 Bacteria 6580790
367 2928531829 2928531327 Bacteria 5101314
368 2937816712 2937813078 Bacteria 7783518
369 2958134275 2958130278 Bacteria 6897202
370 2958183127 2958179912 Bacteria 6874908
371 2961081082 2961077736 Bacteria 7079850
372 2977847183 2977843712 Bacteria 6753583
373 8004392088 8004387939 Bacteria 7049250
374 8004717719 8004714634 Bacteria 6776161
375 8054004438 8054002106 Bacteria 7987183
376 Ga0495627_000916
377 JGI25153J46596_10000121
378 Ga0055528_1007842
379 Ga0055531_10005031
380 Ga0065165_1000798
381 Ga0070658_10000939
382 Ga0070658_10131118
383 Ga0070658_10241313
384 Ga0070658_10323370
385 Ga0070683_100008947
386 Ga0070683_100049654
387 Ga0070683_100050979
388 Ga0070680_100000844
389 Ga0070680_100004400
390 Ga0070660_100000495
391 Ga0070660_100014192
392 Ga0070660_100114957
393 Ga0070691_10002731
394 Ga0070661_100000286
395 Ga0070661_100003869
396 Ga0070661_100054513
397 Ga0070661_100110976
398 Ga0070692_10194095
399 Ga0070671_100376749
400 Ga0070674_100251737
401 Ga0070673_100001939
402 Ga0070659_100001037
403 Ga0070659_100063219
404 Ga0070713_100114646
405 Ga0070678_100066654
406 Ga0070662_100000071
407 Ga0070681_10002538
408 Ga0070681_10238096
409 Ga0070698_100003783
410 Ga0070699_100020569
411 Ga0070679_100001065
412 Ga0070679_100229365
413 Ga0070679_100232007
414 Ga0070684_100022040
415 Ga0070684_100149995
416 Ga0068853_100000412
417 Ga0068853_100019175
418 Ga0068853_100076197
419 Ga0068853_100261177
420 Ga0070693_100083858
421 Ga0070665_100017459
422 Ga0070665_100020129
423 Ga0070665_100041031
424 Ga0068855_100000970
425 Ga0068855_100023172
426 Ga0068855_100036194
427 Ga0068855_100263555
428 Ga0068855_100433030
429 Ga0070664_100000432
430 Ga0070664_100002540
431 Ga0070664_100040870
432 Ga0068857_100006750
433 Ga0068857_100049005
434 Ga0068857_100114271
435 Ga0068857_100163667
436 Ga0068857_100240689
437 Ga0068854_100003391
438 Ga0068856_100377145
439 Ga0068852_100033210
440 Ga0068852_100352493
441 Ga0068859_100182078
442 Ga0068851_10005875
443 Ga0081455_10000027
444 Ga0081455_10026505
445 Ga0081540_1001204
446 Ga0081539_10047327
447 Ga0075362_10004532
448 Ga0075367_10004201
449 Ga0075367_10041126
450 Ga0075367_10247861
451 Ga0075369_10071360
452 Ga0075366_10049021
453 Ga0075370_10092479
454 Ga0097620_100182086
455 Ga0105240_10000679
456 Ga0105240_10107715
457 Ga0105240_10434623
458 Ga0111539_10192664
459 Ga0114129_10422841
460 Ga0105241_10018405
461 Ga0105241_10075719
462 Ga0105237_10116137
463 Ga0157373_10003748
464 Ga0157371_10001293
465 Ga0157371_10041528
466 Ga0157370_10000991
467 Ga0157370_10055853
468 Ga0157370_10287869
469 Ga0157370_10304186
470 Ga0157369_10000812
471 Ga0157378_10030544
472 Ga0157372_10000946
473 Ga0157372_10085124
474 Ga0157372_10122598
475 Ga0157379_10674557
476 Ga0213875_10003442
477 Ga0209565_1000179
478 Ga0209673_1002861
479 Ga0209675_1002580
480 Ga0209564_1014862
481 Ga0209758_1000202
482 Ga0209758_1000824
483 Ga0209758_1004711
484 Ga0209050_1003002
485 Ga0209256_1006897
486 Ga0209256_1009053
487 Ga0209257_1000544
488 Ga0209257_1000632
489 Ga0207647_10004019
490 Ga0207645_10086328
491 Ga0207705_10001252
492 Ga0207705_10001620
493 Ga0207705_10023594
494 Ga0207705_10192000
495 Ga0207705_10414275
496 Ga0207654_10017289
497 Ga0207654_10108272
498 Ga0207707_10005677
499 Ga0207695_10005231
500 Ga0207695_10021036
501 Ga0207671_10045862
502 Ga0207660_10000725
503 Ga0207660_10041344
504 Ga0207657_10000025
505 Ga0207657_10012330
506 Ga0207657_10013705
507 Ga0207649_10000361
508 Ga0207649_10003579
509 Ga0207649_10044262
510 Ga0207652_10001306
511 Ga0207652_10123325
512 Ga0207652_10348811
513 Ga0207652_10373855
514 Ga0207694_10145550
515 Ga0207694_10273707
516 Ga0207644_10131984
517 Ga0207690_10000374
518 Ga0207690_10001763
519 Ga0207690_10044269
520 Ga0207706_10000035
521 Ga0207706_10009500
522 Ga0207669_10128697
523 Ga0207661_10007431
524 Ga0207661_10089147
525 Ga0207661_10289002
526 Ga0207679_10003334
527 Ga0207679_10003742
528 Ga0207679_10012461
529 Ga0207667_10000472
530 Ga0207667_10028003
531 Ga0207667_10068557
532 Ga0207640_10069550
533 Ga0207640_10094283
534 Ga0207640_10167727
535 Ga0207703_10178577
536 Ga0207639_10000432
537 Ga0207639_10011766
538 Ga0207639_10032433
539 Ga0207639_10064714
540 Ga0207639_10127176
541 Ga0207678_10125693
542 Ga0207702_10015991
543 Ga0207702_10019145
544 Ga0207648_10515115
545 Ga0207676_10510653
546 Ga0207674_10019465
547 Ga0207674_10023894
548 Ga0207674_10048254
549 Ga0207674_10069352
550 Ga0207674_10093169
551 Ga0207674_10141957
552 Ga0207698_10002323
553 Ga0207698_10006191
554 Ga0207698_10114295
555 Ga0207698_10180477
556 Ga0268266_10018717
557 Ga0268266_10037936
558 Ga0265337_1017692
559 Ga0265334_10009456
560 Ga0307515_10104795
561 Ga0265338_10112169
562 Ga0265324_10020467
563 Ga0307512_10067056
564 Ga0265328_10033644
565 Ga0265340_10028015
566 Ga0265340_10039899
567 Ga0265339_10017091
568 Ga0265327_10030734
569 Ga0265316_10364903
570 Ga0307513_10225933
571 Ga0307508_10156988
572 Ga0307412_10122634
573 Ga0307409_100256780
574 Ga0307416_100348288
575 Ga0307416_100851378
576 Ga0373937_0081222
577 Ga0395899_0003728
578 Ga0395899_0009434
579 Ga0395899_0059862
580 Ga0395900_0028772
581 Ga0395900_0035534
582 Ga0395900_0308392
583 Ga0395898_0002866
584 Ga0395898_0003487
585 Ga0395905_0132169
586 Ga0395905_0147845
587 Ga0436364_1152526
588 Ga0436364_1200019
589 Ga0436360_0484195
590 Ga0436361_0986855
591 Ga0436363_0800604
592 Ga0439462_0007504
593 Ga0451577_0190685
594 Ga0466969_0074832
595 Ga0466966_0101544
596 Ga0466963_0021768
597 Ga0466963_0069293
598 Ga0466963_0314859
599 Ga0453684_0133147
600 Ga0466957_0185225
601 Ga0466959_0036766
602 Ga0466958_0084222
603 Ga0466967_0027489
604 Ga0495638_0001807
605 Ga0495638_0009517
606 Ga0495638_0017375
607 Ga0495638_0021067
608 Ga0495650_0000024
609 Ga0495650_0052778
610 Ga0495596_0001044
611 Ga0495583_0000025
612 Ga0495606_0005222
613 Ga0495606_0026632
614 Ga0495610_0000154
615 Ga0495610_0000983
616 Ga0495610_0003955
617 Ga0495616_0000186
618 Ga0495631_0078231
619 Ga0495632_0002681
620 Ga0495637_0047490
621 Ga0495648_0048383
622 Ga0495642_0032431
623 Ga0495654_0000153
624 Ga0495668_0000040
625 Ga0495625_0000043
626 Ga0495625_0007590
627 Ga0495625_0011365
628 Ga0495625_0021126
629 Ga0495625_0092643
630 Ga0495589_0106835
631 Ga0495660_0008083
632 Ga0495672_0001086
633 Ga0495679_066663
634 Ga0495673_0000102
635 Ga0495673_0003223
636 Ga0495681_0090060
637 Ga0495686_0012194
638 Ga0495686_0030471
639 Ga0495686_0055508
640 Ga0495686_0058261
641 Ga0495626_0000763
642 Ga0496102_0054560
643 Ga0496103_0024933
644 Ga0496107_0000029
645 Ga0496109_0278382
646 Ga0496110_0165149
647 Ga0496110_0284903
648 Ga0496111_0265962
649 Ga0496114_0002020
650 Ga0496121_0005375
651 Ga0496126_0100012
652 Ga0496126_0137117
653 Ga0501034_0449319
654 Ga0501036_0292761
655 Ga0501037_0167015
656 Ga0501047_0023245
657 Ga0501047_0388849
658 Ga0501067_0018921
659 Ga0501068_0007675
660 Ga0501070_0013703
661 Ga0501070_0158671
662 Ga0501070_0306559
663 Ga0501073_0036220
664 Ga0501238_007694
665 Ga0501080_0013533
666 Ga0501083_0027240
667 Ga0501035_0080490
668 Ga0501035_0199255
669 Ga0501044_0022318
670 Ga0501044_0146287
671 Ga0501044_0199346
672 Ga0501044_0310269
673 nmdc:mga03683_2102_c1
674 nmdc:mga03683_770_c1
675 nmdc:mga0yw44_301864_c1
676 nmdc:mga0k408_138232_c1
677 nmdc:mga06z11_22233_c1
678 nmdc:mga06z11_5808_c1
679 nmdc:mga07m45_117440_c1
680 nmdc:mga07m45_33855_c1
681 nmdc:mga05p37_371825_c1
682 nmdc:mga08y16_149693_c1
683 nmdc:mga0sz30_184_c1
684 nmdc:mga0sz30_2936_c1
685 nmdc:mga0sz30_86619_c1
686 Ga0500578_0113848
687 Ga0500643_007835
688 Ga0500643_032127
689 Ga0500644_0051587
690 Ga0500651_0115904
691 Ga0500641_0000272
692 Ga0500641_0019247
693 Ga0500556_0000846
694 Ga0500562_000754
695 Ga0500572_000252
696 Ga0500618_001024
697 Ga0500642_0000463
698 Ga0500559_0000098
699 Ga0500559_0015336
700 Ga0500577_0028063
701 Ga0500616_0000493
702 Ga0500616_0019731
703 Ga0500620_016498
704 Ga0500622_0009285
705 Ga0500627_0021619
706 Ga0500611_026441
707 Ga0500645_002409
708 Ga0500609_000567
709 2585155138
710 2585194819
711 2599104762
712 2599938927
713 2643747384
714 2643780921
715 2643924608
716 2643929832
717 2644507417
718 2819538469
719 2819648086
720 2846953558
721 2847673533
722 2848860286
723 2849564158
724 2851155289
725 2856318998
726 2856367777
727 2857506087
728 2869289903
729 2871432271
730 2874152065
731 2874158741
732 2876418065
733 2878039342
734 2878749048
735 2884963490
736 2897808103
737 2898334083
738 2903505171
739 2906311373
740 2906324135
741 2906419069
742 2928531829
743 2937816712
744 2958134275
745 2958183127
746 2961081082
747 2977847183
748 8004392088
749 8004717719
750 8054004438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

182

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

75

213

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9527 3 216
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9396 3 216
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9268 5 211
2it1-assembly1.cif.gz_B structure of ph0203 protein from pyrococcus horikoshii 0.9267 6 220
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9265 3 215
ID Description Score Start End Superfamily
af_O65934_308_546_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9504 6 220 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9417 5 216 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9348 3 216 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9265 3 215 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9236 6 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A429TR11-F1-model_v4 deleted 0.9558 2 165
AF-A0A3C0JFJ3-F1-model_v4 ABC transporter 0.9491 3 156 GO:0005524
GO:0016887
AF-A0A7K1V6J1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9441 1 221 GO:0005524
GO:0016887
GO:0033232
AF-A0A3D2QAU4-F1-model_v4 ABC transporter ATP-binding protein 0.9364 6 153 GO:0005524
GO:0016887
AF-A0A2V6WXH7-F1-model_v4 AAA+ ATPase domain-containing protein 0.9306 1 165 GO:0005524
GO:0016887

Map