F427031

General Info

Members Datasets Scaffolds Average Seq Length
375 165 750 444

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10261047|Ga0105249_102610471
Length 488
Sequence VEIVWEICGWTDLGDGGYSMGGNWEATAVVETAELNPWDLIKAKLAERIAPQEYQNWVMRTALDSLDGGSLRVQVPDQVTKDFFEQEYTEHIHSTIQELNLPVESIIYLPHSESRQPSEMAASSSSSEPVFASAAGQLNSRFRFDNFVVGSCNQFAHAAARAVADSPSRSYNPLFIYGGVGMGKTHLMHAIGRQLLDKYPSLRVVYTSSERFMNEMIQCLRTNRMPAFQRHFRSADVLLVDDVQILAGKERMQEEFFHTFNELHDHQKQIVISSDSAPKSTPGLVERLRSRFEWGLMVDVQPPDLETKMAILDKKAESEGVALPEEVRIYIATKTKSNVRELEGALIKLIAYSSITSSPITLQMAQQVLKYLISTGERRISMDSILRAVAEKFNMQPPQLKQKSNSRQIAYPRQIAMYLMKDLTQASLPEIGRIFGGKHHTTVLHSVQKNGFGLGQSLHRMSQANKTPVVDDTNKTNVLSRLDCGSVC

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10261047 3300009553 Bacteria 1721
2 Ga0058863_10016505 3300004799 Bacteria 2186
3 Ga0070658_10027644 3300005327 Bacteria 4551
4 Ga0070658_10052356 3300005327 Bacteria 3310
5 Ga0070676_10021874 3300005328 Bacteria 3582
6 Ga0070683_100000012 3300005329 Bacteria 274646
7 Ga0070683_100005350 3300005329 Bacteria 10705
8 Ga0070683_100006691 3300005329 Bacteria 9677
9 Ga0070683_100073912 3300005329 Bacteria 3183
10 Ga0070683_100093985 3300005329 Bacteria 2818
11 Ga0070683_100196917 3300005329 Bacteria 1913
12 Ga0070683_100229852 3300005329 Bacteria 1763
13 Ga0070690_100051446 3300005330 Bacteria 2630
14 Ga0068869_100157978 3300005334 Bacteria 1763
15 Ga0070680_100030672 3300005336 Bacteria 4320
16 Ga0070660_100033262 3300005339 Bacteria 3885
17 Ga0070671_100066822 3300005355 Bacteria 2997
18 Ga0070673_100047773 3300005364 Bacteria 3332
19 Ga0070709_10037087 3300005434 Bacteria 2974
20 Ga0070714_100033310 3300005435 Bacteria 4306
21 Ga0070713_100002713 3300005436 Bacteria 11554
22 Ga0070713_100022719 3300005436 Bacteria 4852
23 Ga0070713_100024571 3300005436 Bacteria 4696
24 Ga0070713_100043559 3300005436 Bacteria 3670
25 Ga0070713_100129381 3300005436 Bacteria 2224
26 Ga0070713_100129652 3300005436 Bacteria 2222
27 Ga0070678_100130805 3300005456 Bacteria 1994
28 Ga0070681_10067741 3300005458 Bacteria 3537
29 Ga0068867_100023161 3300005459 Bacteria 4446
30 Ga0070706_100149216 3300005467 Bacteria 2183
31 Ga0070699_100098585 3300005518 Bacteria 2561
32 Ga0070679_100015257 3300005530 Bacteria 7381
33 Ga0070679_100041676 3300005530 Bacteria 4569
34 Ga0070679_100069996 3300005530 Bacteria 3500
35 Ga0070684_100000013 3300005535 Bacteria 167281
36 Ga0070684_100000461 3300005535 Bacteria 27785
37 Ga0070684_100015400 3300005535 Bacteria 6228
38 Ga0070684_100067521 3300005535 Bacteria 3141
39 Ga0070684_100195490 3300005535 Bacteria 1842
40 Ga0068853_100045142 3300005539 Bacteria 3774
41 Ga0068853_100124851 3300005539 Bacteria 2299
42 Ga0068853_100210128 3300005539 Unclassified 1774
43 Ga0070696_100000642 3300005546 Bacteria 22341
44 Ga0068855_100001264 3300005563 Bacteria 31380
45 Ga0068855_100020019 3300005563 Bacteria 8034
46 Ga0068855_100060129 3300005563 Bacteria 4444
47 Ga0068855_100233419 3300005563 Bacteria 2058
48 Ga0068855_100251251 3300005563 Bacteria 1972
49 Ga0070664_100066046 3300005564 Bacteria 3088
50 Ga0068857_100008490 3300005577 Bacteria 8879
51 Ga0068857_100010968 3300005577 Bacteria 7885
52 Ga0068857_100028089 3300005577 Bacteria 4962
53 Ga0068856_100002281 3300005614 Bacteria 19787
54 Ga0068856_100012063 3300005614 Bacteria 8372
55 Ga0068856_100028767 3300005614 Bacteria 5429
56 Ga0068856_100035884 3300005614 Bacteria 4860
57 Ga0068856_100089419 3300005614 Bacteria 3063
58 Ga0068856_100252898 3300005614 Bacteria 1777
59 Ga0068852_100018268 3300005616 Bacteria 5523
60 Ga0068852_100049579 3300005616 Bacteria 3593
61 Ga0068859_100028389 3300005617 Bacteria 5609
62 Ga0068859_100259103 3300005617 Bacteria 1830
63 Ga0068864_100031562 3300005618 Bacteria 4496
64 Ga0068858_100002546 3300005842 Bacteria 18386
65 Ga0068858_100186627 3300005842 Bacteria 1959
66 Ga0070717_10027569 3300006028 Bacteria 4541
67 Ga0070717_10101899 3300006028 Bacteria 2439
68 Ga0070716_100083191 3300006173 Bacteria 1916
69 Ga0097621_100017411 3300006237 Bacteria 5456
70 Ga0097621_100026631 3300006237 Bacteria 4538
71 Ga0097621_100033339 3300006237 Bacteria 4100
72 Ga0097621_100034015 3300006237 Bacteria 4063
73 Ga0068871_100004128 3300006358 Bacteria 10044
74 Ga0075436_100078983 3300006914 Bacteria 2279
75 Ga0097620_100028387 3300006931 Bacteria 5609
76 Ga0097620_100259108 3300006931 Bacteria 1830
77 Ga0105240_10000836 3300009093 Bacteria 55438
78 Ga0105240_10003254 3300009093 Bacteria 25411
79 Ga0105240_10004285 3300009093 Bacteria 21799
80 Ga0105240_10004314 3300009093 Bacteria 21713
81 Ga0105240_10006842 3300009093 Bacteria 16669
82 Ga0105240_10073099 3300009093 Bacteria 4235
83 Ga0105240_10139015 3300009093 Bacteria 2906
84 Ga0105240_10148624 3300009093 Bacteria 2792
85 Ga0105240_10401189 3300009093 Bacteria 1544
86 Ga0105245_10001095 3300009098 Bacteria 24574
87 Ga0105245_10009500 3300009098 Bacteria 8482
88 Ga0105245_10076565 3300009098 Bacteria 3048
89 Ga0114129_10112160 3300009147 Bacteria 3761
90 Ga0114129_10142405 3300009147 Bacteria 3285
91 Ga0114129_10226315 3300009147 Unclassified 2521
92 Ga0114129_10371160 3300009147 Bacteria 1891
93 Ga0105243_10111916 3300009148 Bacteria 2286
94 Ga0105241_10020882 3300009174 Bacteria 4842
95 Ga0105241_10044429 3300009174 Bacteria 3366
96 Ga0105242_10063936 3300009176 Bacteria 3031
97 Ga0105242_10091769 3300009176 Bacteria 2557
98 Ga0105242_10203262 3300009176 Bacteria 1761
99 Ga0105242_10251120 3300009176 Bacteria 1594
100 Ga0105248_10063377 3300009177 Bacteria 4150
101 Ga0105248_10090214 3300009177 Bacteria 3451
102 Ga0105248_10118812 3300009177 Bacteria 2982
103 Ga0105237_10010234 3300009545 Bacteria 9994
104 Ga0105237_10013253 3300009545 Bacteria 8648
105 Ga0105237_10013674 3300009545 Bacteria 8499
106 Ga0105237_10019392 3300009545 Bacteria 7024
107 Ga0105237_10019712 3300009545 Bacteria 6963
108 Ga0105237_10066496 3300009545 Bacteria 3600
109 Ga0105238_10001663 3300009551 Bacteria 22339
110 Ga0105238_10026647 3300009551 Bacteria 5893
111 Ga0105238_10038111 3300009551 Bacteria 4883
112 Ga0105238_10052773 3300009551 Bacteria 4087
113 Ga0105238_10097528 3300009551 Bacteria 2925
114 Ga0105238_10113361 3300009551 Bacteria 2691
115 Ga0105249_10036584 3300009553 Bacteria 4454
116 Ga0105239_10013134 3300010375 Bacteria 9203
117 Ga0105239_10021503 3300010375 Bacteria 7113
118 Ga0105239_10025072 3300010375 Bacteria 6569
119 Ga0105239_10038001 3300010375 Bacteria 5276
120 Ga0105239_10082844 3300010375 Bacteria 3532
121 Ga0105239_10087091 3300010375 Bacteria 3443
122 Ga0105239_10124589 3300010375 Bacteria 2863
123 Ga0105246_10020663 3300011119 Bacteria 4226
124 Ga0157370_10005835 3300013104 Bacteria 13760
125 Ga0157370_10008178 3300013104 Bacteria 11308
126 Ga0157370_10029012 3300013104 Bacteria 5436
127 Ga0157370_10045504 3300013104 Bacteria 4210
128 Ga0157370_10089331 3300013104 Bacteria 2894
129 Ga0157370_10096551 3300013104 Bacteria 2773
130 Ga0157369_10001521 3300013105 Bacteria 28440
131 Ga0157369_10005820 3300013105 Bacteria 14336
132 Ga0157369_10068523 3300013105 Bacteria 3812
133 Ga0157369_10074963 3300013105 Bacteria 3628
134 Ga0157369_10092735 3300013105 Bacteria 3224
135 Ga0157369_10114617 3300013105 Bacteria 2862
136 Ga0157369_10147307 3300013105 Bacteria 2489
137 Ga0157369_10169390 3300013105 Bacteria 2302
138 Ga0157369_10170555 3300013105 Bacteria 2293
139 Ga0157369_10183918 3300013105 Bacteria 2198
140 Ga0157374_10008504 3300013296 Bacteria 8780
141 Ga0157374_10019083 3300013296 Bacteria 6067
142 Ga0157374_10052600 3300013296 Bacteria 3794
143 Ga0157374_10114670 3300013296 Bacteria 2595
144 Ga0157374_10250554 3300013296 Bacteria 1743
145 Ga0157374_10343577 3300013296 Unclassified 1482
146 Ga0157378_10002457 3300013297 Bacteria 16485
147 Ga0157378_10021255 3300013297 Bacteria 5707
148 Ga0157378_10151141 3300013297 Bacteria 2163
149 Ga0157372_10055670 3300013307 Bacteria 4417
150 Ga0157372_10134654 3300013307 Unclassified 2845
151 Ga0157372_10159223 3300013307 Bacteria 2608
152 Ga0157372_10218494 3300013307 Bacteria 2209
153 Ga0157372_10401028 3300013307 Bacteria 1598
154 Ga0157375_10009280 3300013308 Bacteria 8632
155 Ga0157375_10036855 3300013308 Bacteria 4682
156 Ga0157375_10049344 3300013308 Bacteria 4123
157 Ga0163163_10000599 3300014325 Bacteria 31449
158 Ga0163163_10028603 3300014325 Bacteria 5355
159 Ga0163163_10067342 3300014325 Bacteria 3560
160 Ga0163163_10293533 3300014325 Bacteria 1678
161 Ga0157380_10054964 3300014326 Bacteria 3160
162 Ga0157379_10046447 3300014968 Bacteria 3874
163 Ga0157379_10101764 3300014968 Bacteria 2579
164 Ga0213873_10004068 3300021358 Bacteria 2696
165 Ga0213876_10025532 3300021384 Bacteria 3115
166 Ga0213876_10049060 3300021384 Bacteria 2230
167 Ga0213875_10016585 3300021388 Bacteria 3569
168 Ga0207699_10039263 3300025906 Bacteria 2719
169 Ga0207705_10091640 3300025909 Bacteria 2226
170 Ga0207654_10005853 3300025911 Bacteria 6200
171 Ga0207654_10047793 3300025911 Bacteria 2446
172 Ga0207654_10048610 3300025911 Bacteria 2428
173 Ga0207654_10081410 3300025911 Bacteria 1950
174 Ga0207707_10020294 3300025912 Bacteria 5801
175 Ga0207707_10034872 3300025912 Bacteria 4401
176 Ga0207707_10040492 3300025912 Bacteria 4069
177 Ga0207707_10041859 3300025912 Bacteria 4000
178 Ga0207707_10220867 3300025912 Unclassified 1649
179 Ga0207695_10003561 3300025913 Bacteria 21813
180 Ga0207695_10004065 3300025913 Bacteria 20121
181 Ga0207695_10006490 3300025913 Bacteria 15170
182 Ga0207695_10011109 3300025913 Bacteria 10932
183 Ga0207695_10039361 3300025913 Bacteria 5082
184 Ga0207695_10094229 3300025913 Bacteria 3002
185 Ga0207695_10180814 3300025913 Bacteria 2029
186 Ga0207671_10030278 3300025914 Bacteria 4037
187 Ga0207671_10040210 3300025914 Bacteria 3462
188 Ga0207693_10252939 3300025915 Bacteria 1382
189 Ga0207657_10021034 3300025919 Bacteria 6151
190 Ga0207657_10031089 3300025919 Bacteria 4840
191 Ga0207657_10043887 3300025919 Bacteria 3935
192 Ga0207652_10043339 3300025921 Bacteria 3831
193 Ga0207652_10045148 3300025921 Bacteria 3755
194 Ga0207652_10179731 3300025921 Bacteria 1901
195 Ga0207694_10004148 3300025924 Bacteria 11379
196 Ga0207694_10006163 3300025924 Bacteria 9163
197 Ga0207694_10017927 3300025924 Bacteria 5352
198 Ga0207694_10041955 3300025924 Bacteria 3527
199 Ga0207694_10123115 3300025924 Bacteria 2072
200 Ga0207694_10174670 3300025924 Bacteria 1740
201 Ga0207687_10001544 3300025927 Bacteria 15810
202 Ga0207687_10001838 3300025927 Bacteria 14603
203 Ga0207687_10069528 3300025927 Bacteria 2511
204 Ga0207687_10090622 3300025927 Bacteria 2229
205 Ga0207700_10004618 3300025928 Bacteria 8153
206 Ga0207700_10026479 3300025928 Bacteria 4044
207 Ga0207700_10108346 3300025928 Bacteria 2230
208 Ga0207664_10122818 3300025929 Bacteria 2176
209 Ga0207664_10169173 3300025929 Unclassified 1869
210 Ga0207644_10048992 3300025931 Bacteria 3023
211 Ga0207690_10058925 3300025932 Bacteria 2600
212 Ga0207686_10013035 3300025934 Bacteria 4589
213 Ga0207686_10048944 3300025934 Bacteria 2621
214 Ga0207686_10052687 3300025934 Bacteria 2541
215 Ga0207686_10115295 3300025934 Bacteria 1819
216 Ga0207686_10168223 3300025934 Bacteria 1543
217 Ga0207711_10021034 3300025941 Bacteria 5448
218 Ga0207711_10062824 3300025941 Bacteria 3204
219 Ga0207711_10080430 3300025941 Bacteria 2846
220 Ga0207689_10015294 3300025942 Bacteria 6496
221 Ga0207689_10178314 3300025942 Bacteria 1752
222 Ga0207661_10000034 3300025944 Bacteria 154138
223 Ga0207661_10008430 3300025944 Bacteria 7368
224 Ga0207661_10015718 3300025944 Bacteria 5575
225 Ga0207661_10059707 3300025944 Bacteria 3074
226 Ga0207661_10061697 3300025944 Bacteria 3030
227 Ga0207661_10069420 3300025944 Bacteria 2873
228 Ga0207661_10094146 3300025944 Bacteria 2502
229 Ga0207661_10096065 3300025944 Bacteria 2479
230 Ga0207661_10186343 3300025944 Bacteria 1816
231 Ga0207667_10000145 3300025949 Bacteria 107389
232 Ga0207667_10003252 3300025949 Bacteria 20045
233 Ga0207667_10031726 3300025949 Bacteria 5702
234 Ga0207667_10057403 3300025949 Bacteria 4085
235 Ga0207667_10065084 3300025949 Bacteria 3803
236 Ga0207667_10319233 3300025949 Bacteria 1586
237 Ga0207712_10026993 3300025961 Bacteria 3831
238 Ga0207677_10031282 3300026023 Bacteria 3408
239 Ga0207703_10088184 3300026035 Bacteria 2603
240 Ga0207703_10173237 3300026035 Bacteria 1900
241 Ga0207639_10041834 3300026041 Bacteria 3431
242 Ga0207639_10049226 3300026041 Bacteria 3194
243 Ga0207639_10091336 3300026041 Bacteria 2437
244 Ga0207639_10236573 3300026041 Bacteria 1586
245 Ga0207702_10012949 3300026078 Bacteria 6938
246 Ga0207702_10024399 3300026078 Bacteria 5018
247 Ga0207702_10039919 3300026078 Bacteria 3935
248 Ga0207702_10040702 3300026078 Bacteria 3895
249 Ga0207702_10081827 3300026078 Bacteria 2805
250 Ga0207702_10089583 3300026078 Unclassified 2690
251 Ga0207702_10282169 3300026078 Bacteria 1570
252 Ga0207641_10127891 3300026088 Bacteria 2277
253 Ga0207648_10012969 3300026089 Bacteria 7779
254 Ga0207648_10033316 3300026089 Bacteria 4544
255 Ga0207648_10076649 3300026089 Bacteria 2914
256 Ga0207676_10025298 3300026095 Bacteria 4405
257 Ga0207674_10001972 3300026116 Bacteria 25978
258 Ga0207674_10002063 3300026116 Bacteria 25513
259 Ga0207674_10247614 3300026116 Bacteria 1729
260 Ga0207674_10286925 3300026116 Bacteria 1594
261 Ga0207683_10243313 3300026121 Bacteria 1641
262 Ga0207698_10092175 3300026142 Bacteria 2483
263 Ga0207698_10094389 3300026142 Bacteria 2459
264 Ga0265323_10000834 3300028653 Bacteria 16473
265 Ga0265322_10013580 3300028654 Bacteria 2357
266 Ga0265338_10012895 3300028800 Bacteria 9495
267 Ga0265320_10002073 3300031240 Bacteria 14121
268 Ga0265325_10041607 3300031241 Bacteria 2407
269 Ga0265340_10033678 3300031247 Bacteria 2550
270 Ga0265340_10054977 3300031247 Bacteria 1919
271 Ga0265331_10015790 3300031250 Bacteria 3978
272 Ga0265316_10000972 3300031344 Bacteria 31191
273 Ga0265316_10003654 3300031344 Bacteria 15484
274 Ga0265316_10005452 3300031344 Bacteria 12356
275 Ga0265316_10006560 3300031344 Bacteria 11098
276 Ga0265316_10010922 3300031344 Bacteria 8243
277 Ga0265316_10048539 3300031344 Bacteria 3350
278 Ga0265316_10051412 3300031344 Bacteria 3237
279 Ga0307408_100185963 3300031548 Bacteria 1670
280 Ga0265313_10009772 3300031595 Bacteria 6181
281 Ga0265314_10004329 3300031711 Bacteria 13237
282 Ga0265314_10108982 3300031711 Bacteria 1763
283 Ga0265342_10127321 3300031712 Bacteria 1429
284 Ga0307409_100019595 3300031995 Bacteria 4586
285 Ga0307416_100055193 3300032002 Bacteria 3198
286 Ga0373926_0060169 3300035083 Unclassified 1383
287 Ga0373934_0002316 3300035086 Bacteria 7007
288 Ga0373956_0043166 3300035119 Bacteria 2007
289 Ga0373955_0009333 3300035172 Bacteria 4594
290 Ga0373955_0015515 3300035172 Bacteria 3732
291 Ga0373935_0033652 3300035692 Bacteria 3191
292 Ga0373935_0091098 3300035692 Bacteria 1997
293 Ga0373927_0003906 3300035695 Bacteria 10571
294 Ga0373927_0006516 3300035695 Bacteria 7953
295 Ga0373927_0027213 3300035695 Bacteria 3734
296 Ga0373933_0002695 3300035724 Bacteria 9942
297 Ga0373937_0031279 3300036401 Bacteria 4821
298 Ga0373925_0003400 3300037068 Bacteria 12333
299 Ga0373925_0052680 3300037068 Bacteria 3041
300 Ga0373925_0198215 3300037068 Bacteria 1596
301 Ga0436364_0088985 3300037853 Bacteria 1721
302 Ga0436364_0199622 3300037853 Bacteria 6204
303 Ga0436364_0507174 3300037853 Bacteria 3132
304 Ga0436364_0989117 3300037853 Bacteria 5308
305 Ga0395901_0178259 3300038443 Bacteria 2229
306 Ga0436365_0376737 3300039437 Bacteria 3675
307 Ga0436365_0449298 3300039437 Bacteria 4816
308 Ga0436365_1576530 3300039437 Bacteria 3558
309 Ga0436365_1702378 3300039437 Bacteria 1816
310 Ga0436361_0472924 3300039447 Bacteria 5261
311 Ga0436361_0726991 3300039447 Bacteria 1329
312 Ga0436363_1583319 3300039450 Bacteria 5954
313 Ga0436362_0090074 3300039453 Bacteria 2831
314 Ga0436362_1183855 3300039453 Bacteria 1750
315 Ga0451577_0083793 3300042876 Bacteria 2844
316 Ga0495592_0016555 3300046454 Bacteria 5596
317 Ga0495580_0008620 3300046472 Bacteria 8086
318 Ga0495580_0021285 3300046472 Bacteria 4786
319 Ga0495580_0027964 3300046472 Bacteria 4102
320 Ga0495580_0134610 3300046472 Bacteria 1714
321 Ga0495582_0012451 3300046473 Bacteria 4687
322 Ga0495628_0017713 3300046516 Bacteria 5920
323 Ga0495652_0203473 3300046529 Bacteria 1501
324 Ga0495634_0016337 3300046642 Bacteria 5309
325 Ga0495635_0120853 3300046663 Bacteria 1787
326 Ga0495599_0015040 3300046678 Bacteria 4797
327 Ga0495658_0020607 3300046683 Bacteria 3463
328 Ga0495600_0036874 3300046809 Bacteria 3178
329 Ga0495674_0100763 3300047319 Bacteria 2458
330 Ga0495684_0004430 3300047471 Bacteria 10979
331 Ga0495684_0061344 3300047471 Bacteria 2860
332 Ga0495684_0083227 3300047471 Bacteria 2427
333 Ga0495602_0002149 3300048088 Bacteria 19909
334 Ga0496112_0224988 3300048915 Bacteria 1832
335 Ga0501031_0004967 3300049568 Bacteria 8650
336 Ga0501032_0001115 3300049569 Bacteria 21479
337 Ga0501033_0001453 3300049570 Bacteria 20995
338 Ga0501034_0002275 3300049571 Bacteria 23563
339 Ga0501036_0029455 3300049572 Bacteria 4636
340 Ga0501037_0050714 3300049573 Bacteria 3036
341 Ga0501038_0009976 3300049574 Bacteria 8696
342 Ga0501038_0144950 3300049574 Bacteria 1940
343 Ga0501043_0000309 3300049579 Bacteria 44423
344 Ga0501046_0002719 3300049580 Bacteria 16466
345 Ga0501047_0007395 3300049581 Bacteria 10330
346 Ga0501047_0046621 3300049581 Bacteria 4188
347 Ga0501047_0220871 3300049581 Bacteria 1751
348 Ga0501048_0009411 3300049582 Bacteria 7338
349 Ga0501048_0064785 3300049582 Bacteria 2584
350 Ga0501067_0000817 3300049583 Bacteria 16793
351 Ga0501068_0001543 3300049584 Bacteria 12244
352 Ga0501069_0000163 3300049585 Bacteria 29376
353 Ga0501070_0003011 3300049586 Bacteria 14667
354 Ga0501070_0047890 3300049586 Bacteria 3552
355 Ga0501072_0022398 3300049588 Bacteria 4901
356 Ga0501073_0002461 3300049589 Bacteria 13834
357 Ga0501074_0006440 3300049590 Bacteria 8479
358 Ga0501075_0015998 3300049591 Bacteria 5396
359 Ga0501076_0043839 3300049592 Bacteria 3527
360 Ga0501076_0067134 3300049592 Bacteria 2863
361 Ga0501079_0003242 3300049741 Bacteria 11916
362 Ga0501080_0000176 3300049742 Bacteria 46962
363 Ga0501083_0034307 3300049744 Bacteria 3470
364 Ga0501083_0072776 3300049744 Bacteria 2284
365 Ga0501044_0001389 3300049823 Bacteria 28402
366 Ga0501044_0005272 3300049823 Bacteria 14380
367 Ga0501044_0100635 3300049823 Bacteria 2908
368 Ga0501044_0269642 3300049823 Bacteria 1638
369 nmdc:mga05p37_329129_c1 3300050507 Bacteria 1805
370 nmdc:mga05p37_333938_c1 3300050507 Bacteria 1789
371 nmdc:mga06r32_100343_c1 3300050510 Bacteria 2840
372 nmdc:mga08x19_6205_c1 3300050514 Bacteria 7069
373 Ga0495612_0047527 3300053078 Bacteria 1759
374 Ga0501084_0001944 3300054114 Bacteria 16509
375 Ga0501082_0008871 3300060353 Bacteria 8673
376 Ga0105249_10261047
377 Ga0058863_10016505
378 Ga0070658_10027644
379 Ga0070658_10052356
380 Ga0070676_10021874
381 Ga0070683_100000012
382 Ga0070683_100005350
383 Ga0070683_100006691
384 Ga0070683_100073912
385 Ga0070683_100093985
386 Ga0070683_100196917
387 Ga0070683_100229852
388 Ga0070690_100051446
389 Ga0068869_100157978
390 Ga0070680_100030672
391 Ga0070660_100033262
392 Ga0070671_100066822
393 Ga0070673_100047773
394 Ga0070709_10037087
395 Ga0070714_100033310
396 Ga0070713_100002713
397 Ga0070713_100022719
398 Ga0070713_100024571
399 Ga0070713_100043559
400 Ga0070713_100129381
401 Ga0070713_100129652
402 Ga0070678_100130805
403 Ga0070681_10067741
404 Ga0068867_100023161
405 Ga0070706_100149216
406 Ga0070699_100098585
407 Ga0070679_100015257
408 Ga0070679_100041676
409 Ga0070679_100069996
410 Ga0070684_100000013
411 Ga0070684_100000461
412 Ga0070684_100015400
413 Ga0070684_100067521
414 Ga0070684_100195490
415 Ga0068853_100045142
416 Ga0068853_100124851
417 Ga0068853_100210128
418 Ga0070696_100000642
419 Ga0068855_100001264
420 Ga0068855_100020019
421 Ga0068855_100060129
422 Ga0068855_100233419
423 Ga0068855_100251251
424 Ga0070664_100066046
425 Ga0068857_100008490
426 Ga0068857_100010968
427 Ga0068857_100028089
428 Ga0068856_100002281
429 Ga0068856_100012063
430 Ga0068856_100028767
431 Ga0068856_100035884
432 Ga0068856_100089419
433 Ga0068856_100252898
434 Ga0068852_100018268
435 Ga0068852_100049579
436 Ga0068859_100028389
437 Ga0068859_100259103
438 Ga0068864_100031562
439 Ga0068858_100002546
440 Ga0068858_100186627
441 Ga0070717_10027569
442 Ga0070717_10101899
443 Ga0070716_100083191
444 Ga0097621_100017411
445 Ga0097621_100026631
446 Ga0097621_100033339
447 Ga0097621_100034015
448 Ga0068871_100004128
449 Ga0075436_100078983
450 Ga0097620_100028387
451 Ga0097620_100259108
452 Ga0105240_10000836
453 Ga0105240_10003254
454 Ga0105240_10004285
455 Ga0105240_10004314
456 Ga0105240_10006842
457 Ga0105240_10073099
458 Ga0105240_10139015
459 Ga0105240_10148624
460 Ga0105240_10401189
461 Ga0105245_10001095
462 Ga0105245_10009500
463 Ga0105245_10076565
464 Ga0114129_10112160
465 Ga0114129_10142405
466 Ga0114129_10226315
467 Ga0114129_10371160
468 Ga0105243_10111916
469 Ga0105241_10020882
470 Ga0105241_10044429
471 Ga0105242_10063936
472 Ga0105242_10091769
473 Ga0105242_10203262
474 Ga0105242_10251120
475 Ga0105248_10063377
476 Ga0105248_10090214
477 Ga0105248_10118812
478 Ga0105237_10010234
479 Ga0105237_10013253
480 Ga0105237_10013674
481 Ga0105237_10019392
482 Ga0105237_10019712
483 Ga0105237_10066496
484 Ga0105238_10001663
485 Ga0105238_10026647
486 Ga0105238_10038111
487 Ga0105238_10052773
488 Ga0105238_10097528
489 Ga0105238_10113361
490 Ga0105249_10036584
491 Ga0105239_10013134
492 Ga0105239_10021503
493 Ga0105239_10025072
494 Ga0105239_10038001
495 Ga0105239_10082844
496 Ga0105239_10087091
497 Ga0105239_10124589
498 Ga0105246_10020663
499 Ga0157370_10005835
500 Ga0157370_10008178
501 Ga0157370_10029012
502 Ga0157370_10045504
503 Ga0157370_10089331
504 Ga0157370_10096551
505 Ga0157369_10001521
506 Ga0157369_10005820
507 Ga0157369_10068523
508 Ga0157369_10074963
509 Ga0157369_10092735
510 Ga0157369_10114617
511 Ga0157369_10147307
512 Ga0157369_10169390
513 Ga0157369_10170555
514 Ga0157369_10183918
515 Ga0157374_10008504
516 Ga0157374_10019083
517 Ga0157374_10052600
518 Ga0157374_10114670
519 Ga0157374_10250554
520 Ga0157374_10343577
521 Ga0157378_10002457
522 Ga0157378_10021255
523 Ga0157378_10151141
524 Ga0157372_10055670
525 Ga0157372_10134654
526 Ga0157372_10159223
527 Ga0157372_10218494
528 Ga0157372_10401028
529 Ga0157375_10009280
530 Ga0157375_10036855
531 Ga0157375_10049344
532 Ga0163163_10000599
533 Ga0163163_10028603
534 Ga0163163_10067342
535 Ga0163163_10293533
536 Ga0157380_10054964
537 Ga0157379_10046447
538 Ga0157379_10101764
539 Ga0213873_10004068
540 Ga0213876_10025532
541 Ga0213876_10049060
542 Ga0213875_10016585
543 Ga0207699_10039263
544 Ga0207705_10091640
545 Ga0207654_10005853
546 Ga0207654_10047793
547 Ga0207654_10048610
548 Ga0207654_10081410
549 Ga0207707_10020294
550 Ga0207707_10034872
551 Ga0207707_10040492
552 Ga0207707_10041859
553 Ga0207707_10220867
554 Ga0207695_10003561
555 Ga0207695_10004065
556 Ga0207695_10006490
557 Ga0207695_10011109
558 Ga0207695_10039361
559 Ga0207695_10094229
560 Ga0207695_10180814
561 Ga0207671_10030278
562 Ga0207671_10040210
563 Ga0207693_10252939
564 Ga0207657_10021034
565 Ga0207657_10031089
566 Ga0207657_10043887
567 Ga0207652_10043339
568 Ga0207652_10045148
569 Ga0207652_10179731
570 Ga0207694_10004148
571 Ga0207694_10006163
572 Ga0207694_10017927
573 Ga0207694_10041955
574 Ga0207694_10123115
575 Ga0207694_10174670
576 Ga0207687_10001544
577 Ga0207687_10001838
578 Ga0207687_10069528
579 Ga0207687_10090622
580 Ga0207700_10004618
581 Ga0207700_10026479
582 Ga0207700_10108346
583 Ga0207664_10122818
584 Ga0207664_10169173
585 Ga0207644_10048992
586 Ga0207690_10058925
587 Ga0207686_10013035
588 Ga0207686_10048944
589 Ga0207686_10052687
590 Ga0207686_10115295
591 Ga0207686_10168223
592 Ga0207711_10021034
593 Ga0207711_10062824
594 Ga0207711_10080430
595 Ga0207689_10015294
596 Ga0207689_10178314
597 Ga0207661_10000034
598 Ga0207661_10008430
599 Ga0207661_10015718
600 Ga0207661_10059707
601 Ga0207661_10061697
602 Ga0207661_10069420
603 Ga0207661_10094146
604 Ga0207661_10096065
605 Ga0207661_10186343
606 Ga0207667_10000145
607 Ga0207667_10003252
608 Ga0207667_10031726
609 Ga0207667_10057403
610 Ga0207667_10065084
611 Ga0207667_10319233
612 Ga0207712_10026993
613 Ga0207677_10031282
614 Ga0207703_10088184
615 Ga0207703_10173237
616 Ga0207639_10041834
617 Ga0207639_10049226
618 Ga0207639_10091336
619 Ga0207639_10236573
620 Ga0207702_10012949
621 Ga0207702_10024399
622 Ga0207702_10039919
623 Ga0207702_10040702
624 Ga0207702_10081827
625 Ga0207702_10089583
626 Ga0207702_10282169
627 Ga0207641_10127891
628 Ga0207648_10012969
629 Ga0207648_10033316
630 Ga0207648_10076649
631 Ga0207676_10025298
632 Ga0207674_10001972
633 Ga0207674_10002063
634 Ga0207674_10247614
635 Ga0207674_10286925
636 Ga0207683_10243313
637 Ga0207698_10092175
638 Ga0207698_10094389
639 Ga0265323_10000834
640 Ga0265322_10013580
641 Ga0265338_10012895
642 Ga0265320_10002073
643 Ga0265325_10041607
644 Ga0265340_10033678
645 Ga0265340_10054977
646 Ga0265331_10015790
647 Ga0265316_10000972
648 Ga0265316_10003654
649 Ga0265316_10005452
650 Ga0265316_10006560
651 Ga0265316_10010922
652 Ga0265316_10048539
653 Ga0265316_10051412
654 Ga0307408_100185963
655 Ga0265313_10009772
656 Ga0265314_10004329
657 Ga0265314_10108982
658 Ga0265342_10127321
659 Ga0307409_100019595
660 Ga0307416_100055193
661 Ga0373926_0060169
662 Ga0373934_0002316
663 Ga0373956_0043166
664 Ga0373955_0009333
665 Ga0373955_0015515
666 Ga0373935_0033652
667 Ga0373935_0091098
668 Ga0373927_0003906
669 Ga0373927_0006516
670 Ga0373927_0027213
671 Ga0373933_0002695
672 Ga0373937_0031279
673 Ga0373925_0003400
674 Ga0373925_0052680
675 Ga0373925_0198215
676 Ga0436364_0088985
677 Ga0436364_0199622
678 Ga0436364_0507174
679 Ga0436364_0989117
680 Ga0395901_0178259
681 Ga0436365_0376737
682 Ga0436365_0449298
683 Ga0436365_1576530
684 Ga0436365_1702378
685 Ga0436361_0472924
686 Ga0436361_0726991
687 Ga0436363_1583319
688 Ga0436362_0090074
689 Ga0436362_1183855
690 Ga0451577_0083793
691 Ga0495592_0016555
692 Ga0495580_0008620
693 Ga0495580_0021285
694 Ga0495580_0027964
695 Ga0495580_0134610
696 Ga0495582_0012451
697 Ga0495628_0017713
698 Ga0495652_0203473
699 Ga0495634_0016337
700 Ga0495635_0120853
701 Ga0495599_0015040
702 Ga0495658_0020607
703 Ga0495600_0036874
704 Ga0495674_0100763
705 Ga0495684_0004430
706 Ga0495684_0061344
707 Ga0495684_0083227
708 Ga0495602_0002149
709 Ga0496112_0224988
710 Ga0501031_0004967
711 Ga0501032_0001115
712 Ga0501033_0001453
713 Ga0501034_0002275
714 Ga0501036_0029455
715 Ga0501037_0050714
716 Ga0501038_0009976
717 Ga0501038_0144950
718 Ga0501043_0000309
719 Ga0501046_0002719
720 Ga0501047_0007395
721 Ga0501047_0046621
722 Ga0501047_0220871
723 Ga0501048_0009411
724 Ga0501048_0064785
725 Ga0501067_0000817
726 Ga0501068_0001543
727 Ga0501069_0000163
728 Ga0501070_0003011
729 Ga0501070_0047890
730 Ga0501072_0022398
731 Ga0501073_0002461
732 Ga0501074_0006440
733 Ga0501075_0015998
734 Ga0501076_0043839
735 Ga0501076_0067134
736 Ga0501079_0003242
737 Ga0501080_0000176
738 Ga0501083_0034307
739 Ga0501083_0072776
740 Ga0501044_0001389
741 Ga0501044_0005272
742 Ga0501044_0100635
743 Ga0501044_0269642
744 nmdc:mga05p37_329129_c1
745 nmdc:mga05p37_333938_c1
746 nmdc:mga06r32_100343_c1
747 nmdc:mga08x19_6205_c1
748 Ga0495612_0047527
749 Ga0501084_0001944
750 Ga0501082_0008871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00308

Bac_DnaA

Bacterial DnaA ATPAse domain

138

299

0.99

PF08299

Bac_DnaA_C

Bacterial dnaA protein helix-turn-helix

382

449

0.98

PF11638

DnaA_N

DnaA N-terminal domain

36

98

0.95

PF01695

IstB_IS21

IstB-like ATP binding protein

162

279

0.89

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

174

298

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j1v-assembly1.cif.gz_A crystal structure of dnaa domainiv complexed with dnaabox dna 0.9862 353 444
3pvv-assembly2.cif.gz_B structure of mycobacterium tuberculosis dnaa-dbd in complex with box1 dna 0.973 353 444
1j1v-assembly1.cif.gz_A crystal structure of dnaa domainiv complexed with dnaabox dna 0.9554 353 444
2z4r-assembly2.cif.gz_B crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa 0.9536 111 345
8bv3-assembly1.cif.gz_E bacillus subtilis dnaa domain iii structure 0.951 111 343
ID Description Score Start End Superfamily
af_P03004_374_467_1.10.1750.10 Mainly Alpha;Orthogonal Bundle;Chromosomal Replication Initiator Protein Dnaa; Chain: A;;DnaA protein, C-terminal DNA-binding domain 0.9876 353 444 1.10.1750.10
1j1vA00 Mainly Alpha;Orthogonal Bundle;Chromosomal Replication Initiator Protein Dnaa; Chain: A;;DnaA protein, C-terminal DNA-binding domain 0.9855 353 444 1.10.1750.10
3pvvB00 Mainly Alpha;Orthogonal Bundle;Chromosomal Replication Initiator Protein Dnaa; Chain: A;;DnaA protein, C-terminal DNA-binding domain 0.973 353 444 1.10.1750.10
af_P03004_374_467_1.10.1750.10 Mainly Alpha;Orthogonal Bundle;Chromosomal Replication Initiator Protein Dnaa; Chain: A;;DnaA protein, C-terminal DNA-binding domain 0.9567 353 444 1.10.1750.10
1j1vA00 Mainly Alpha;Orthogonal Bundle;Chromosomal Replication Initiator Protein Dnaa; Chain: A;;DnaA protein, C-terminal DNA-binding domain 0.9541 353 444 1.10.1750.10
ID Description Score Start End GO Terms
AF-A0A7G6RSJ6-F1-model_v4 deleted 0.9873 353 444
AF-A0A3C0PHD9-F1-model_v4 Chromosomal replication initiator protein DnaA 0.9816 352 444 GO:0003688
GO:0005524
GO:0005886
GO:0006270
GO:0006275
AF-A0A3D5FY76-F1-model_v4 deleted 0.9792 358 444
AF-X1KL06-F1-model_v4 Chromosomal replication initiator DnaA C-terminal domain-containing protein 0.9759 351 445 GO:0003688
GO:0005524
GO:0005886
GO:0006270
GO:0006275
AF-A0A4Q9W1X5-F1-model_v4 Chromosomal replication initiator protein DnaA 0.9666 349 444 GO:0003688
GO:0005524
GO:0005886
GO:0006270
GO:0006275

Map