F427113

General Info

Members Datasets Scaffolds Average Seq Length
375 225 750 282

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1030743|Ga0436363_1030743_118_1134
Length 338
Sequence MSVPEASETEQRMEKEQPLERAPLAYENRPFVNGPEGRMLRMNAEYLEPLSRFRRERVQDTVVFFGSARFVNQESARENLEEAERGALDPPSPVKLLDAPYSAHLAPPEEQPDRASSGDDDIRRARAAVEMARYYEDARRLAYLLTEWSMTIRSKRARFVVTSGGGPGIMEAANRGAAEAGGKTIGLNIKLPFEQFPNRWITPALNFEFHYFFMRKYWFAYLAKALVVFPGGFGTLDEAFEILTLAQTRKLAKKIAVIFYGSDYWKRVINFDALVEAGAISSKDLQLFQWADTPEEAFRLLKEHLQDQLTTQSPRTLRPAGHDDENGDTGPEIAHTND

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 2.93
Rhizosphere 96.27
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1030743 3300039450 Bacteria 1693
2 Ga0065715_10146573 3300005293 Bacteria 1779
3 Ga0065707_10103032 3300005295 Bacteria 2771
4 Ga0070683_100271612 3300005329 Bacteria 1613
5 Ga0070690_100017025 3300005330 Bacteria 4363
6 Ga0068869_100256830 3300005334 Bacteria 1398
7 Ga0070666_10008495 3300005335 Bacteria 6379
8 Ga0070682_100108188 3300005337 Bacteria 1848
9 Ga0068868_100041457 3300005338 Bacteria 3587
10 Ga0070660_100006009 3300005339 Bacteria 8393
11 Ga0070660_100071945 3300005339 Bacteria 2701
12 Ga0070691_10022109 3300005341 Bacteria 2948
13 Ga0070687_100083748 3300005343 Bacteria 1747
14 Ga0070661_100081516 3300005344 Bacteria 2389
15 Ga0070668_100005585 3300005347 Bacteria 9329
16 Ga0070669_100128648 3300005353 Bacteria 1940
17 Ga0070675_100011700 3300005354 Bacteria 6878
18 Ga0070674_100185712 3300005356 Bacteria 1595
19 Ga0070673_100180338 3300005364 Bacteria 1807
20 Ga0070673_100308200 3300005364 Bacteria 1396
21 Ga0070659_100020218 3300005366 Bacteria 5054
22 Ga0070709_10126284 3300005434 Bacteria 1741
23 Ga0070709_10361656 3300005434 Bacteria 1075
24 Ga0070705_100026620 3300005440 Bacteria 3149
25 Ga0070705_100070467 3300005440 Bacteria 2112
26 Ga0070700_100228258 3300005441 Bacteria 1323
27 Ga0070694_100001070 3300005444 Bacteria 15658
28 Ga0070694_100041096 3300005444 Bacteria 3083
29 Ga0070708_100000435 3300005445 Bacteria 31161
30 Ga0070681_10127590 3300005458 Bacteria 2477
31 Ga0070706_100008394 3300005467 Bacteria 9625
32 Ga0070707_100000605 3300005468 Bacteria 36094
33 Ga0070698_100003037 3300005471 Bacteria 18494
34 Ga0070698_100032799 3300005471 Bacteria 5379
35 Ga0070699_100001736 3300005518 Bacteria 19896
36 Ga0070699_100006038 3300005518 Bacteria 10591
37 Ga0070699_100009224 3300005518 Bacteria 8552
38 Ga0070699_100064873 3300005518 Bacteria 3168
39 Ga0070699_100266640 3300005518 Bacteria 1532
40 Ga0070699_100351416 3300005518 Unclassified 1328
41 Ga0070679_100013553 3300005530 Bacteria 7810
42 Ga0070679_100041269 3300005530 Bacteria 4592
43 Ga0070679_100149050 3300005530 Bacteria 2317
44 Ga0070684_100124164 3300005535 Bacteria 2324
45 Ga0070684_100154293 3300005535 Bacteria 2082
46 Ga0070697_100000199 3300005536 Bacteria 49135
47 Ga0070697_100028760 3300005536 Bacteria 4452
48 Ga0068853_100114207 3300005539 Bacteria 2402
49 Ga0070672_100357705 3300005543 Bacteria 1245
50 Ga0070686_100000485 3300005544 Bacteria 24083
51 Ga0070695_100009117 3300005545 Bacteria 5897
52 Ga0070695_100047918 3300005545 Bacteria 2731
53 Ga0070696_100001063 3300005546 Bacteria 17763
54 Ga0070696_100003538 3300005546 Bacteria 10398
55 Ga0070696_100115600 3300005546 Bacteria 1936
56 Ga0070665_100003994 3300005548 Bacteria 15557
57 Ga0070665_100076454 3300005548 Bacteria 3355
58 Ga0070665_100088680 3300005548 Bacteria 3099
59 Ga0070704_100005169 3300005549 Bacteria 7588
60 Ga0070704_100253034 3300005549 Bacteria 1448
61 Ga0068855_100064889 3300005563 Bacteria 4258
62 Ga0068855_100347992 3300005563 Bacteria 1633
63 Ga0068855_100669694 3300005563 Bacteria 1113
64 Ga0070664_100376205 3300005564 Bacteria 1296
65 Ga0068857_100133051 3300005577 Bacteria 2244
66 Ga0068854_100001623 3300005578 Bacteria 13675
67 Ga0068854_100062511 3300005578 Bacteria 2700
68 Ga0068854_100144210 3300005578 Bacteria 1830
69 Ga0068856_100471722 3300005614 Bacteria 1276
70 Ga0068859_100086566 3300005617 Bacteria 3180
71 Ga0068864_100010570 3300005618 Bacteria 7632
72 Ga0068864_100069799 3300005618 Bacteria 3056
73 Ga0068864_100090830 3300005618 Bacteria 2693
74 Ga0068864_100189468 3300005618 Bacteria 1885
75 Ga0068864_100308210 3300005618 Bacteria 1484
76 Ga0068866_10121412 3300005718 Bacteria 1473
77 Ga0068861_100026065 3300005719 Bacteria 4246
78 Ga0068861_100092629 3300005719 Bacteria 2387
79 Ga0068861_100237524 3300005719 Bacteria 1549
80 Ga0068858_100001195 3300005842 Bacteria 26893
81 Ga0068858_100008505 3300005842 Bacteria 9862
82 Ga0068858_100011598 3300005842 Bacteria 8311
83 Ga0068862_100067405 3300005844 Bacteria 3085
84 Ga0070717_10052232 3300006028 Bacteria 3366
85 Ga0075432_10073837 3300006058 Bacteria 1228
86 Ga0097621_100013816 3300006237 Bacteria 6028
87 Ga0068871_100029898 3300006358 Bacteria 4284
88 Ga0075428_100152357 3300006844 Bacteria 2511
89 Ga0075428_100298637 3300006844 Bacteria 1732
90 Ga0075431_100181344 3300006847 Bacteria 2161
91 Ga0075431_100268972 3300006847 Bacteria 1728
92 Ga0075433_10007922 3300006852 Bacteria 8453
93 Ga0075433_10081065 3300006852 Bacteria 2861
94 Ga0075434_100005345 3300006871 Bacteria 11683
95 Ga0075434_100073748 3300006871 Bacteria 3406
96 Ga0075434_100113051 3300006871 Bacteria 2727
97 Ga0075434_100170711 3300006871 Bacteria 2195
98 Ga0075434_100303718 3300006871 Bacteria 1616
99 Ga0075434_100515168 3300006871 Bacteria 1217
100 Ga0068865_100330649 3300006881 Bacteria 1229
101 Ga0075436_100000182 3300006914 Bacteria 39329
102 Ga0075436_100013462 3300006914 Bacteria 5600
103 Ga0075436_100021651 3300006914 Bacteria 4412
104 Ga0075436_100045992 3300006914 Bacteria 3011
105 Ga0075436_100051406 3300006914 Bacteria 2844
106 Ga0075436_100113463 3300006914 Bacteria 1892
107 Ga0097620_100086571 3300006931 Bacteria 3180
108 Ga0075435_100000027 3300007076 Bacteria 84051
109 Ga0075435_100002436 3300007076 Bacteria 12352
110 Ga0075435_100035653 3300007076 Bacteria 3948
111 Ga0075435_100041128 3300007076 Bacteria 3694
112 Ga0075435_100274257 3300007076 Bacteria 1439
113 Ga0099794_10189310 3300007265 Bacteria 1052
114 Ga0105240_10178101 3300009093 Bacteria 2512
115 Ga0105240_10406836 3300009093 Bacteria 1531
116 Ga0111539_10000935 3300009094 Bacteria 38232
117 Ga0111539_10028232 3300009094 Bacteria 6848
118 Ga0111539_10229337 3300009094 Bacteria 2162
119 Ga0111539_10362902 3300009094 Bacteria 1686
120 Ga0105245_10072742 3300009098 Bacteria 3124
121 Ga0105247_10025881 3300009101 Bacteria 3541
122 Ga0105247_10040116 3300009101 Bacteria 2861
123 Ga0105247_10054117 3300009101 Bacteria 2477
124 Ga0114129_10007196 3300009147 Bacteria 15837
125 Ga0114129_10014660 3300009147 Bacteria 11165
126 Ga0114129_10018245 3300009147 Bacteria 9992
127 Ga0114129_10073957 3300009147 Bacteria 4747
128 Ga0114129_10223319 3300009147 Bacteria 2540
129 Ga0105241_10243383 3300009174 Bacteria 1522
130 Ga0105242_10026745 3300009176 Bacteria 4575
131 Ga0105242_10274224 3300009176 Bacteria 1529
132 Ga0105248_10013497 3300009177 Bacteria 8995
133 Ga0105248_10092059 3300009177 Bacteria 3414
134 Ga0105248_10095082 3300009177 Bacteria 3355
135 Ga0105248_10354500 3300009177 Bacteria 1652
136 Ga0105248_10470949 3300009177 Bacteria 1416
137 Ga0105248_10568934 3300009177 Bacteria 1279
138 Ga0105248_10579814 3300009177 Bacteria 1265
139 Ga0105238_10013317 3300009551 Bacteria 8298
140 Ga0105238_10306895 3300009551 Bacteria 1571
141 Ga0105238_10359063 3300009551 Bacteria 1446
142 Ga0105246_10101708 3300011119 Bacteria 2094
143 Ga0157369_10002016 3300013105 Bacteria 24480
144 Ga0157374_10072758 3300013296 Bacteria 3244
145 Ga0157378_10544068 3300013297 Bacteria 1165
146 Ga0163162_10099717 3300013306 Bacteria 2995
147 Ga0163163_10014757 3300014325 Bacteria 7190
148 Ga0163163_10035667 3300014325 Bacteria 4826
149 Ga0163163_10042548 3300014325 Bacteria 4450
150 Ga0163163_10095641 3300014325 Bacteria 2990
151 Ga0157380_10003956 3300014326 Bacteria 10230
152 Ga0157379_10052590 3300014968 Bacteria 3638
153 Ga0157379_10247087 3300014968 Bacteria 1619
154 Ga0157379_10350038 3300014968 Bacteria 1352
155 Ga0207697_10013581 3300025315 Bacteria 3397
156 Ga0207656_10093625 3300025321 Bacteria 1368
157 Ga0207682_10021614 3300025893 Bacteria 2532
158 Ga0207642_10057431 3300025899 Bacteria 1790
159 Ga0207710_10023588 3300025900 Bacteria 2645
160 Ga0207680_10029896 3300025903 Bacteria 3066
161 Ga0207645_10004842 3300025907 Bacteria 9885
162 Ga0207645_10143254 3300025907 Bacteria 1558
163 Ga0207643_10060109 3300025908 Bacteria 2169
164 Ga0207684_10001311 3300025910 Bacteria 27341
165 Ga0207707_10019486 3300025912 Bacteria 5924
166 Ga0207695_10248075 3300025913 Bacteria 1680
167 Ga0207695_10251606 3300025913 Bacteria 1666
168 Ga0207671_10214910 3300025914 Bacteria 1505
169 Ga0207657_10012107 3300025919 Bacteria 8524
170 Ga0207657_10079294 3300025919 Bacteria 2763
171 Ga0207649_10430433 3300025920 Bacteria 992
172 Ga0207652_10022685 3300025921 Bacteria 5197
173 Ga0207652_10065880 3300025921 Bacteria 3138
174 Ga0207652_10100253 3300025921 Bacteria 2557
175 Ga0207646_10001857 3300025922 Bacteria 25474
176 Ga0207646_10244376 3300025922 Bacteria 1621
177 Ga0207650_10034441 3300025925 Bacteria 3673
178 Ga0207659_10059085 3300025926 Bacteria 2755
179 Ga0207659_10309065 3300025926 Bacteria 1301
180 Ga0207687_10085573 3300025927 Bacteria 2287
181 Ga0207690_10029859 3300025932 Bacteria 3471
182 Ga0207706_10031475 3300025933 Bacteria 4726
183 Ga0207686_10021734 3300025934 Bacteria 3687
184 Ga0207686_10182811 3300025934 Bacteria 1488
185 Ga0207669_10149259 3300025937 Bacteria 1635
186 Ga0207704_10108254 3300025938 Bacteria 1872
187 Ga0207665_10070893 3300025939 Bacteria 2378
188 Ga0207665_10125458 3300025939 Bacteria 1817
189 Ga0207711_10054415 3300025941 Bacteria 3434
190 Ga0207689_10086649 3300025942 Bacteria 2574
191 Ga0207661_10352328 3300025944 Bacteria 1328
192 Ga0207667_10073335 3300025949 Bacteria 3557
193 Ga0207667_10237632 3300025949 Bacteria 1865
194 Ga0207651_10168299 3300025960 Bacteria 1726
195 Ga0207668_10081107 3300025972 Bacteria 2352
196 Ga0207640_10023801 3300025981 Bacteria 3686
197 Ga0207640_10337729 3300025981 Bacteria 1205
198 Ga0207677_10056373 3300026023 Bacteria 2692
199 Ga0207677_10088587 3300026023 Bacteria 2245
200 Ga0207703_10006270 3300026035 Bacteria 9509
201 Ga0207703_10040483 3300026035 Bacteria 3729
202 Ga0207703_10044050 3300026035 Bacteria 3584
203 Ga0207703_10051917 3300026035 Bacteria 3326
204 Ga0207703_10440461 3300026035 Bacteria 1215
205 Ga0207639_10102478 3300026041 Bacteria 2317
206 Ga0207676_10012507 3300026095 Bacteria 6084
207 Ga0207676_10149389 3300026095 Bacteria 2010
208 Ga0207676_10219387 3300026095 Bacteria 1692
209 Ga0207674_10265189 3300026116 Bacteria 1665
210 Ga0207428_10005438 3300027907 Bacteria 11878
211 Ga0207428_10014438 3300027907 Bacteria 6864
212 Ga0268266_10022286 3300028379 Bacteria 5398
213 Ga0268266_10093919 3300028379 Bacteria 2632
214 Ga0268266_10204150 3300028379 Bacteria 1810
215 Ga0268264_10091600 3300028381 Bacteria 2623
216 Ga0307408_100063967 3300031548 Bacteria 2693
217 Ga0373948_0001484 3300034817 Bacteria 3266
218 Ga0373948_0017129 3300034817 Bacteria 1347
219 Ga0373958_0000617 3300034819 Bacteria 4432
220 Ga0373959_0003069 3300034820 Bacteria 2654
221 Ga0373938_0001689 3300034957 Bacteria 3532
222 Ga0373929_0000331 3300035085 Bacteria 8772
223 Ga0373934_0002549 3300035086 Bacteria 6704
224 Ga0373940_0000361 3300035088 Bacteria 6821
225 Ga0373951_0001456 3300035091 Bacteria 6205
226 Ga0373952_0000758 3300035092 Bacteria 5805
227 Ga0373932_0000241 3300035112 Bacteria 16677
228 Ga0373936_0012398 3300035113 Bacteria 3242
229 Ga0373939_0017841 3300035114 Bacteria 1891
230 Ga0373941_0003343 3300035115 Bacteria 3624
231 Ga0373960_0003460 3300035121 Bacteria 3579
232 Ga0373955_0014270 3300035172 Bacteria 3860
233 Ga0373955_0055271 3300035172 Bacteria 2173
234 Ga0373931_0004375 3300035691 Bacteria 6450
235 Ga0373935_0188492 3300035692 Bacteria 1419
236 Ga0373937_0048398 3300036401 Bacteria 3892
237 Ga0373937_0146458 3300036401 Bacteria 2211
238 Ga0373925_0102131 3300037068 Bacteria 2206
239 Ga0395905_0018709 3300037471 Bacteria 6571
240 Ga0395905_0218882 3300037471 Bacteria 1782
241 Ga0395901_0076779 3300038443 Bacteria 3486
242 Ga0395901_0166782 3300038443 Bacteria 2312
243 Ga0436363_0658713 3300039450 Bacteria 2722
244 Ga0439441_000857 3300042001 Bacteria 3657
245 Ga0439434_0050759 3300042435 Bacteria 1286
246 Ga0451577_0003216 3300042876 Bacteria 18350
247 Ga0466959_0105593 3300045049 Bacteria 2014
248 Ga0451576_0001751 3300045051 Bacteria 35661
249 Ga0451576_0559808 3300045051 Bacteria 1201
250 Ga0495592_0039068 3300046454 Bacteria 3567
251 Ga0495641_0037392 3300046461 Bacteria 2275
252 Ga0495651_0268938 3300046462 Bacteria 1156
253 Ga0495653_0009091 3300046463 Bacteria 8124
254 Ga0495653_0193490 3300046463 Bacteria 1386
255 Ga0495580_0069565 3300046472 Bacteria 2459
256 Ga0495582_0092793 3300046473 Bacteria 1685
257 Ga0495664_0031738 3300046477 Bacteria 3097
258 Ga0495664_0054703 3300046477 Bacteria 2373
259 Ga0495594_0017750 3300046499 Bacteria 3763
260 Ga0495608_0217225 3300046511 Bacteria 1200
261 Ga0495618_0119260 3300046514 Bacteria 1690
262 Ga0495628_0028371 3300046516 Bacteria 4547
263 Ga0495628_0095547 3300046516 Bacteria 2296
264 Ga0495630_0055621 3300046517 Bacteria 2965
265 Ga0495665_0005023 3300046531 Bacteria 7133
266 Ga0495665_0114745 3300046531 Bacteria 1412
267 Ga0495640_0050180 3300046533 Bacteria 2876
268 Ga0495586_0080624 3300046535 Bacteria 1788
269 Ga0495645_0006176 3300046543 Bacteria 8292
270 Ga0495645_0010182 3300046543 Bacteria 6587
271 Ga0495667_0016855 3300046559 Bacteria 4933
272 Ga0495667_0024553 3300046559 Bacteria 4059
273 Ga0495634_0032559 3300046642 Bacteria 3585
274 Ga0495635_0049648 3300046663 Bacteria 2892
275 Ga0495635_0144111 3300046663 Bacteria 1622
276 Ga0495659_0026607 3300046664 Bacteria 1990
277 Ga0495588_0001065 3300046674 Bacteria 11902
278 Ga0495657_0112080 3300046675 Bacteria 1727
279 Ga0495657_0147637 3300046675 Bacteria 1462
280 Ga0495599_0003615 3300046678 Bacteria 9068
281 Ga0495599_0060639 3300046678 Bacteria 2365
282 Ga0495623_0161798 3300046679 Bacteria 1315
283 Ga0495646_0058605 3300046680 Bacteria 2302
284 Ga0495658_0014002 3300046683 Bacteria 4088
285 Ga0495658_0067855 3300046683 Bacteria 2064
286 Ga0495613_0016470 3300046689 Bacteria 5505
287 Ga0495613_0078941 3300046689 Bacteria 2394
288 Ga0495624_0055247 3300046690 Bacteria 2502
289 Ga0495600_0011786 3300046809 Bacteria 5458
290 Ga0495600_0015977 3300046809 Bacteria 4757
291 Ga0495604_0028357 3300047317 Bacteria 4453
292 Ga0495674_0032067 3300047319 Bacteria 4769
293 Ga0495674_0153021 3300047319 Bacteria 1933
294 Ga0495680_0012295 3300047322 Bacteria 7542
295 Ga0495680_0122182 3300047322 Bacteria 1921
296 Ga0495675_0063010 3300047444 Bacteria 2347
297 Ga0495675_0074165 3300047444 Bacteria 2144
298 Ga0495684_0109155 3300047471 Bacteria 2089
299 Ga0495684_0290694 3300047471 Bacteria 1176
300 Ga0495593_0093239 3300047673 Bacteria 1550
301 Ga0495602_0178393 3300048088 Bacteria 1641
302 Ga0496102_0321889 3300048905 Bacteria 1457
303 Ga0496104_0025865 3300048907 Bacteria 5413
304 Ga0496106_0046405 3300048909 Bacteria 3266
305 Ga0496106_0249816 3300048909 Bacteria 1418
306 Ga0496108_0094461 3300048911 Bacteria 2545
307 Ga0496109_0240398 3300048912 Bacteria 1704
308 Ga0496109_0548188 3300048912 Bacteria 1091
309 Ga0496112_0228274 3300048915 Bacteria 1817
310 Ga0496112_0299944 3300048915 Bacteria 1552
311 Ga0496113_0115250 3300048916 Bacteria 2096
312 Ga0496114_0059503 3300048917 Bacteria 3192
313 Ga0501033_0171653 3300049570 Bacteria 1557
314 Ga0501034_0002146 3300049571 Bacteria 24492
315 Ga0501034_0283051 3300049571 Bacteria 1597
316 Ga0501036_0003736 3300049572 Bacteria 12200
317 Ga0501036_0073020 3300049572 Bacteria 2901
318 Ga0501037_0055061 3300049573 Bacteria 2909
319 Ga0501038_0121321 3300049574 Bacteria 2155
320 Ga0501039_0093337 3300049575 Bacteria 2345
321 Ga0501039_0368170 3300049575 Bacteria 1129
322 Ga0501041_0012027 3300049577 Bacteria 5122
323 Ga0501043_0369203 3300049579 Bacteria 1088
324 Ga0501046_0286923 3300049580 Bacteria 1204
325 Ga0501048_0105574 3300049582 Bacteria 1988
326 Ga0501068_0117430 3300049584 Bacteria 1657
327 Ga0501071_0005602 3300049587 Bacteria 8095
328 Ga0501072_0000863 3300049588 Bacteria 22256
329 Ga0501074_0332489 3300049590 Bacteria 1078
330 Ga0501075_0005333 3300049591 Bacteria 8794
331 Ga0501075_0120222 3300049591 Bacteria 1999
332 Ga0501075_0158256 3300049591 Bacteria 1728
333 Ga0501076_0000306 3300049592 Bacteria 30655
334 Ga0501076_0189434 3300049592 Bacteria 1678
335 Ga0501076_0461637 3300049592 Bacteria 1046
336 Ga0501077_0052787 3300049593 Bacteria 2581
337 Ga0501079_0006897 3300049741 Bacteria 8558
338 Ga0501080_0017731 3300049742 Bacteria 6589
339 Ga0501081_0052684 3300049743 Bacteria 2809
340 Ga0501081_0078162 3300049743 Bacteria 2313
341 Ga0501045_0001523 3300049824 Bacteria 15428
342 nmdc:mga0yw44_338_c1 3300050492 Bacteria 16401
343 nmdc:mga05p37_100256_c1 3300050507 Bacteria 3567
344 nmdc:mga05p37_11640_c1 3300050507 Bacteria 10484
345 nmdc:mga05p37_23969_c1 3300050507 Bacteria 7411
346 nmdc:mga05p37_261382_c1 3300050507 Bacteria 2071
347 nmdc:mga05p37_49061_c1 3300050507 Bacteria 2949
348 nmdc:mga08y16_17955_c1 3300050511 Bacteria 7453
349 nmdc:mga08y16_2359_c1 3300050511 Bacteria 19371
350 nmdc:mga0n895_106029_c1 3300050512 Bacteria 2823
351 nmdc:mga0n895_124239_c1 3300050512 Bacteria 2603
352 nmdc:mga0n895_166157_c1 3300050512 Bacteria 2238
353 nmdc:mga0n895_195008_c1 3300050512 Bacteria 2057
354 nmdc:mga0n895_250967_c1 3300050512 Bacteria 1796
355 nmdc:mga0n895_3_c1 3300050512 Bacteria 134167
356 nmdc:mga0rr50_111521_c1 3300050513 Bacteria 2165
357 nmdc:mga0rr50_203040_c1 3300050513 Bacteria 1630
358 nmdc:mga0rr50_39_c1 3300050513 Bacteria 84395
359 nmdc:mga0rr50_533570_c1 3300050513 Bacteria 999
360 nmdc:mga0rr50_6445_c1 3300050513 Bacteria 7144
361 nmdc:mga08x19_13793_c1 3300050514 Bacteria 4895
362 nmdc:mga08x19_246514_c1 3300050514 Bacteria 1233
363 nmdc:mga08x19_259_c1 3300050514 Bacteria 40273
364 nmdc:mga08x19_46907_c1 3300050514 Bacteria 2765
365 nmdc:mga0a205_211067_c1 3300050515 Bacteria 1830
366 nmdc:mga0a205_59946_c1 3300050515 Bacteria 3676
367 Ga0495601_0172472 3300053077 Bacteria 1414
368 Ga0495595_0119615 3300053084 Bacteria 1282
369 Ga0495619_0018902 3300053085 Bacteria 4375
370 Ga0495619_0144597 3300053085 Bacteria 1639
371 Ga0501084_0005006 3300054114 Bacteria 10834
372 Ga0501082_0003624 3300060353 Bacteria 13491
373 Ga0501082_0082503 3300060353 Bacteria 2774
374 Ga0501082_0260320 3300060353 Bacteria 1509
375 Ga0530510_0000966 3300061734 Bacteria 18983
376 Ga0436363_1030743
377 Ga0065715_10146573
378 Ga0065707_10103032
379 Ga0070683_100271612
380 Ga0070690_100017025
381 Ga0068869_100256830
382 Ga0070666_10008495
383 Ga0070682_100108188
384 Ga0068868_100041457
385 Ga0070660_100006009
386 Ga0070660_100071945
387 Ga0070691_10022109
388 Ga0070687_100083748
389 Ga0070661_100081516
390 Ga0070668_100005585
391 Ga0070669_100128648
392 Ga0070675_100011700
393 Ga0070674_100185712
394 Ga0070673_100180338
395 Ga0070673_100308200
396 Ga0070659_100020218
397 Ga0070709_10126284
398 Ga0070709_10361656
399 Ga0070705_100026620
400 Ga0070705_100070467
401 Ga0070700_100228258
402 Ga0070694_100001070
403 Ga0070694_100041096
404 Ga0070708_100000435
405 Ga0070681_10127590
406 Ga0070706_100008394
407 Ga0070707_100000605
408 Ga0070698_100003037
409 Ga0070698_100032799
410 Ga0070699_100001736
411 Ga0070699_100006038
412 Ga0070699_100009224
413 Ga0070699_100064873
414 Ga0070699_100266640
415 Ga0070699_100351416
416 Ga0070679_100013553
417 Ga0070679_100041269
418 Ga0070679_100149050
419 Ga0070684_100124164
420 Ga0070684_100154293
421 Ga0070697_100000199
422 Ga0070697_100028760
423 Ga0068853_100114207
424 Ga0070672_100357705
425 Ga0070686_100000485
426 Ga0070695_100009117
427 Ga0070695_100047918
428 Ga0070696_100001063
429 Ga0070696_100003538
430 Ga0070696_100115600
431 Ga0070665_100003994
432 Ga0070665_100076454
433 Ga0070665_100088680
434 Ga0070704_100005169
435 Ga0070704_100253034
436 Ga0068855_100064889
437 Ga0068855_100347992
438 Ga0068855_100669694
439 Ga0070664_100376205
440 Ga0068857_100133051
441 Ga0068854_100001623
442 Ga0068854_100062511
443 Ga0068854_100144210
444 Ga0068856_100471722
445 Ga0068859_100086566
446 Ga0068864_100010570
447 Ga0068864_100069799
448 Ga0068864_100090830
449 Ga0068864_100189468
450 Ga0068864_100308210
451 Ga0068866_10121412
452 Ga0068861_100026065
453 Ga0068861_100092629
454 Ga0068861_100237524
455 Ga0068858_100001195
456 Ga0068858_100008505
457 Ga0068858_100011598
458 Ga0068862_100067405
459 Ga0070717_10052232
460 Ga0075432_10073837
461 Ga0097621_100013816
462 Ga0068871_100029898
463 Ga0075428_100152357
464 Ga0075428_100298637
465 Ga0075431_100181344
466 Ga0075431_100268972
467 Ga0075433_10007922
468 Ga0075433_10081065
469 Ga0075434_100005345
470 Ga0075434_100073748
471 Ga0075434_100113051
472 Ga0075434_100170711
473 Ga0075434_100303718
474 Ga0075434_100515168
475 Ga0068865_100330649
476 Ga0075436_100000182
477 Ga0075436_100013462
478 Ga0075436_100021651
479 Ga0075436_100045992
480 Ga0075436_100051406
481 Ga0075436_100113463
482 Ga0097620_100086571
483 Ga0075435_100000027
484 Ga0075435_100002436
485 Ga0075435_100035653
486 Ga0075435_100041128
487 Ga0075435_100274257
488 Ga0099794_10189310
489 Ga0105240_10178101
490 Ga0105240_10406836
491 Ga0111539_10000935
492 Ga0111539_10028232
493 Ga0111539_10229337
494 Ga0111539_10362902
495 Ga0105245_10072742
496 Ga0105247_10025881
497 Ga0105247_10040116
498 Ga0105247_10054117
499 Ga0114129_10007196
500 Ga0114129_10014660
501 Ga0114129_10018245
502 Ga0114129_10073957
503 Ga0114129_10223319
504 Ga0105241_10243383
505 Ga0105242_10026745
506 Ga0105242_10274224
507 Ga0105248_10013497
508 Ga0105248_10092059
509 Ga0105248_10095082
510 Ga0105248_10354500
511 Ga0105248_10470949
512 Ga0105248_10568934
513 Ga0105248_10579814
514 Ga0105238_10013317
515 Ga0105238_10306895
516 Ga0105238_10359063
517 Ga0105246_10101708
518 Ga0157369_10002016
519 Ga0157374_10072758
520 Ga0157378_10544068
521 Ga0163162_10099717
522 Ga0163163_10014757
523 Ga0163163_10035667
524 Ga0163163_10042548
525 Ga0163163_10095641
526 Ga0157380_10003956
527 Ga0157379_10052590
528 Ga0157379_10247087
529 Ga0157379_10350038
530 Ga0207697_10013581
531 Ga0207656_10093625
532 Ga0207682_10021614
533 Ga0207642_10057431
534 Ga0207710_10023588
535 Ga0207680_10029896
536 Ga0207645_10004842
537 Ga0207645_10143254
538 Ga0207643_10060109
539 Ga0207684_10001311
540 Ga0207707_10019486
541 Ga0207695_10248075
542 Ga0207695_10251606
543 Ga0207671_10214910
544 Ga0207657_10012107
545 Ga0207657_10079294
546 Ga0207649_10430433
547 Ga0207652_10022685
548 Ga0207652_10065880
549 Ga0207652_10100253
550 Ga0207646_10001857
551 Ga0207646_10244376
552 Ga0207650_10034441
553 Ga0207659_10059085
554 Ga0207659_10309065
555 Ga0207687_10085573
556 Ga0207690_10029859
557 Ga0207706_10031475
558 Ga0207686_10021734
559 Ga0207686_10182811
560 Ga0207669_10149259
561 Ga0207704_10108254
562 Ga0207665_10070893
563 Ga0207665_10125458
564 Ga0207711_10054415
565 Ga0207689_10086649
566 Ga0207661_10352328
567 Ga0207667_10073335
568 Ga0207667_10237632
569 Ga0207651_10168299
570 Ga0207668_10081107
571 Ga0207640_10023801
572 Ga0207640_10337729
573 Ga0207677_10056373
574 Ga0207677_10088587
575 Ga0207703_10006270
576 Ga0207703_10040483
577 Ga0207703_10044050
578 Ga0207703_10051917
579 Ga0207703_10440461
580 Ga0207639_10102478
581 Ga0207676_10012507
582 Ga0207676_10149389
583 Ga0207676_10219387
584 Ga0207674_10265189
585 Ga0207428_10005438
586 Ga0207428_10014438
587 Ga0268266_10022286
588 Ga0268266_10093919
589 Ga0268266_10204150
590 Ga0268264_10091600
591 Ga0307408_100063967
592 Ga0373948_0001484
593 Ga0373948_0017129
594 Ga0373958_0000617
595 Ga0373959_0003069
596 Ga0373938_0001689
597 Ga0373929_0000331
598 Ga0373934_0002549
599 Ga0373940_0000361
600 Ga0373951_0001456
601 Ga0373952_0000758
602 Ga0373932_0000241
603 Ga0373936_0012398
604 Ga0373939_0017841
605 Ga0373941_0003343
606 Ga0373960_0003460
607 Ga0373955_0014270
608 Ga0373955_0055271
609 Ga0373931_0004375
610 Ga0373935_0188492
611 Ga0373937_0048398
612 Ga0373937_0146458
613 Ga0373925_0102131
614 Ga0395905_0018709
615 Ga0395905_0218882
616 Ga0395901_0076779
617 Ga0395901_0166782
618 Ga0436363_0658713
619 Ga0439441_000857
620 Ga0439434_0050759
621 Ga0451577_0003216
622 Ga0466959_0105593
623 Ga0451576_0001751
624 Ga0451576_0559808
625 Ga0495592_0039068
626 Ga0495641_0037392
627 Ga0495651_0268938
628 Ga0495653_0009091
629 Ga0495653_0193490
630 Ga0495580_0069565
631 Ga0495582_0092793
632 Ga0495664_0031738
633 Ga0495664_0054703
634 Ga0495594_0017750
635 Ga0495608_0217225
636 Ga0495618_0119260
637 Ga0495628_0028371
638 Ga0495628_0095547
639 Ga0495630_0055621
640 Ga0495665_0005023
641 Ga0495665_0114745
642 Ga0495640_0050180
643 Ga0495586_0080624
644 Ga0495645_0006176
645 Ga0495645_0010182
646 Ga0495667_0016855
647 Ga0495667_0024553
648 Ga0495634_0032559
649 Ga0495635_0049648
650 Ga0495635_0144111
651 Ga0495659_0026607
652 Ga0495588_0001065
653 Ga0495657_0112080
654 Ga0495657_0147637
655 Ga0495599_0003615
656 Ga0495599_0060639
657 Ga0495623_0161798
658 Ga0495646_0058605
659 Ga0495658_0014002
660 Ga0495658_0067855
661 Ga0495613_0016470
662 Ga0495613_0078941
663 Ga0495624_0055247
664 Ga0495600_0011786
665 Ga0495600_0015977
666 Ga0495604_0028357
667 Ga0495674_0032067
668 Ga0495674_0153021
669 Ga0495680_0012295
670 Ga0495680_0122182
671 Ga0495675_0063010
672 Ga0495675_0074165
673 Ga0495684_0109155
674 Ga0495684_0290694
675 Ga0495593_0093239
676 Ga0495602_0178393
677 Ga0496102_0321889
678 Ga0496104_0025865
679 Ga0496106_0046405
680 Ga0496106_0249816
681 Ga0496108_0094461
682 Ga0496109_0240398
683 Ga0496109_0548188
684 Ga0496112_0228274
685 Ga0496112_0299944
686 Ga0496113_0115250
687 Ga0496114_0059503
688 Ga0501033_0171653
689 Ga0501034_0002146
690 Ga0501034_0283051
691 Ga0501036_0003736
692 Ga0501036_0073020
693 Ga0501037_0055061
694 Ga0501038_0121321
695 Ga0501039_0093337
696 Ga0501039_0368170
697 Ga0501041_0012027
698 Ga0501043_0369203
699 Ga0501046_0286923
700 Ga0501048_0105574
701 Ga0501068_0117430
702 Ga0501071_0005602
703 Ga0501072_0000863
704 Ga0501074_0332489
705 Ga0501075_0005333
706 Ga0501075_0120222
707 Ga0501075_0158256
708 Ga0501076_0000306
709 Ga0501076_0189434
710 Ga0501076_0461637
711 Ga0501077_0052787
712 Ga0501079_0006897
713 Ga0501080_0017731
714 Ga0501081_0052684
715 Ga0501081_0078162
716 Ga0501045_0001523
717 nmdc:mga0yw44_338_c1
718 nmdc:mga05p37_100256_c1
719 nmdc:mga05p37_11640_c1
720 nmdc:mga05p37_23969_c1
721 nmdc:mga05p37_261382_c1
722 nmdc:mga05p37_49061_c1
723 nmdc:mga08y16_17955_c1
724 nmdc:mga08y16_2359_c1
725 nmdc:mga0n895_106029_c1
726 nmdc:mga0n895_124239_c1
727 nmdc:mga0n895_166157_c1
728 nmdc:mga0n895_195008_c1
729 nmdc:mga0n895_250967_c1
730 nmdc:mga0n895_3_c1
731 nmdc:mga0rr50_111521_c1
732 nmdc:mga0rr50_203040_c1
733 nmdc:mga0rr50_39_c1
734 nmdc:mga0rr50_533570_c1
735 nmdc:mga0rr50_6445_c1
736 nmdc:mga08x19_13793_c1
737 nmdc:mga08x19_246514_c1
738 nmdc:mga08x19_259_c1
739 nmdc:mga08x19_46907_c1
740 nmdc:mga0a205_211067_c1
741 nmdc:mga0a205_59946_c1
742 Ga0495601_0172472
743 Ga0495595_0119615
744 Ga0495619_0018902
745 Ga0495619_0144597
746 Ga0501084_0005006
747 Ga0501082_0003624
748 Ga0501082_0082503
749 Ga0501082_0260320
750 Ga0530510_0000966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

170

301

0.92

PF18306

LDcluster4

SLOG cluster4 family

149

281

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9147 13 263
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.9088 13 266
1wek-assembly1.cif.gz_E crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.905 15 263
5zi9-assembly1.cif.gz_A crystal structure of type-ii log from streptomyces coelicolor a3 0.9013 13 263
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.8963 13 266
ID Description Score Start End Superfamily
af_Q8I1V0_170_336_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9382 110 264 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9211 20 266 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.908 20 262 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9035 20 266 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8899 20 262 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A521JZB0-F1-model_v4 LOG family protein 0.9754 4 228 GO:0005829
AF-A0A352GHQ1-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9724 1 266 GO:0005829
GO:0008714
GO:0009691
AF-A0A7W1I3Z2-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9711 86 287 GO:0005829
GO:0009691
GO:0016787
AF-A0A7C1U9M9-F1-model_v4 LOG family protein 0.9707 104 268 GO:0005829
AF-A0A7Y2K7P2-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9679 88 273 GO:0005829
GO:0009691
GO:0016787

Map