F426971

General Info

Members Datasets Scaffolds Average Seq Length
375 274 354 175

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100222629|Ga0070672_1002226291
Length 190
Sequence VSDFARSLPEGEEHAPRGEVRVRPVAPGTRPELASIEAGIVAERGRVSLLYQVLLNSAPLAEGWEKLLTAVRNRSAVPGDLRELIILRVAVCNRAPYEFAAHVPHAREAGVSEEKIEALRAGADVSAAFDARERAVLALADAMTCNVQVDDATMAPITAQFDPRTVVEIVATVAAYNMVSRFLEALRIGH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2818991446 Variovorax sp. 1180 Isolate Unclassified
9 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
10 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
11 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
12 2855767633 Achromobacter sp. HZ34 Isolate Nodule
13 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
14 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
15 2904456579 Variovorax sp. 2002 Isolate Unclassified
16 2928037797 Variovorax sp. 1126 Isolate Unclassified
17 2928044640 Variovorax sp. 1128 Isolate Unclassified
18 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
19 2929520902 Variovorax beijingensis 502 Isolate Unclassified
20 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
21 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
22 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
23 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
37 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
166 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
167 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
186 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
195 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
196 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
199 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
200 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
203 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
204 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
265 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
272 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 0.53
Isolates 5.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36
Nodule 0.8
Rhizoplane 3.73
Rhizosphere 49.07
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2300504 2162886007 Bacteria 952
2 JGI25158J39367_1009665 3300002739 Bacteria 1318
3 JGI25152J39213_1000010 3300002773 Bacteria 134529
4 JGI25152J39213_1001576 3300002773 Bacteria 9567
5 JGI25150J39212_1000054 3300002774 Bacteria 68367
6 JGI25159J45721_1000027 3300002987 Bacteria 113483
7 JGI25151J46595_10000104 3300003187 Bacteria 114078
8 JGI25153J46596_10000076 3300003215 Bacteria 114078
9 JGI25153J46596_10000151 3300003215 Bacteria 70139
10 rootH1_10060511 3300003316 Bacteria 2235
11 rootH2_10167896 3300003320 Bacteria 1411
12 rootL2_10216486 3300003322 Bacteria 2659
13 rootH1_10001859 3300003323 Bacteria 12429
14 JGI25160J50197_1000066 3300003354 Bacteria 114078
15 JGI25160J50197_1006915 3300003354 Bacteria 4515
16 JGI25161J50226_1000191 3300003374 Bacteria 39938
17 Ga0006562J51391_1133628 3300003578 Bacteria 2580
18 Ga0006562J51391_1133629 3300003578 Bacteria 1969
19 Ga0055532_1007486 3300003758 Bacteria 1402
20 Ga0055535_1000241 3300003761 Bacteria 57946
21 Ga0055542_1000126 3300003762 Bacteria 100388
22 Ga0055529_1001134 3300003763 Bacteria 11334
23 Ga0055526_1000055 3300003771 Bacteria 113485
24 Ga0055526_1007258 3300003771 Bacteria 5809
25 Ga0055537_1000023 3300003773 Bacteria 113485
26 Ga0055537_1008718 3300003773 Bacteria 2311
27 Ga0055524_1000092 3300003775 Bacteria 113485
28 Ga0055524_1004353 3300003775 Bacteria 6552
29 Ga0055536_1002200 3300003781 Bacteria 11106
30 Ga0055536_1002840 3300003781 Bacteria 9540
31 Ga0055534_1000036 3300003784 Bacteria 113485
32 Ga0055534_1002641 3300003784 Bacteria 6084
33 Ga0055528_1000038 3300003790 Bacteria 113485
34 Ga0055528_1002270 3300003790 Bacteria 10417
35 Ga0055530_10000967 3300003791 Bacteria 23302
36 Ga0055530_10001927 3300003791 Bacteria 14155
37 Ga0055530_10005776 3300003791 Bacteria 5749
38 Ga0055540_1000149 3300003792 Bacteria 68747
39 Ga0055540_1000275 3300003792 Bacteria 46202
40 Ga0055540_1003439 3300003792 Bacteria 7649
41 Ga0055540_1004407 3300003792 Bacteria 6365
42 Ga0055540_1004668 3300003792 Bacteria 6073
43 Ga0055531_10000062 3300003794 Bacteria 120504
44 Ga0055531_10002400 3300003794 Bacteria 12584
45 Ga0055531_10006836 3300003794 Bacteria 6365
46 Ga0055531_10035138 3300003794 Bacteria 1575
47 Ga0055543_1000313 3300004625 Bacteria 33720
48 Ga0055543_1004163 3300004625 Bacteria 4016
49 Ga0065165_1000165 3300005262 Bacteria 115869
50 Ga0065165_1004962 3300005262 Bacteria 7816
51 Ga0065165_1016203 3300005262 Bacteria 2801
52 Ga0065704_10157361 3300005289 Bacteria 1381
53 Ga0070680_100539171 3300005336 Unclassified 1000
54 Ga0070660_100103841 3300005339 Bacteria 2254
55 Ga0070661_100066573 3300005344 Bacteria 2647
56 Ga0070674_100606990 3300005356 Bacteria 925
57 Ga0070673_100003994 3300005364 Bacteria 9279
58 Ga0070659_100572171 3300005366 Unclassified 969
59 Ga0070667_100022884 3300005367 Bacteria 5181
60 Ga0070667_100043574 3300005367 Bacteria 3766
61 Ga0070667_100525649 3300005367 Bacteria 1086
62 Ga0070711_100276173 3300005439 Bacteria 1328
63 Ga0070700_100296503 3300005441 Bacteria 1178
64 Ga0070708_100247620 3300005445 Bacteria 1674
65 Ga0070678_100334592 3300005456 Bacteria 1297
66 Ga0070681_10060534 3300005458 Bacteria 3762
67 Ga0070685_10493627 3300005466 Unclassified 865
68 Ga0070707_101678334 3300005468 Unclassified 602
69 Ga0070679_100109842 3300005530 Bacteria 2744
70 Ga0068853_100040084 3300005539 Bacteria 3995
71 Ga0070672_100222629 3300005543 Bacteria 1583
72 Ga0070693_100077746 3300005547 Bacteria 1970
73 Ga0068855_100037880 3300005563 Bacteria 5731
74 Ga0070664_100161760 3300005564 Bacteria 1981
75 Ga0068857_100052641 3300005577 Bacteria 3611
76 Ga0068856_100327219 3300005614 Bacteria 1550
77 Ga0068859_100361203 3300005617 Bacteria 1547
78 Ga0068861_100858071 3300005719 Bacteria 857
79 Ga0068863_100064124 3300005841 Bacteria 3474
80 Ga0068858_100162594 3300005842 Bacteria 2102
81 Ga0068858_100511170 3300005842 Unclassified 1161
82 Ga0068860_100125140 3300005843 Bacteria 2464
83 Ga0075365_10047269 3300006038 Bacteria 2828
84 Ga0075365_10355273 3300006038 Bacteria 1033
85 Ga0075363_100000734 3300006048 Bacteria 11140
86 Ga0075363_100372631 3300006048 Bacteria 836
87 Ga0075364_10036085 3300006051 Bacteria 3196
88 Ga0075432_10003405 3300006058 Bacteria 5383
89 Ga0075362_10000286 3300006177 Bacteria 14260
90 Ga0075362_10043496 3300006177 Bacteria 1989
91 Ga0075362_10065727 3300006177 Bacteria 1647
92 Ga0075367_10199558 3300006178 Bacteria 1250
93 Ga0075369_10013577 3300006186 Bacteria 3237
94 Ga0075369_10187590 3300006186 Bacteria 952
95 Ga0075366_10001531 3300006195 Bacteria 11562
96 Ga0075366_10005069 3300006195 Bacteria 7122
97 Ga0075366_10255370 3300006195 Bacteria 1069
98 Ga0075366_10287567 3300006195 Bacteria 1005
99 Ga0075370_10007230 3300006353 Bacteria 5646
100 Ga0075370_10030258 3300006353 Bacteria 3020
101 Ga0075370_10084914 3300006353 Bacteria 1822
102 Ga0075431_100206017 3300006847 Bacteria 2011
103 Ga0068865_101135636 3300006881 Bacteria 689
104 Ga0097620_100361195 3300006931 Bacteria 1547
105 Ga0105244_10013636 3300009036 Bacteria 4737
106 Ga0105243_10343479 3300009148 Bacteria 1368
107 Ga0105241_10014355 3300009174 Bacteria 5800
108 Ga0105242_10223678 3300009176 Bacteria 1683
109 Ga0105248_10544520 3300009177 Bacteria 1309
110 Ga0105237_10022801 3300009545 Bacteria 6424
111 Ga0105238_12136927 3300009551 Unclassified 594
112 Ga0105239_10072398 3300010375 Bacteria 3788
113 Ga0105246_10774990 3300011119 Bacteria 848
114 Ga0157339_1003620 3300012505 Bacteria 1127
115 Ga0157373_10333389 3300013100 Bacteria 1080
116 Ga0157370_10703603 3300013104 Bacteria 922
117 Ga0157378_11659299 3300013297 Unclassified 686
118 Ga0157372_10785621 3300013307 Unclassified 1106
119 Ga0157375_10284876 3300013308 Bacteria 1815
120 Ga0157375_10766775 3300013308 Unclassified 1115
121 Ga0163163_10058325 3300014325 Bacteria 3817
122 Ga0182008_10088401 3300014497 Bacteria 1526
123 Ga0157379_10764238 3300014968 Bacteria 910
124 Ga0157376_10257888 3300014969 Bacteria 1632
125 Ga0157376_10390810 3300014969 Bacteria 1342
126 Ga0157376_11101335 3300014969 Bacteria 820
127 Ga0182006_1012230 3300015261 Bacteria 3756
128 Ga0163161_10043479 3300017792 Bacteria 3234
129 Ga0163161_10128083 3300017792 Bacteria 1913
130 Ga0209436_101351 3300025208 Bacteria 8667
131 Ga0209436_110591 3300025208 Bacteria 1675
132 Ga0209672_100550 3300025228 Bacteria 20292
133 Ga0209672_106414 3300025228 Bacteria 1914
134 Ga0209147_100805 3300025229 Bacteria 15154
135 Ga0209258_100018 3300025242 Bacteria 567561
136 Ga0209258_109897 3300025242 Bacteria 1260
137 Ga0207425_1000057 3300025245 Bacteria 149738
138 Ga0209148_1000030 3300025254 Bacteria 567582
139 Ga0209129_1000030 3300025258 Bacteria 391958
140 Ga0209565_1000019 3300025263 Bacteria 438920
141 Ga0209565_1001499 3300025263 Bacteria 10194
142 Ga0209455_1001484 3300025272 Bacteria 10522
143 Ga0209673_1000155 3300025273 Bacteria 145667
144 Ga0209673_1000648 3300025273 Bacteria 51507
145 Ga0209130_1000011 3300025284 Bacteria 431723
146 Ga0209130_1001838 3300025284 Bacteria 12244
147 Ga0209675_1000031 3300025291 Bacteria 273599
148 Ga0209675_1002192 3300025291 Bacteria 10243
149 Ga0209676_1000004 3300025292 Bacteria 1138360
150 Ga0209676_1000627 3300025292 Bacteria 51086
151 Ga0209025_1000078 3300025294 Bacteria 271683
152 Ga0209564_1000056 3300025295 Bacteria 340873
153 Ga0209564_1000319 3300025295 Bacteria 93563
154 Ga0209758_1000037 3300025297 Bacteria 439101
155 Ga0209758_1000120 3300025297 Bacteria 192212
156 Ga0209050_1000002 3300025298 Bacteria 1792849
157 Ga0209050_1000100 3300025298 Bacteria 231385
158 Ga0209050_1000537 3300025298 Bacteria 62966
159 Ga0209256_1000043 3300025299 Bacteria 340873
160 Ga0209256_1000166 3300025299 Bacteria 133549
161 Ga0207426_1000029 3300025302 Bacteria 473835
162 Ga0207426_1000469 3300025302 Bacteria 62457
163 Ga0209051_1000002 3300025303 Bacteria 1631846
164 Ga0209051_1000067 3300025303 Bacteria 227181
165 Ga0209051_1000302 3300025303 Bacteria 77692
166 Ga0209051_1000345 3300025303 Bacteria 69229
167 Ga0209051_1000804 3300025303 Bacteria 32919
168 Ga0209257_1000002 3300025304 Bacteria 1767052
169 Ga0209257_1000095 3300025304 Bacteria 259437
170 Ga0209257_1000127 3300025304 Bacteria 214847
171 Ga0209257_1002834 3300025304 Bacteria 16262
172 Ga0207655_1019123 3300025728 Bacteria 3598
173 Ga0207688_10156116 3300025901 Bacteria 1350
174 Ga0207654_10074080 3300025911 Bacteria 2031
175 Ga0207707_10368255 3300025912 Bacteria 1236
176 Ga0207671_10020497 3300025914 Bacteria 5031
177 Ga0207660_10397618 3300025917 Unclassified 1109
178 Ga0207649_10157867 3300025920 Bacteria 1569
179 Ga0207652_10029751 3300025921 Bacteria 4570
180 Ga0207681_10610199 3300025923 Bacteria 902
181 Ga0207694_10274754 3300025924 Bacteria 1383
182 Ga0207690_10146067 3300025932 Bacteria 1749
183 Ga0207706_10395358 3300025933 Bacteria 1199
184 Ga0207686_10964019 3300025934 Bacteria 691
185 Ga0207709_10095559 3300025935 Bacteria 1953
186 Ga0207709_10244449 3300025935 Bacteria 1307
187 Ga0207669_10286502 3300025937 Bacteria 1245
188 Ga0207679_10137131 3300025945 Bacteria 1972
189 Ga0207667_10266354 3300025949 Bacteria 1752
190 Ga0207651_10008612 3300025960 Bacteria 5521
191 Ga0207658_10026305 3300025986 Bacteria 4079
192 Ga0207658_10082503 3300025986 Bacteria 2469
193 Ga0207703_10256220 3300026035 Bacteria 1580
194 Ga0207703_10547259 3300026035 Unclassified 1091
195 Ga0207639_10100670 3300026041 Bacteria 2335
196 Ga0207678_10869770 3300026067 Bacteria 797
197 Ga0207702_10881390 3300026078 Unclassified 886
198 Ga0207641_10166307 3300026088 Bacteria 2009
199 Ga0207641_10318737 3300026088 Bacteria 1474
200 Ga0207648_11267775 3300026089 Bacteria 692
201 Ga0207676_10626357 3300026095 Bacteria 1036
202 Ga0207674_10072711 3300026116 Bacteria 3453
203 Ga0207683_10278149 3300026121 Bacteria 1529
204 Ga0207428_10027222 3300027907 Bacteria 4762
205 Ga0268265_10295487 3300028380 Bacteria 1456
206 Ga0268264_10046306 3300028381 Bacteria 3612
207 Ga0307515_10000292 3300028794 Bacteria 123160
208 Ga0307515_10008051 3300028794 Bacteria 20654
209 Ga0307512_10177607 3300030522 Bacteria 1204
210 Ga0316176_1174321 3300030732 Bacteria 2171
211 Ga0316181_1116699 3300030744 Bacteria 14877
212 Ga0307513_10000021 3300031456 Bacteria 228078
213 Ga0307513_10011472 3300031456 Bacteria 11012
214 Ga0307513_10196149 3300031456 Bacteria 1865
215 Ga0307509_10028152 3300031507 Bacteria 6249
216 Ga0307509_10057042 3300031507 Bacteria 4143
217 Ga0307408_100009496 3300031548 Bacteria 6417
218 Ga0307408_100245991 3300031548 Bacteria 1472
219 Ga0307508_10000248 3300031616 Bacteria 65511
220 Ga0307508_10083585 3300031616 Bacteria 2775
221 Ga0307514_10020138 3300031649 Bacteria 5448
222 Ga0307405_10135589 3300031731 Bacteria 1708
223 Ga0307405_10949304 3300031731 Bacteria 730
224 Ga0307413_10860341 3300031824 Bacteria 767
225 Ga0307406_10001484 3300031901 Bacteria 12954
226 Ga0307412_10235612 3300031911 Bacteria 1412
227 Ga0307412_10756097 3300031911 Bacteria 839
228 Ga0307412_10776639 3300031911 Bacteria 829
229 Ga0307412_11925615 3300031911 Bacteria 546
230 Ga0307416_100400384 3300032002 Bacteria 1410
231 Ga0307416_100531219 3300032002 Bacteria 1246
232 Ga0307414_10229259 3300032004 Bacteria 1530
233 Ga0307411_10132823 3300032005 Bacteria 1822
234 Ga0307411_10251062 3300032005 Bacteria 1391
235 Ga0307411_10840408 3300032005 Bacteria 811
236 Ga0307507_10027421 3300033179 Bacteria 6105
237 Ga0307507_10051930 3300033179 Bacteria 3939
238 Ga0373954_0532403 3300035118 Unclassified 582
239 Ga0373933_0475646 3300035724 Unclassified 818
240 Ga0395905_0328661 3300037471 Bacteria 1419
241 Ga0436360_1230336 3300039438 Unclassified 1605
242 Ga0439436_0000775 3300041404 Bacteria 8654
243 Ga0439438_035791 3300041405 Bacteria 1304
244 Ga0439439_0019442 3300041406 Bacteria 1686
245 Ga0439439_0036859 3300041406 Bacteria 1259
246 Ga0439447_006227 3300041407 Bacteria 3890
247 Ga0439447_012087 3300041407 Bacteria 2494
248 Ga0439461_0065961 3300041410 Bacteria 831
249 Ga0439466_0000919 3300041411 Bacteria 11259
250 Ga0439466_0207222 3300041411 Bacteria 596
251 Ga0439465_0001472 3300041413 Bacteria 7631
252 Ga0439431_0000651 3300041997 Bacteria 7389
253 Ga0439433_0000563 3300041999 Bacteria 7025
254 Ga0439433_0050000 3300041999 Bacteria 984
255 Ga0439442_041769 3300042002 Bacteria 964
256 Ga0439445_0000311 3300042004 Bacteria 9444
257 Ga0439432_000839 3300042006 Bacteria 11492
258 Ga0439432_005237 3300042006 Bacteria 4679
259 Ga0439449_0001169 3300042007 Bacteria 10300
260 Ga0439449_0064029 3300042007 Bacteria 1356
261 Ga0439452_002912 3300042010 Bacteria 6116
262 Ga0439454_023807 3300042011 Bacteria 921
263 Ga0439457_004677 3300042014 Bacteria 3538
264 Ga0439457_029481 3300042014 Bacteria 1216
265 Ga0439457_033738 3300042014 Bacteria 1137
266 Ga0439462_0000245 3300042015 Bacteria 9690
267 Ga0439462_0011228 3300042015 Bacteria 2278
268 Ga0450894_007545 3300042131 Bacteria 1404
269 Ga0450898_099218 3300042134 Bacteria 607
270 Ga0450906_028234 3300042145 Bacteria 994
271 Ga0439446_0000836 3300042156 Bacteria 6584
272 Ga0450909_030469 3300042185 Bacteria 818
273 Ga0439434_0009760 3300042435 Bacteria 2823
274 Ga0451577_0618858 3300042876 Bacteria 982
275 Ga0466968_0072494 3300044735 Bacteria 1501
276 Ga0495638_0039027 3300046460 Bacteria 3016
277 Ga0495651_0091230 3300046462 Unclassified 2284
278 Ga0495650_0001463 3300046471 Bacteria 22653
279 Ga0495610_0011354 3300046512 Bacteria 5454
280 Ga0495616_0010366 3300046513 Bacteria 5399
281 Ga0495631_0000135 3300046518 Bacteria 50021
282 Ga0495637_0038920 3300046520 Bacteria 2056
283 Ga0495643_0010218 3300046522 Bacteria 5784
284 Ga0495666_0172716 3300046526 Bacteria 999
285 Ga0495654_0120992 3300046530 Bacteria 1185
286 Ga0495625_0240646 3300046660 Bacteria 1178
287 Ga0495588_0502972 3300046674 Bacteria 635
288 Ga0495670_0635131 3300046691 Bacteria 582
289 Ga0495600_0418179 3300046809 Unclassified 832
290 Ga0495660_0115255 3300046810 Bacteria 1366
291 Ga0495677_0157699 3300047445 Bacteria 875
292 Ga0496101_0961721 3300048904 Bacteria 672
293 Ga0496102_0292016 3300048905 Bacteria 1537
294 Ga0496103_0434193 3300048906 Unclassified 843
295 Ga0496104_0476916 3300048907 Bacteria 1159
296 Ga0496105_0011105 3300048908 Bacteria 7103
297 Ga0496110_0310564 3300048913 Bacteria 1436
298 Ga0496111_0169942 3300048914 Bacteria 1620
299 Ga0496111_1000796 3300048914 Bacteria 599
300 Ga0496114_0325858 3300048917 Bacteria 1358
301 Ga0496114_0931278 3300048917 Unclassified 751
302 Ga0496115_0072116 3300048918 Bacteria 2802
303 Ga0496116_0010352 3300048919 Bacteria 7829
304 Ga0496117_0008683 3300048920 Bacteria 9605
305 Ga0496118_0025727 3300048921 Bacteria 5036
306 Ga0496119_0155824 3300048922 Bacteria 1219
307 Ga0496121_0085934 3300048924 Bacteria 2473
308 Ga0496121_0206419 3300048924 Bacteria 1395
309 Ga0496121_0300320 3300048924 Bacteria 1090
310 Ga0496122_0042043 3300048925 Bacteria 3602
311 Ga0496123_0062617 3300048926 Bacteria 2382
312 Ga0496124_0106586 3300048927 Bacteria 2263
313 Ga0496124_0630084 3300048927 Unclassified 692
314 Ga0496126_0509868 3300048929 Bacteria 960
315 Ga0501043_0001631 3300049579 Bacteria 19514
316 Ga0501046_0001796 3300049580 Bacteria 20471
317 Ga0501047_0000305 3300049581 Bacteria 56371
318 Ga0501048_0001348 3300049582 Bacteria 18627
319 Ga0501249_000841 3300049679 Bacteria 6799
320 Ga0501225_0012975 3300049705 Bacteria 2335
321 Ga0501083_0735910 3300049744 Bacteria 641
322 Ga0501262_000282 3300049759 Bacteria 6144
323 Ga0501045_0016684 3300049824 Bacteria 5216
324 nmdc:mga03683_111025_c1 3300050489 Bacteria 1212
325 nmdc:mga03683_119329_c1 3300050489 Bacteria 1172
326 nmdc:mga03683_131_c2 3300050489 Bacteria 14717
327 nmdc:mga03683_75350_c1 3300050489 Bacteria 1449
328 nmdc:mga0yw44_156522_c1 3300050492 Bacteria 1490
329 nmdc:mga0yw44_53165_c2 3300050492 Bacteria 1913
330 nmdc:mga0k408_242572_c1 3300050493 Bacteria 1076
331 nmdc:mga0k408_2988_c1 3300050493 Bacteria 8964
332 nmdc:mga07m45_1095_c1 3300050496 Bacteria 12086
333 nmdc:mga07m45_15187_c3 3300050496 Bacteria 2373
334 nmdc:mga06r32_636084_c1 3300050510 Bacteria 1036
335 nmdc:mga0sz30_1590_c1 3300050516 Bacteria 4772
336 nmdc:mga0sz30_208826_c1 3300050516 Bacteria 867
337 nmdc:mga0sz30_72673_c1 3300050516 Bacteria 1482
338 Ga0500644_0299187 3300053088 Bacteria 688
339 Ga0500566_0042673 3300053094 Bacteria 2616
340 Ga0500562_027671 3300053108 Bacteria 1488
341 Ga0500593_000233 3300053117 Bacteria 22924
342 Ga0500594_0008492 3300053118 Bacteria 2343
343 Ga0500626_015713 3300053128 Bacteria 3303
344 Ga0500628_094317 3300053129 Bacteria 784
345 Ga0500658_0000142 3300053134 Bacteria 34080
346 Ga0500559_0009713 3300053136 Bacteria 4152
347 Ga0500568_0000983 3300053139 Bacteria 19591
348 Ga0500574_003272 3300053141 Bacteria 2836
349 Ga0500616_0152193 3300053153 Bacteria 1069
350 Ga0500619_000062 3300053154 Bacteria 32808
351 Ga0500627_0032160 3300053158 Bacteria 2210
352 Ga0500645_018384 3300053730 Bacteria 2183
353 Ga0500645_037351 3300053730 Bacteria 1442
354 Ga0500661_004602 3300055283 Bacteria 2578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0509868 Ga0496126_0509868_17_448 143
2 3300003316 rootH1_10060511 rootH1_100605113 155
3 3300003758 Ga0055532_1007486 Ga0055532_10074862 155
4 3300003761 Ga0055535_1000241 Ga0055535_100024122 155
5 3300003762 Ga0055542_1000126 Ga0055542_100012661 155
6 3300025228 Ga0209672_100550 Ga0209672_1005503 155
7 3300025229 Ga0209147_100805 Ga0209147_1008052 155
8 3300025242 Ga0209258_100018 Ga0209258_100018104 155
9 3300025254 Ga0209148_1000030 Ga0209148_1000030104 155
10 3300002739 JGI25158J39367_1009665 JGI25158J39367_10096652 161
11 3300002773 JGI25152J39213_1000010 JGI25152J39213_100001023 161
12 3300002774 JGI25150J39212_1000054 JGI25150J39212_10000543 161
13 3300002987 JGI25159J45721_1000027 JGI25159J45721_1000027106 161
14 3300003187 JGI25151J46595_10000104 JGI25151J46595_100001043 161
15 3300003215 JGI25153J46596_10000076 JGI25153J46596_100000763 161
16 3300003354 JGI25160J50197_1000066 JGI25160J50197_10000663 161
17 3300003374 JGI25161J50226_1000191 JGI25161J50226_10001913 161
18 3300003771 Ga0055526_1000055 Ga0055526_10000553 161
19 3300003773 Ga0055537_1000023 Ga0055537_1000023106 161
20 3300003775 Ga0055524_1000092 Ga0055524_10000923 161
21 3300003784 Ga0055534_1000036 Ga0055534_10000363 161
22 3300003790 Ga0055528_1000038 Ga0055528_10000383 161
23 3300003792 Ga0055540_1004668 Ga0055540_10046682 161
24 3300003794 Ga0055531_10002400 Ga0055531_100024003 161
25 3300004625 Ga0055543_1000313 Ga0055543_100031328 161
26 3300005262 Ga0065165_1000165 Ga0065165_10001653 161
27 3300025245 Ga0207425_1000057 Ga0207425_100005727 161
28 3300025258 Ga0209129_1000030 Ga0209129_1000030312 161
29 3300025263 Ga0209565_1000019 Ga0209565_1000019384 161
30 3300025273 Ga0209673_1000155 Ga0209673_1000155110 161
31 3300025284 Ga0209130_1000011 Ga0209130_1000011376 161
32 3300025291 Ga0209675_1000031 Ga0209675_1000031234 161
33 3300025294 Ga0209025_1000078 Ga0209025_1000078232 161
34 3300025295 Ga0209564_1000056 Ga0209564_1000056299 161
35 3300025297 Ga0209758_1000037 Ga0209758_100003727 161
36 3300025299 Ga0209256_1000043 Ga0209256_1000043299 161
37 3300025302 Ga0207426_1000029 Ga0207426_100002927 161
38 3300025303 Ga0209051_1000804 Ga0209051_100080411 161
39 3300025304 Ga0209257_1000127 Ga0209257_1000127201 161
40 3300025208 Ga0209436_101351 Ga0209436_10135111 162
41 3300046674 Ga0495588_0502972 Ga0495588_0502972_18_515 165
42 3300046691 Ga0495670_0635131 Ga0495670_0635131_65_562 165
43 3300048922 Ga0496119_0155824 Ga0496119_0155824_631_1128 165
44 3300031456 Ga0307513_10196149 Ga0307513_101961492 167
45 3300031507 Ga0307509_10057042 Ga0307509_100570423 167
46 3300025923 Ga0207681_10610199 Ga0207681_106101992 168
47 3300025933 Ga0207706_10395358 Ga0207706_103953583 168
48 3300005336 Ga0070680_100539171 Ga0070680_1005391712 169
49 3300005441 Ga0070700_100296503 Ga0070700_1002965032 169
50 3300005458 Ga0070681_10060534 Ga0070681_100605344 169
51 3300005530 Ga0070679_100109842 Ga0070679_1001098422 169
52 3300005539 Ga0068853_100040084 Ga0068853_1000400842 169
53 3300005547 Ga0070693_100077746 Ga0070693_1000777462 169
54 3300005563 Ga0068855_100037880 Ga0068855_1000378807 169
55 3300005577 Ga0068857_100052641 Ga0068857_1000526412 169
56 3300005614 Ga0068856_100327219 Ga0068856_1003272192 169
57 3300006847 Ga0075431_100206017 Ga0075431_1002060172 169
58 3300009174 Ga0105241_10014355 Ga0105241_100143556 169
59 3300009545 Ga0105237_10022801 Ga0105237_100228015 169
60 3300010375 Ga0105239_10072398 Ga0105239_100723982 169
61 3300013297 Ga0157378_11659299 Ga0157378_116592992 169
62 3300013307 Ga0157372_10785621 Ga0157372_107856212 169
63 3300014969 Ga0157376_10390810 Ga0157376_103908102 169
64 3300025911 Ga0207654_10074080 Ga0207654_100740802 169
65 3300025912 Ga0207707_10368255 Ga0207707_103682551 169
66 3300025914 Ga0207671_10020497 Ga0207671_100204973 169
67 3300025917 Ga0207660_10397618 Ga0207660_103976182 169
68 3300025921 Ga0207652_10029751 Ga0207652_100297514 169
69 3300025924 Ga0207694_10274754 Ga0207694_102747541 169
70 3300025949 Ga0207667_10266354 Ga0207667_102663542 169
71 3300026041 Ga0207639_10100670 Ga0207639_101006702 169
72 3300026078 Ga0207702_10881390 Ga0207702_108813902 169
73 3300026116 Ga0207674_10072711 Ga0207674_100727112 169
74 3300035118 Ga0373954_0532403 Ga0373954_0532403_12_533 169
75 3300035724 Ga0373933_0475646 Ga0373933_0475646_171_692 169
76 3300048906 Ga0496103_0434193 Ga0496103_0434193_262_783 169
77 3300048917 Ga0496114_0931278 Ga0496114_0931278_90_611 169
78 3300050510 nmdc:mga06r32_636084_c1 nmdc:mga06r32_636084_c1_56_577 169
79 3300053117 Ga0500593_000233 Ga0500593_000233_4948_5469 169
80 3300053158 Ga0500627_0032160 Ga0500627_0032160_1575_2096 169
81 3300053730 Ga0500645_037351 Ga0500645_037351_186_707 169
82 iso_pu_bacteria 2511231002 2511244260 169
83 iso_pu_bacteria 2939631187 2939636847 169
84 3300039438 Ga0436360_1230336 Ga0436360_1230336_784_1305 170
85 iso_pu_bacteria 2847930680 2847932448 170
86 3300005468 Ga0070707_101678334 Ga0070707_1016783341 171
87 3300048918 Ga0496115_0072116 Ga0496115_0072116_973_1494 171
88 iso_pu_bacteria 2513020051 2513228981 171
89 iso_pu_bacteria 2599185214 2599621132 171
90 iso_pu_bacteria 2599185226 2599675150 171
91 iso_pu_bacteria 2599185227 2599678252 171
92 iso_pu_bacteria 2599185229 2599690643 171
93 iso_pu_bacteria 2818991446 2819600875 171
94 iso_pu_bacteria 2831265667 2831267495 171
95 iso_pu_bacteria 2838054893 2838056000 171
96 iso_pu_bacteria 2928037797 2928042954 171
97 iso_pu_bacteria 2928044640 2928050387 171
98 iso_pu_bacteria 2928084124 2928088308 171
99 iso_pu_bacteria 2954767861 2954768286 171
100 3300003763 Ga0055529_1001134 Ga0055529_10011342 172
101 3300005367 Ga0070667_100525649 Ga0070667_1005256492 172
102 3300005617 Ga0068859_100361203 Ga0068859_1003612032 172
103 3300005719 Ga0068861_100858071 Ga0068861_1008580712 172
104 3300005841 Ga0068863_100064124 Ga0068863_1000641244 172
105 3300005842 Ga0068858_100162594 Ga0068858_1001625942 172
106 3300005843 Ga0068860_100125140 Ga0068860_1001251402 172
107 3300006931 Ga0097620_100361195 Ga0097620_1003611952 172
108 3300014968 Ga0157379_10764238 Ga0157379_107642381 172
109 3300014969 Ga0157376_11101335 Ga0157376_111013352 172
110 3300025228 Ga0209672_106414 Ga0209672_1064142 172
111 3300025242 Ga0209258_109897 Ga0209258_1098972 172
112 3300025272 Ga0209455_1001484 Ga0209455_10014846 172
113 3300025935 Ga0207709_10095559 Ga0207709_100955592 172
114 3300026035 Ga0207703_10256220 Ga0207703_102562202 172
115 3300026067 Ga0207678_10869770 Ga0207678_108697702 172
116 3300026088 Ga0207641_10166307 Ga0207641_101663072 172
117 3300026088 Ga0207641_10318737 Ga0207641_103187372 172
118 3300028380 Ga0268265_10295487 Ga0268265_102954871 172
119 3300028381 Ga0268264_10046306 Ga0268264_100463062 172
120 3300031911 Ga0307412_11925615 Ga0307412_119256151 172
121 3300048907 Ga0496104_0476916 Ga0496104_0476916_68_592 172
122 3300048913 Ga0496110_0310564 Ga0496110_0310564_268_792 172
123 3300048914 Ga0496111_1000796 Ga0496111_1000796_16_540 172
124 iso_pu_bacteria 2855767633 2855769316 172
125 iso_pu_bacteria 2881412998 2881414788 172
126 iso_pu_bacteria 2904449895 2904455831 172
127 3300003791 Ga0055530_10001927 Ga0055530_100019275 173
128 3300003792 Ga0055540_1000149 Ga0055540_100014911 173
129 3300003794 Ga0055531_10035138 Ga0055531_100351382 173
130 3300005262 Ga0065165_1004962 Ga0065165_10049625 173
131 3300005367 Ga0070667_100022884 Ga0070667_1000228842 173
132 3300005367 Ga0070667_100043574 Ga0070667_1000435744 173
133 3300005439 Ga0070711_100276173 Ga0070711_1002761731 173
134 3300005445 Ga0070708_100247620 Ga0070708_1002476202 173
135 3300009176 Ga0105242_10223678 Ga0105242_102236782 173
136 3300009177 Ga0105248_10544520 Ga0105248_105445202 173
137 3300013308 Ga0157375_10284876 Ga0157375_102848762 173
138 3300014325 Ga0163163_10058325 Ga0163163_100583252 173
139 3300014969 Ga0157376_10257888 Ga0157376_102578883 173
140 3300025298 Ga0209050_1000537 Ga0209050_100053749 173
141 3300025303 Ga0209051_1000345 Ga0209051_100034512 173
142 3300025304 Ga0209257_1002834 Ga0209257_100283412 173
143 3300025986 Ga0207658_10026305 Ga0207658_100263052 173
144 3300025986 Ga0207658_10082503 Ga0207658_100825032 173
145 3300026095 Ga0207676_10626357 Ga0207676_106263572 173
146 3300028794 Ga0307515_10000292 Ga0307515_1000029274 173
147 3300031456 Ga0307513_10000021 Ga0307513_1000002137 173
148 3300044735 Ga0466968_0072494 Ga0466968_0072494_326_847 173
149 iso_pu_bacteria 2904456579 2904461521 173
150 iso_pu_bacteria 2941531003 2941537449 173
151 3300003215 JGI25153J46596_10000151 JGI25153J46596_1000015118 174
152 3300025297 Ga0209758_1000120 Ga0209758_1000120130 174
153 3300053088 Ga0500644_0299187 Ga0500644_0299187_94_633 174
154 3300053094 Ga0500566_0042673 Ga0500566_0042673_436_975 174
155 3300053129 Ga0500628_094317 Ga0500628_094317_216_755 174
156 3300053730 Ga0500645_018384 Ga0500645_018384_268_807 174
157 3300055283 Ga0500661_004602 Ga0500661_004602_1701_2240 174
158 3300002773 JGI25152J39213_1001576 JGI25152J39213_10015767 175
159 3300003320 rootH2_10167896 rootH2_101678962 175
160 3300003322 rootL2_10216486 rootL2_102164862 175
161 3300003323 rootH1_10001859 rootH1_100018599 175
162 3300003354 JGI25160J50197_1006915 JGI25160J50197_10069155 175
163 3300003773 Ga0055537_1008718 Ga0055537_10087182 175
164 3300003775 Ga0055524_1004353 Ga0055524_10043533 175
165 3300003781 Ga0055536_1002200 Ga0055536_100220010 175
166 3300003781 Ga0055536_1002840 Ga0055536_10028407 175
167 3300003784 Ga0055534_1002641 Ga0055534_10026416 175
168 3300003790 Ga0055528_1002270 Ga0055528_10022707 175
169 3300003791 Ga0055530_10000967 Ga0055530_1000096714 175
170 3300003791 Ga0055530_10005776 Ga0055530_100057763 175
171 3300003792 Ga0055540_1000275 Ga0055540_10002753 175
172 3300003792 Ga0055540_1004407 Ga0055540_10044073 175
173 3300003794 Ga0055531_10000062 Ga0055531_1000006275 175
174 3300003794 Ga0055531_10006836 Ga0055531_100068367 175
175 3300004625 Ga0055543_1004163 Ga0055543_10041634 175
176 3300005262 Ga0065165_1016203 Ga0065165_10162032 175
177 3300005339 Ga0070660_100103841 Ga0070660_1001038411 175
178 3300005344 Ga0070661_100066573 Ga0070661_1000665733 175
179 3300005356 Ga0070674_100606990 Ga0070674_1006069902 175
180 3300005364 Ga0070673_100003994 Ga0070673_1000039946 175
181 3300005366 Ga0070659_100572171 Ga0070659_1005721712 175
182 3300005456 Ga0070678_100334592 Ga0070678_1003345922 175
183 3300005466 Ga0070685_10493627 Ga0070685_104936271 175
184 3300005543 Ga0070672_100222629 Ga0070672_1002226291 175
185 3300005564 Ga0070664_100161760 Ga0070664_1001617603 175
186 3300005842 Ga0068858_100511170 Ga0068858_1005111702 175
187 3300006048 Ga0075363_100372631 Ga0075363_1003726312 175
188 3300006177 Ga0075362_10043496 Ga0075362_100434962 175
189 3300006195 Ga0075366_10001531 Ga0075366_100015316 175
190 3300006195 Ga0075366_10255370 Ga0075366_102553701 175
191 3300006195 Ga0075366_10287567 Ga0075366_102875672 175
192 3300006353 Ga0075370_10030258 Ga0075370_100302582 175
193 3300006881 Ga0068865_101135636 Ga0068865_1011356361 175
194 3300009036 Ga0105244_10013636 Ga0105244_100136363 175
195 3300009148 Ga0105243_10343479 Ga0105243_103434792 175
196 3300009551 Ga0105238_12136927 Ga0105238_121369271 175
197 3300011119 Ga0105246_10774990 Ga0105246_107749902 175
198 3300013308 Ga0157375_10766775 Ga0157375_107667752 175
199 3300014497 Ga0182008_10088401 Ga0182008_100884012 175
200 3300017792 Ga0163161_10043479 Ga0163161_100434793 175
201 3300017792 Ga0163161_10128083 Ga0163161_101280832 175
202 3300025263 Ga0209565_1001499 Ga0209565_10014998 175
203 3300025273 Ga0209673_1000648 Ga0209673_100064840 175
204 3300025284 Ga0209130_1001838 Ga0209130_10018385 175
205 3300025291 Ga0209675_1002192 Ga0209675_10021929 175
206 3300025292 Ga0209676_1000004 Ga0209676_100000411 175
207 3300025292 Ga0209676_1000627 Ga0209676_10006273 175
208 3300025295 Ga0209564_1000319 Ga0209564_100031911 175
209 3300025298 Ga0209050_1000002 Ga0209050_1000002521 175
210 3300025298 Ga0209050_1000100 Ga0209050_1000100185 175
211 3300025299 Ga0209256_1000166 Ga0209256_1000166112 175
212 3300025302 Ga0207426_1000469 Ga0207426_100046911 175
213 3300025303 Ga0209051_1000002 Ga0209051_1000002289 175
214 3300025303 Ga0209051_1000067 Ga0209051_100006742 175
215 3300025304 Ga0209257_1000002 Ga0209257_1000002430 175
216 3300025304 Ga0209257_1000095 Ga0209257_1000095199 175
217 3300025728 Ga0207655_1019123 Ga0207655_10191233 175
218 3300025920 Ga0207649_10157867 Ga0207649_101578672 175
219 3300025932 Ga0207690_10146067 Ga0207690_101460672 175
220 3300025934 Ga0207686_10964019 Ga0207686_109640192 175
221 3300025935 Ga0207709_10244449 Ga0207709_102444493 175
222 3300025937 Ga0207669_10286502 Ga0207669_102865022 175
223 3300025945 Ga0207679_10137131 Ga0207679_101371312 175
224 3300025960 Ga0207651_10008612 Ga0207651_100086123 175
225 3300026035 Ga0207703_10547259 Ga0207703_105472592 175
226 3300026121 Ga0207683_10278149 Ga0207683_102781492 175
227 3300028794 Ga0307515_10008051 Ga0307515_1000805111 175
228 3300031456 Ga0307513_10011472 Ga0307513_1001147211 175
229 3300031548 Ga0307408_100245991 Ga0307408_1002459912 175
230 3300031616 Ga0307508_10000248 Ga0307508_1000024843 175
231 3300031649 Ga0307514_10020138 Ga0307514_100201383 175
232 3300031731 Ga0307405_10949304 Ga0307405_109493042 175
233 3300031824 Ga0307413_10860341 Ga0307413_108603412 175
234 3300031911 Ga0307412_10756097 Ga0307412_107560972 175
235 3300032002 Ga0307416_100531219 Ga0307416_1005312192 175
236 3300032005 Ga0307411_10251062 Ga0307411_102510623 175
237 3300033179 Ga0307507_10027421 Ga0307507_100274213 175
238 3300041404 Ga0439436_0000775 Ga0439436_0000775_4433_4960 175
239 3300041405 Ga0439438_035791 Ga0439438_035791_208_735 175
240 3300041406 Ga0439439_0019442 Ga0439439_0019442_828_1355 175
241 3300041406 Ga0439439_0036859 Ga0439439_0036859_86_613 175
242 3300041407 Ga0439447_006227 Ga0439447_006227_3222_3749 175
243 3300041407 Ga0439447_012087 Ga0439447_012087_953_1480 175
244 3300041410 Ga0439461_0065961 Ga0439461_0065961_76_603 175
245 3300041411 Ga0439466_0207222 Ga0439466_0207222_26_553 175
246 3300041413 Ga0439465_0001472 Ga0439465_0001472_5286_5813 175
247 3300041997 Ga0439431_0000651 Ga0439431_0000651_1932_2459 175
248 3300041999 Ga0439433_0000563 Ga0439433_0000563_1257_1784 175
249 3300041999 Ga0439433_0050000 Ga0439433_0050000_17_544 175
250 3300042002 Ga0439442_041769 Ga0439442_041769_396_923 175
251 3300042004 Ga0439445_0000311 Ga0439445_0000311_82_609 175
252 3300042006 Ga0439432_000839 Ga0439432_000839_6670_7197 175
253 3300042006 Ga0439432_005237 Ga0439432_005237_3820_4347 175
254 3300042007 Ga0439449_0001169 Ga0439449_0001169_3758_4285 175
255 3300042011 Ga0439454_023807 Ga0439454_023807_305_832 175
256 3300042014 Ga0439457_004677 Ga0439457_004677_152_679 175
257 3300042014 Ga0439457_029481 Ga0439457_029481_174_701 175
258 3300042015 Ga0439462_0000245 Ga0439462_0000245_3377_3904 175
259 3300042015 Ga0439462_0011228 Ga0439462_0011228_1509_2036 175
260 3300042131 Ga0450894_007545 Ga0450894_007545_177_704 175
261 3300042134 Ga0450898_099218 Ga0450898_099218_27_554 175
262 3300042185 Ga0450909_030469 Ga0450909_030469_158_685 175
263 3300042876 Ga0451577_0618858 Ga0451577_0618858_75_602 175
264 3300046460 Ga0495638_0039027 Ga0495638_0039027_881_1408 175
265 3300046512 Ga0495610_0011354 Ga0495610_0011354_4235_4762 175
266 3300046513 Ga0495616_0010366 Ga0495616_0010366_4626_5153 175
267 3300046518 Ga0495631_0000135 Ga0495631_0000135_40906_41433 175
268 3300046520 Ga0495637_0038920 Ga0495637_0038920_565_1092 175
269 3300046522 Ga0495643_0010218 Ga0495643_0010218_3734_4261 175
270 3300046530 Ga0495654_0120992 Ga0495654_0120992_314_841 175
271 3300046660 Ga0495625_0240646 Ga0495625_0240646_129_656 175
272 3300046810 Ga0495660_0115255 Ga0495660_0115255_446_973 175
273 3300047445 Ga0495677_0157699 Ga0495677_0157699_200_727 175
274 3300048904 Ga0496101_0961721 Ga0496101_0961721_54_581 175
275 3300048905 Ga0496102_0292016 Ga0496102_0292016_112_639 175
276 3300048908 Ga0496105_0011105 Ga0496105_0011105_3532_4059 175
277 3300048914 Ga0496111_0169942 Ga0496111_0169942_361_888 175
278 3300048917 Ga0496114_0325858 Ga0496114_0325858_694_1221 175
279 3300048919 Ga0496116_0010352 Ga0496116_0010352_7270_7797 175
280 3300048920 Ga0496117_0008683 Ga0496117_0008683_1114_1641 175
281 3300048921 Ga0496118_0025727 Ga0496118_0025727_2875_3402 175
282 3300048924 Ga0496121_0085934 Ga0496121_0085934_1468_1995 175
283 3300048924 Ga0496121_0206419 Ga0496121_0206419_604_1131 175
284 3300048924 Ga0496121_0300320 Ga0496121_0300320_142_669 175
285 3300048925 Ga0496122_0042043 Ga0496122_0042043_560_1087 175
286 3300048926 Ga0496123_0062617 Ga0496123_0062617_373_900 175
287 3300050489 nmdc:mga03683_111025_c1 nmdc:mga03683_111025_c1_91_618 175
288 3300050489 nmdc:mga03683_75350_c1 nmdc:mga03683_75350_c1_54_581 175
289 3300050493 nmdc:mga0k408_242572_c1 nmdc:mga0k408_242572_c1_96_623 175
290 3300050493 nmdc:mga0k408_2988_c1 nmdc:mga0k408_2988_c1_906_1433 175
291 3300050496 nmdc:mga07m45_1095_c1 nmdc:mga07m45_1095_c1_2870_3397 175
292 3300053108 Ga0500562_027671 Ga0500562_027671_162_689 175
293 3300053118 Ga0500594_0008492 Ga0500594_0008492_644_1171 175
294 3300053128 Ga0500626_015713 Ga0500626_015713_1371_1898 175
295 3300053134 Ga0500658_0000142 Ga0500658_0000142_14048_14575 175
296 3300053136 Ga0500559_0009713 Ga0500559_0009713_1953_2480 175
297 3300053139 Ga0500568_0000983 Ga0500568_0000983_5495_6022 175
298 3300053141 Ga0500574_003272 Ga0500574_003272_652_1179 175
299 3300053153 Ga0500616_0152193 Ga0500616_0152193_83_610 175
300 3300053154 Ga0500619_000062 Ga0500619_000062_17895_18422 175
301 iso_pu_bacteria 2929520902 2929522983 175
302 3300003771 Ga0055526_1007258 Ga0055526_10072582 176
303 3300003792 Ga0055540_1003439 Ga0055540_10034396 176
304 3300006353 Ga0075370_10084914 Ga0075370_100849142 176
305 3300012505 Ga0157339_1003620 Ga0157339_10036202 176
306 3300013104 Ga0157370_10703603 Ga0157370_107036032 176
307 3300025208 Ga0209436_110591 Ga0209436_1105912 176
308 3300025901 Ga0207688_10156116 Ga0207688_101561162 176
309 3300026089 Ga0207648_11267775 Ga0207648_112677752 176
310 3300041411 Ga0439466_0000919 Ga0439466_0000919_5500_6030 176
311 3300042007 Ga0439449_0064029 Ga0439449_0064029_25_555 176
312 3300042010 Ga0439452_002912 Ga0439452_002912_4900_5430 176
313 3300042156 Ga0439446_0000836 Ga0439446_0000836_2374_2904 176
314 3300042435 Ga0439434_0009760 Ga0439434_0009760_1444_1974 176
315 3300046462 Ga0495651_0091230 Ga0495651_0091230_767_1297 176
316 3300046471 Ga0495650_0001463 Ga0495650_0001463_22014_22544 176
317 3300046809 Ga0495600_0418179 Ga0495600_0418179_34_564 176
318 3300048927 Ga0496124_0106586 Ga0496124_0106586_257_790 176
319 3300048927 Ga0496124_0630084 Ga0496124_0630084_99_629 176
320 3300049579 Ga0501043_0001631 Ga0501043_0001631_15487_16017 176
321 3300049582 Ga0501048_0001348 Ga0501048_0001348_14770_15300 176
322 3300049679 Ga0501249_000841 Ga0501249_000841_3953_4483 176
323 3300049705 Ga0501225_0012975 Ga0501225_0012975_227_757 176
324 3300049759 Ga0501262_000282 Ga0501262_000282_4093_4623 176
325 3300050516 nmdc:mga0sz30_72673_c1 nmdc:mga0sz30_72673_c1_608_1138 176
326 2162886007 SwRhRL2b_contig_2300504 SwRhRL2b_0678.00002700 177
327 3300003578 Ga0006562J51391_1133628 Ga0006562J51391_11336283 177
328 3300003578 Ga0006562J51391_1133629 Ga0006562J51391_11336293 177
329 3300005289 Ga0065704_10157361 Ga0065704_101573612 177
330 3300006038 Ga0075365_10047269 Ga0075365_100472692 177
331 3300006038 Ga0075365_10355273 Ga0075365_103552732 177
332 3300006048 Ga0075363_100000734 Ga0075363_10000073411 177
333 3300006051 Ga0075364_10036085 Ga0075364_100360852 177
334 3300006058 Ga0075432_10003405 Ga0075432_100034052 177
335 3300006177 Ga0075362_10000286 Ga0075362_1000028610 177
336 3300006177 Ga0075362_10065727 Ga0075362_100657272 177
337 3300006178 Ga0075367_10199558 Ga0075367_101995582 177
338 3300006186 Ga0075369_10013577 Ga0075369_100135772 177
339 3300006186 Ga0075369_10187590 Ga0075369_101875902 177
340 3300006195 Ga0075366_10005069 Ga0075366_100050695 177
341 3300006353 Ga0075370_10007230 Ga0075370_100072304 177
342 3300013100 Ga0157373_10333389 Ga0157373_103333892 177
343 3300015261 Ga0182006_1012230 Ga0182006_10122303 177
344 3300025303 Ga0209051_1000302 Ga0209051_10003025 177
345 3300027907 Ga0207428_10027222 Ga0207428_100272225 177
346 3300030522 Ga0307512_10177607 Ga0307512_101776071 177
347 3300030732 Ga0316176_1174321 Ga0316176_11743213 177
348 3300030744 Ga0316181_1116699 Ga0316181_111669914 177
349 3300031507 Ga0307509_10028152 Ga0307509_100281523 177
350 3300031548 Ga0307408_100009496 Ga0307408_1000094966 177
351 3300031616 Ga0307508_10083585 Ga0307508_100835852 177
352 3300031731 Ga0307405_10135589 Ga0307405_101355893 177
353 3300031901 Ga0307406_10001484 Ga0307406_100014846 177
354 3300031911 Ga0307412_10235612 Ga0307412_102356122 177
355 3300031911 Ga0307412_10776639 Ga0307412_107766392 177
356 3300032002 Ga0307416_100400384 Ga0307416_1004003842 177
357 3300032004 Ga0307414_10229259 Ga0307414_102292592 177
358 3300032005 Ga0307411_10132823 Ga0307411_101328232 177
359 3300032005 Ga0307411_10840408 Ga0307411_108404082 177
360 3300033179 Ga0307507_10051930 Ga0307507_100519305 177
361 3300037471 Ga0395905_0328661 Ga0395905_0328661_93_632 177
362 3300042014 Ga0439457_033738 Ga0439457_033738_182_715 177
363 3300042145 Ga0450906_028234 Ga0450906_028234_293_826 177
364 3300046526 Ga0495666_0172716 Ga0495666_0172716_76_612 177
365 3300049580 Ga0501046_0001796 Ga0501046_0001796_3498_4070 177
366 3300049581 Ga0501047_0000305 Ga0501047_0000305_36026_36598 177
367 3300049744 Ga0501083_0735910 Ga0501083_0735910_42_614 177
368 3300049824 Ga0501045_0016684 Ga0501045_0016684_1031_1603 177
369 3300050489 nmdc:mga03683_119329_c1 nmdc:mga03683_119329_c1_46_579 177
370 3300050489 nmdc:mga03683_131_c2 nmdc:mga03683_131_c2_4060_4593 177
371 3300050492 nmdc:mga0yw44_156522_c1 nmdc:mga0yw44_156522_c1_725_1258 177
372 3300050492 nmdc:mga0yw44_53165_c2 nmdc:mga0yw44_53165_c2_559_1092 177
373 3300050496 nmdc:mga07m45_15187_c3 nmdc:mga07m45_15187_c3_1017_1559 177
374 3300050516 nmdc:mga0sz30_1590_c1 nmdc:mga0sz30_1590_c1_1932_2465 177
375 3300050516 nmdc:mga0sz30_208826_c1 nmdc:mga0sz30_208826_c1_232_765 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

58

142

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9165 45 172
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9127 43 177
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9085 44 173
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8777 45 172
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.8434 7 173
ID Description Score Start End Superfamily
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9326 38 173 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9117 43 173 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9114 52 175 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.901 51 173 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8882 43 172 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A1Y1J3J2-F1-model_v4 deleted 0.9875 56 177
AF-A0A315C5U5-F1-model_v4 Carboxymuconolactone decarboxylase 0.9854 9 177 GO:0051920
AF-A0A315C5U5-F1-model_v4 Carboxymuconolactone decarboxylase 0.974 9 177 GO:0051920
AF-Q3BT70-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9735 41 173 GO:0051920
AF-A0A1Y1J3J2-F1-model_v4 deleted 0.9718 56 177

Feature Viewer

pLDDT pTM Quality
94.9 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map