F426952

General Info

Members Datasets Scaffolds Average Seq Length
375 249 750 130

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100179266|Ga0070673_1001792662
Length 149
Sequence MEPASRRSDEVLLPQAGDTSAVDRLLVSSGSPYEPTIGFSRAVRDGRHVFVAGTCAVMPEGGAPPPDAYRQAKRCLEIIVAALAEAGAAPEHVVRTRTFLLEAGDWEEVGRAHGEVFREVRPASTMIVVSALLDPRWLVEIEADALLPE

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
95 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
168 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 10.13
Rhizosphere 88.27
Stem 0
Stem Tuber 0
Unclassified 17.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100179266 3300005364 Bacteria 1813
2 JGI24751J29686_10119892 3300002459 Bacteria 553
3 Ga0065712_10269927 3300005290 Unclassified 918
4 Ga0065715_10610493 3300005293 Unclassified 702
5 Ga0070683_100661838 3300005329 Bacteria 1000
6 Ga0070670_100070076 3300005331 Bacteria 3010
7 Ga0070670_100262605 3300005331 Bacteria 1505
8 Ga0068869_100405074 3300005334 Bacteria 1123
9 Ga0070666_10964468 3300005335 Unclassified 632
10 Ga0070680_100774019 3300005336 Bacteria 827
11 Ga0070682_100685793 3300005337 Bacteria 820
12 Ga0068868_100010300 3300005338 Bacteria 6762
13 Ga0070660_100011217 3300005339 Bacteria 6361
14 Ga0070689_100020905 3300005340 Bacteria 4864
15 Ga0070687_100015627 3300005343 Bacteria 3438
16 Ga0070692_10032523 3300005345 Bacteria 2623
17 Ga0070669_100960117 3300005353 Unclassified 732
18 Ga0070669_101455677 3300005353 Bacteria 595
19 Ga0070675_100278343 3300005354 Bacteria 1470
20 Ga0070675_100860434 3300005354 Unclassified 830
21 Ga0070674_100048944 3300005356 Bacteria 2903
22 Ga0070673_100038161 3300005364 Unclassified 3667
23 Ga0070688_100003349 3300005365 Bacteria 8215
24 Ga0070659_100054472 3300005366 Bacteria 3150
25 Ga0070667_101729203 3300005367 Unclassified 588
26 Ga0070703_10018084 3300005406 Bacteria 2034
27 Ga0070709_10023306 3300005434 Bacteria 3632
28 Ga0070713_100721927 3300005436 Bacteria 952
29 Ga0070710_10003539 3300005437 Bacteria 7401
30 Ga0070701_10075282 3300005438 Bacteria 1815
31 Ga0070711_100559680 3300005439 Unclassified 949
32 Ga0070705_100043218 3300005440 Bacteria 2581
33 Ga0070705_100128893 3300005440 Bacteria 1647
34 Ga0070705_100800899 3300005440 Bacteria 750
35 Ga0070700_100023901 3300005441 Bacteria 3580
36 Ga0070694_100405631 3300005444 Bacteria 1068
37 Ga0070708_100001249 3300005445 Bacteria 19527
38 Ga0070708_100170597 3300005445 Unclassified 2031
39 Ga0070708_100186115 3300005445 Bacteria 1942
40 Ga0070708_100425017 3300005445 Bacteria 1253
41 Ga0070663_100037970 3300005455 Bacteria 3356
42 Ga0070678_100003649 3300005456 Bacteria 8593
43 Ga0070681_10024061 3300005458 Bacteria 6132
44 Ga0070681_10743831 3300005458 Unclassified 897
45 Ga0068867_100723502 3300005459 Bacteria 880
46 Ga0068867_101464743 3300005459 Unclassified 635
47 Ga0070685_10020072 3300005466 Bacteria 3614
48 Ga0070706_100000875 3300005467 Bacteria 33070
49 Ga0070706_100001143 3300005467 Bacteria 28603
50 Ga0070706_100018291 3300005467 Bacteria 6466
51 Ga0070706_100124519 3300005467 Bacteria 2403
52 Ga0070706_100422810 3300005467 Bacteria 1240
53 Ga0070707_100021083 3300005468 Bacteria 6155
54 Ga0070698_100040584 3300005471 Bacteria 4782
55 Ga0070699_100033321 3300005518 Bacteria 4450
56 Ga0070699_100272793 3300005518 Bacteria 1514
57 Ga0070699_100598647 3300005518 Bacteria 1005
58 Ga0070697_100000901 3300005536 Bacteria 22370
59 Ga0070697_100220627 3300005536 Bacteria 1616
60 Ga0068853_100007723 3300005539 Bacteria 8623
61 Ga0070672_100017154 3300005543 Bacteria 5206
62 Ga0070672_100958149 3300005543 Unclassified 757
63 Ga0070695_100032834 3300005545 Bacteria 3245
64 Ga0070695_100238650 3300005545 Bacteria 1318
65 Ga0070696_100017446 3300005546 Bacteria 4845
66 Ga0070665_100001706 3300005548 Bacteria 25241
67 Ga0070665_100186027 3300005548 Bacteria 2078
68 Ga0070704_100016009 3300005549 Bacteria 4727
69 Ga0070704_100371496 3300005549 Bacteria 1213
70 Ga0070704_102156684 3300005549 Bacteria 518
71 Ga0068855_100382555 3300005563 Bacteria 1545
72 Ga0070664_100067911 3300005564 Bacteria 3047
73 Ga0070664_100661535 3300005564 Bacteria 971
74 Ga0068857_100590109 3300005577 Bacteria 1049
75 Ga0068854_100538833 3300005578 Bacteria 988
76 Ga0068856_100115283 3300005614 Bacteria 2686
77 Ga0070702_100020752 3300005615 Bacteria 3446
78 Ga0068859_100604054 3300005617 Unclassified 1190
79 Ga0068866_10066642 3300005718 Unclassified 1887
80 Ga0068866_10213885 3300005718 Bacteria 1159
81 Ga0068870_10003808 3300005840 Bacteria 6423
82 Ga0068863_100018126 3300005841 Bacteria 6741
83 Ga0068862_101181310 3300005844 Bacteria 763
84 Ga0081455_10056513 3300005937 Bacteria 3331
85 Ga0070717_10379583 3300006028 Bacteria 1267
86 Ga0070717_11087036 3300006028 Unclassified 728
87 Ga0075365_10367896 3300006038 Bacteria 1014
88 Ga0075432_10231010 3300006058 Bacteria 743
89 Ga0070712_100023536 3300006175 Bacteria 4070
90 Ga0070712_100273665 3300006175 Unclassified 1358
91 Ga0070712_100514504 3300006175 Bacteria 1005
92 Ga0070712_101123395 3300006175 Bacteria 682
93 Ga0068871_100032898 3300006358 Bacteria 4100
94 Ga0075428_100132650 3300006844 Bacteria 2709
95 Ga0075430_100062710 3300006846 Bacteria 3121
96 Ga0075430_101403475 3300006846 Bacteria 574
97 Ga0075431_100045602 3300006847 Unclassified 4520
98 Ga0075433_11015893 3300006852 Bacteria 722
99 Ga0075434_100000462 3300006871 Bacteria 30392
100 Ga0075429_101087419 3300006880 Unclassified 698
101 Ga0068865_100034382 3300006881 Bacteria 3400
102 Ga0097620_100604024 3300006931 Unclassified 1190
103 Ga0111539_10161997 3300009094 Bacteria 2616
104 Ga0105245_10016804 3300009098 Bacteria 6389
105 Ga0105245_10132556 3300009098 Bacteria 2339
106 Ga0105245_10494864 3300009098 Bacteria 1238
107 Ga0114129_10149141 3300009147 Bacteria 3201
108 Ga0114129_10177569 3300009147 Unclassified 2900
109 Ga0114129_10532398 3300009147 Bacteria 1530
110 Ga0114129_10686149 3300009147 Bacteria 1318
111 Ga0114129_11089504 3300009147 Bacteria 1001
112 Ga0105241_10097372 3300009174 Bacteria 2332
113 Ga0105242_10208772 3300009176 Bacteria 1739
114 Ga0105242_10455180 3300009176 Unclassified 1207
115 Ga0105248_10018487 3300009177 Bacteria 7703
116 Ga0105248_10204743 3300009177 Bacteria 2224
117 Ga0105237_10195799 3300009545 Bacteria 2021
118 Ga0105249_10077196 3300009553 Bacteria 3088
119 Ga0105249_12523065 3300009553 Unclassified 586
120 Ga0099796_10099383 3300010159 Bacteria 1093
121 Ga0105239_10053603 3300010375 Bacteria 4424
122 Ga0105246_10176221 3300011119 Bacteria 1642
123 Ga0105246_11229725 3300011119 Unclassified 691
124 Ga0157371_11130850 3300013102 Unclassified 601
125 Ga0157374_10003998 3300013296 Bacteria 12390
126 Ga0157378_10055043 3300013297 Bacteria 3543
127 Ga0157378_11228555 3300013297 Bacteria 789
128 Ga0163162_10001552 3300013306 Bacteria 21472
129 Ga0163162_12093188 3300013306 Unclassified 649
130 Ga0157372_12497854 3300013307 Unclassified 593
131 Ga0157375_10063195 3300013308 Bacteria 3682
132 Ga0157375_11511126 3300013308 Bacteria 793
133 Ga0157380_10163745 3300014326 Bacteria 1936
134 Ga0157377_10007678 3300014745 Bacteria 5225
135 Ga0157376_10027466 3300014969 Bacteria 4512
136 Ga0163161_11008074 3300017792 Unclassified 711
137 Ga0224569_100071 3300022732 Bacteria 6586
138 Ga0224571_100635 3300022734 Unclassified 2010
139 Ga0224571_102066 3300022734 Unclassified 1272
140 Ga0224572_1000180 3300024225 Bacteria 5845
141 Ga0228598_1000080 3300024227 Bacteria 14893
142 Ga0228598_1001559 3300024227 Bacteria 5021
143 Ga0207653_10017780 3300025885 Bacteria 2239
144 Ga0207653_10175324 3300025885 Unclassified 800
145 Ga0207692_10031031 3300025898 Bacteria 2555
146 Ga0207642_10007029 3300025899 Bacteria 3776
147 Ga0207647_10233511 3300025904 Bacteria 1058
148 Ga0207685_10007963 3300025905 Bacteria 2989
149 Ga0207699_10021084 3300025906 Bacteria 3505
150 Ga0207643_10001386 3300025908 Bacteria 13904
151 Ga0207684_10000509 3300025910 Bacteria 48380
152 Ga0207684_10001711 3300025910 Bacteria 23277
153 Ga0207684_10362025 3300025910 Bacteria 1248
154 Ga0207654_10102892 3300025911 Bacteria 1763
155 Ga0207707_10072611 3300025912 Bacteria 3000
156 Ga0207693_10007043 3300025915 Bacteria 9281
157 Ga0207663_10338133 3300025916 Bacteria 1136
158 Ga0207662_10058434 3300025918 Bacteria 2309
159 Ga0207657_10018031 3300025919 Bacteria 6753
160 Ga0207646_10845372 3300025922 Unclassified 814
161 Ga0207681_10538491 3300025923 Unclassified 960
162 Ga0207650_10091128 3300025925 Bacteria 2329
163 Ga0207650_10202379 3300025925 Bacteria 1591
164 Ga0207687_10195304 3300025927 Unclassified 1578
165 Ga0207687_11003403 3300025927 Bacteria 716
166 Ga0207700_10609471 3300025928 Bacteria 972
167 Ga0207700_11344185 3300025928 Bacteria 636
168 Ga0207686_10294695 3300025934 Unclassified 1203
169 Ga0207686_10421755 3300025934 Bacteria 1021
170 Ga0207709_10033606 3300025935 Bacteria 3014
171 Ga0207709_10673363 3300025935 Unclassified 826
172 Ga0207670_10728943 3300025936 Bacteria 822
173 Ga0207669_10089124 3300025937 Bacteria 2002
174 Ga0207704_10101840 3300025938 Bacteria 1916
175 Ga0207704_11068564 3300025938 Bacteria 685
176 Ga0207691_10020501 3300025940 Bacteria 6250
177 Ga0207711_10049857 3300025941 Bacteria 3584
178 Ga0207711_10096354 3300025941 Bacteria 2611
179 Ga0207689_10800163 3300025942 Bacteria 796
180 Ga0207679_10401190 3300025945 Bacteria 1206
181 Ga0207679_10572933 3300025945 Bacteria 1015
182 Ga0207651_10103728 3300025960 Bacteria 2117
183 Ga0207651_10377265 3300025960 Bacteria 1201
184 Ga0207640_10159800 3300025981 Bacteria 1666
185 Ga0207640_10323570 3300025981 Bacteria 1229
186 Ga0207658_10072084 3300025986 Unclassified 2618
187 Ga0207677_10047904 3300026023 Bacteria 2873
188 Ga0207639_10034318 3300026041 Bacteria 3749
189 Ga0207708_10005409 3300026075 Bacteria 9408
190 Ga0207708_10084886 3300026075 Bacteria 2435
191 Ga0207702_10035047 3300026078 Bacteria 4196
192 Ga0207702_11016493 3300026078 Bacteria 822
193 Ga0207641_11812717 3300026088 Unclassified 612
194 Ga0207648_10000097 3300026089 Bacteria 83554
195 Ga0207676_10003398 3300026095 Bacteria 11247
196 Ga0207674_10180178 3300026116 Bacteria 2064
197 Ga0207675_101213598 3300026118 Bacteria 775
198 Ga0207683_10000038 3300026121 Bacteria 100875
199 Ga0207698_10106066 3300026142 Bacteria 2342
200 Ga0207428_10469175 3300027907 Bacteria 916
201 Ga0224573_1003631 3300028019 Bacteria 1139
202 Ga0268266_10000751 3300028379 Bacteria 43326
203 Ga0268266_10447146 3300028379 Bacteria 1228
204 Ga0268265_10505280 3300028380 Bacteria 1140
205 Ga0268265_12461235 3300028380 Unclassified 527
206 Ga0265338_10000456 3300028800 Bacteria 72990
207 Ga0265324_10000577 3300029957 Bacteria 24985
208 Ga0265760_10088563 3300031090 Unclassified 967
209 Ga0265339_10167444 3300031249 Bacteria 1102
210 Ga0265331_10192157 3300031250 Bacteria 921
211 Ga0265316_10095612 3300031344 Bacteria 2262
212 Ga0307408_100205543 3300031548 Bacteria 1597
213 Ga0307408_100982364 3300031548 Bacteria 777
214 Ga0265314_10022570 3300031711 Bacteria 4820
215 Ga0307409_100912010 3300031995 Bacteria 893
216 Ga0307416_100172818 3300032002 Bacteria 2014
217 Ga0307416_101682896 3300032002 Bacteria 739
218 Ga0307416_102611878 3300032002 Bacteria 603
219 Ga0307414_10025754 3300032004 Bacteria 3774
220 Ga0307415_100340046 3300032126 Bacteria 1259
221 Ga0373939_0066477 3300035114 Unclassified 1162
222 Ga0373945_0404173 3300035116 Bacteria 599
223 Ga0316574_0097007 3300035398 Bacteria 1884
224 Ga0373937_0725422 3300036401 Unclassified 941
225 Ga0373937_1707624 3300036401 Unclassified 576
226 Ga0395899_0026275 3300037312 Unclassified 4393
227 Ga0395899_0086711 3300037312 Bacteria 2273
228 Ga0395900_0001661 3300037418 Bacteria 26033
229 Ga0395900_0004285 3300037418 Bacteria 15136
230 Ga0395900_0007978 3300037418 Bacteria 10895
231 Ga0395900_0451030 3300037418 Bacteria 1242
232 Ga0395900_0553150 3300037418 Bacteria 1095
233 Ga0395898_0003247 3300037466 Bacteria 18276
234 Ga0395898_0003970 3300037466 Bacteria 16287
235 Ga0395898_0775600 3300037466 Bacteria 899
236 Ga0395898_0865853 3300037466 Bacteria 842
237 Ga0395898_0961935 3300037466 Bacteria 791
238 Ga0395905_0002976 3300037471 Bacteria 18407
239 Ga0395905_0004494 3300037471 Bacteria 14464
240 Ga0395905_0167380 3300037471 Bacteria 2065
241 Ga0395905_0562887 3300037471 Bacteria 1041
242 Ga0395905_0589956 3300037471 Bacteria 1013
243 Ga0395905_1014256 3300037471 Bacteria 733
244 Ga0395905_1083075 3300037471 Bacteria 704
245 Ga0395901_0002931 3300038443 Bacteria 17220
246 Ga0395901_0005613 3300038443 Bacteria 12697
247 Ga0395901_0013682 3300038443 Bacteria 8246
248 Ga0395901_0049308 3300038443 Bacteria 4374
249 Ga0395901_0609817 3300038443 Bacteria 1100
250 Ga0395901_0650073 3300038443 Bacteria 1058
251 Ga0439439_0094428 3300041406 Bacteria 819
252 Ga0451793_0845064 3300041452 Unclassified 616
253 Ga0451797_0214769 3300041453 Unclassified 672
254 Ga0451797_0686476 3300041453 Unclassified 662
255 Ga0451847_0812080 3300041503 Bacteria 1463
256 Ga0451843_0124407 3300041509 Archaea 1182
257 Ga0451853_3017823 3300041512 Bacteria 773
258 Ga0439442_143682 3300042002 Bacteria 529
259 Ga0439454_028004 3300042011 Bacteria 869
260 Ga0439460_0035160 3300042461 Bacteria 1448
261 Ga0466960_0181233 3300044901 Bacteria 1142
262 Ga0466960_0423737 3300044901 Bacteria 770
263 Ga0466958_0240884 3300045836 Bacteria 1156
264 Ga0466967_0151860 3300045976 Bacteria 2166
265 Ga0466967_0443121 3300045976 Bacteria 1268
266 Ga0495617_173791 3300046452 Bacteria 680
267 Ga0495627_109245 3300046453 Bacteria 786
268 Ga0495603_0024889 3300046455 Bacteria 3621
269 Ga0495580_0017906 3300046472 Bacteria 5284
270 Ga0495582_0011042 3300046473 Bacteria 4971
271 Ga0495582_0046323 3300046473 Bacteria 2395
272 Ga0495605_0132587 3300046474 Bacteria 1123
273 Ga0495639_0108733 3300046475 Bacteria 1314
274 Ga0495584_0194026 3300046491 Bacteria 1032
275 Ga0495585_0049480 3300046492 Bacteria 2334
276 Ga0495585_0094091 3300046492 Unclassified 1611
277 Ga0495585_0366695 3300046492 Bacteria 698
278 Ga0495594_0116916 3300046499 Bacteria 1506
279 Ga0495596_0135145 3300046500 Bacteria 957
280 Ga0495616_0442361 3300046513 Bacteria 528
281 Ga0495630_1091428 3300046517 Bacteria 605
282 Ga0495631_0127114 3300046518 Unclassified 1096
283 Ga0495644_0220095 3300046523 Unclassified 734
284 Ga0495663_0031435 3300046525 Unclassified 1577
285 Ga0495666_0123820 3300046526 Bacteria 1210
286 Ga0495642_0099654 3300046528 Unclassified 1236
287 Ga0495642_0291056 3300046528 Bacteria 715
288 Ga0495598_0195530 3300046537 Bacteria 728
289 Ga0495609_0055377 3300046538 Unclassified 1760
290 Ga0495609_0344953 3300046538 Bacteria 601
291 Ga0495621_0255637 3300046539 Bacteria 717
292 Ga0495656_0235290 3300046615 Bacteria 921
293 Ga0495668_0119098 3300046616 Bacteria 1444
294 Ga0495611_0158317 3300046648 Bacteria 1058
295 Ga0495659_0029392 3300046664 Unclassified 1908
296 Ga0495659_0133479 3300046664 Bacteria 986
297 Ga0495659_0169911 3300046664 Bacteria 884
298 Ga0495661_0079344 3300046665 Unclassified 1897
299 Ga0495661_0298471 3300046665 Bacteria 807
300 Ga0495588_0171074 3300046674 Bacteria 1148
301 Ga0495588_0412143 3300046674 Bacteria 709
302 Ga0495588_0422927 3300046674 Bacteria 699
303 Ga0495658_0056324 3300046683 Bacteria 2242
304 Ga0495658_0548690 3300046683 Bacteria 740
305 Ga0495613_0131935 3300046689 Bacteria 1789
306 Ga0495671_0267217 3300046692 Unclassified 825
307 Ga0495589_0038769 3300046794 Unclassified 2383
308 Ga0495589_0317152 3300046794 Bacteria 721
309 Ga0495581_0005981 3300047315 Bacteria 7048
310 Ga0495581_0241356 3300047315 Bacteria 1056
311 Ga0495676_0011496 3300047321 Bacteria 7984
312 Ga0495683_0254724 3300047323 Bacteria 769
313 Ga0495677_0122689 3300047445 Bacteria 992
314 Ga0496100_0024245 3300048903 Bacteria 3697
315 Ga0496101_0176940 3300048904 Bacteria 1641
316 Ga0496101_0177591 3300048904 Bacteria 1638
317 Ga0496101_0510341 3300048904 Unclassified 950
318 Ga0496102_0036106 3300048905 Bacteria 4451
319 Ga0496103_0057906 3300048906 Bacteria 2406
320 Ga0496104_0041238 3300048907 Bacteria 4327
321 Ga0496105_0031585 3300048908 Unclassified 4341
322 Ga0496105_0451200 3300048908 Unclassified 1015
323 Ga0496106_0045260 3300048909 Bacteria 3305
324 Ga0496106_0070064 3300048909 Bacteria 2678
325 Ga0496106_0938428 3300048909 Bacteria 682
326 Ga0496107_0015928 3300048910 Bacteria 5274
327 Ga0496107_0060739 3300048910 Bacteria 2736
328 Ga0496107_1039438 3300048910 Bacteria 593
329 Ga0496108_0007860 3300048911 Bacteria 8646
330 Ga0496108_0018872 3300048911 Bacteria 5655
331 Ga0496108_0215373 3300048911 Bacteria 1668
332 Ga0496109_0002044 3300048912 Bacteria 16720
333 Ga0496109_0217863 3300048912 Bacteria 1795
334 Ga0496110_0003214 3300048913 Bacteria 12441
335 Ga0496110_0198577 3300048913 Bacteria 1822
336 Ga0496110_0699430 3300048913 Unclassified 915
337 Ga0496110_0959141 3300048913 Unclassified 762
338 Ga0496111_0004165 3300048914 Bacteria 9099
339 Ga0496111_0191918 3300048914 Bacteria 1519
340 Ga0496111_0302660 3300048914 Bacteria 1185
341 Ga0496111_0499063 3300048914 Bacteria 896
342 Ga0496112_0115897 3300048915 Bacteria 2649
343 Ga0496112_0186541 3300048915 Bacteria 2037
344 Ga0496112_0772243 3300048915 Bacteria 886
345 Ga0496113_0450342 3300048916 Bacteria 1034
346 Ga0496114_0004248 3300048917 Bacteria 11098
347 Ga0496114_0257256 3300048917 Bacteria 1537
348 Ga0496115_0014761 3300048918 Bacteria 5921
349 Ga0501040_0111384 3300049576 Bacteria 1914
350 Ga0501040_0142005 3300049576 Bacteria 1692
351 Ga0501040_1091531 3300049576 Bacteria 579
352 Ga0501041_0076506 3300049577 Bacteria 2059
353 Ga0501046_0069402 3300049580 Bacteria 2742
354 Ga0501067_0385559 3300049583 Bacteria 781
355 Ga0501070_0592870 3300049586 Bacteria 884
356 Ga0501071_0149620 3300049587 Bacteria 1741
357 Ga0501075_0046127 3300049591 Bacteria 3274
358 Ga0501075_0092823 3300049591 Bacteria 2291
359 Ga0501079_0188567 3300049741 Bacteria 1609
360 Ga0501081_1179084 3300049743 Bacteria 580
361 nmdc:mga0yw44_320398_c1 3300050492 Bacteria 1041
362 nmdc:mga05p37_611230_c1 3300050507 Unclassified 1228
363 nmdc:mga05p37_7362_c1 3300050507 Bacteria 2759
364 nmdc:mga09592_1002982_c1 3300050508 Unclassified 698
365 nmdc:mga0qj67_604749_c1 3300050509 Unclassified 877
366 nmdc:mga06r32_5646_c1 3300050510 Bacteria 11253
367 nmdc:mga08y16_125896_c1 3300050511 Bacteria 2665
368 nmdc:mga08y16_601049_c1 3300050511 Bacteria 1109
369 nmdc:mga0n895_1746_c1 3300050512 Bacteria 16448
370 nmdc:mga0rr50_44823_c1 3300050513 Bacteria 3246
371 nmdc:mga0a205_693245_c1 3300050515 Bacteria 868
372 Ga0495595_0141755 3300053084 Bacteria 1179
373 Ga0501084_0063943 3300054114 Bacteria 3081
374 Ga0590075_031146 3300059424 Bacteria 1352
375 Ga0530510_0062153 3300061734 Bacteria 2704
376 Ga0070673_100179266
377 JGI24751J29686_10119892
378 Ga0065712_10269927
379 Ga0065715_10610493
380 Ga0070683_100661838
381 Ga0070670_100070076
382 Ga0070670_100262605
383 Ga0068869_100405074
384 Ga0070666_10964468
385 Ga0070680_100774019
386 Ga0070682_100685793
387 Ga0068868_100010300
388 Ga0070660_100011217
389 Ga0070689_100020905
390 Ga0070687_100015627
391 Ga0070692_10032523
392 Ga0070669_100960117
393 Ga0070669_101455677
394 Ga0070675_100278343
395 Ga0070675_100860434
396 Ga0070674_100048944
397 Ga0070673_100038161
398 Ga0070688_100003349
399 Ga0070659_100054472
400 Ga0070667_101729203
401 Ga0070703_10018084
402 Ga0070709_10023306
403 Ga0070713_100721927
404 Ga0070710_10003539
405 Ga0070701_10075282
406 Ga0070711_100559680
407 Ga0070705_100043218
408 Ga0070705_100128893
409 Ga0070705_100800899
410 Ga0070700_100023901
411 Ga0070694_100405631
412 Ga0070708_100001249
413 Ga0070708_100170597
414 Ga0070708_100186115
415 Ga0070708_100425017
416 Ga0070663_100037970
417 Ga0070678_100003649
418 Ga0070681_10024061
419 Ga0070681_10743831
420 Ga0068867_100723502
421 Ga0068867_101464743
422 Ga0070685_10020072
423 Ga0070706_100000875
424 Ga0070706_100001143
425 Ga0070706_100018291
426 Ga0070706_100124519
427 Ga0070706_100422810
428 Ga0070707_100021083
429 Ga0070698_100040584
430 Ga0070699_100033321
431 Ga0070699_100272793
432 Ga0070699_100598647
433 Ga0070697_100000901
434 Ga0070697_100220627
435 Ga0068853_100007723
436 Ga0070672_100017154
437 Ga0070672_100958149
438 Ga0070695_100032834
439 Ga0070695_100238650
440 Ga0070696_100017446
441 Ga0070665_100001706
442 Ga0070665_100186027
443 Ga0070704_100016009
444 Ga0070704_100371496
445 Ga0070704_102156684
446 Ga0068855_100382555
447 Ga0070664_100067911
448 Ga0070664_100661535
449 Ga0068857_100590109
450 Ga0068854_100538833
451 Ga0068856_100115283
452 Ga0070702_100020752
453 Ga0068859_100604054
454 Ga0068866_10066642
455 Ga0068866_10213885
456 Ga0068870_10003808
457 Ga0068863_100018126
458 Ga0068862_101181310
459 Ga0081455_10056513
460 Ga0070717_10379583
461 Ga0070717_11087036
462 Ga0075365_10367896
463 Ga0075432_10231010
464 Ga0070712_100023536
465 Ga0070712_100273665
466 Ga0070712_100514504
467 Ga0070712_101123395
468 Ga0068871_100032898
469 Ga0075428_100132650
470 Ga0075430_100062710
471 Ga0075430_101403475
472 Ga0075431_100045602
473 Ga0075433_11015893
474 Ga0075434_100000462
475 Ga0075429_101087419
476 Ga0068865_100034382
477 Ga0097620_100604024
478 Ga0111539_10161997
479 Ga0105245_10016804
480 Ga0105245_10132556
481 Ga0105245_10494864
482 Ga0114129_10149141
483 Ga0114129_10177569
484 Ga0114129_10532398
485 Ga0114129_10686149
486 Ga0114129_11089504
487 Ga0105241_10097372
488 Ga0105242_10208772
489 Ga0105242_10455180
490 Ga0105248_10018487
491 Ga0105248_10204743
492 Ga0105237_10195799
493 Ga0105249_10077196
494 Ga0105249_12523065
495 Ga0099796_10099383
496 Ga0105239_10053603
497 Ga0105246_10176221
498 Ga0105246_11229725
499 Ga0157371_11130850
500 Ga0157374_10003998
501 Ga0157378_10055043
502 Ga0157378_11228555
503 Ga0163162_10001552
504 Ga0163162_12093188
505 Ga0157372_12497854
506 Ga0157375_10063195
507 Ga0157375_11511126
508 Ga0157380_10163745
509 Ga0157377_10007678
510 Ga0157376_10027466
511 Ga0163161_11008074
512 Ga0224569_100071
513 Ga0224571_100635
514 Ga0224571_102066
515 Ga0224572_1000180
516 Ga0228598_1000080
517 Ga0228598_1001559
518 Ga0207653_10017780
519 Ga0207653_10175324
520 Ga0207692_10031031
521 Ga0207642_10007029
522 Ga0207647_10233511
523 Ga0207685_10007963
524 Ga0207699_10021084
525 Ga0207643_10001386
526 Ga0207684_10000509
527 Ga0207684_10001711
528 Ga0207684_10362025
529 Ga0207654_10102892
530 Ga0207707_10072611
531 Ga0207693_10007043
532 Ga0207663_10338133
533 Ga0207662_10058434
534 Ga0207657_10018031
535 Ga0207646_10845372
536 Ga0207681_10538491
537 Ga0207650_10091128
538 Ga0207650_10202379
539 Ga0207687_10195304
540 Ga0207687_11003403
541 Ga0207700_10609471
542 Ga0207700_11344185
543 Ga0207686_10294695
544 Ga0207686_10421755
545 Ga0207709_10033606
546 Ga0207709_10673363
547 Ga0207670_10728943
548 Ga0207669_10089124
549 Ga0207704_10101840
550 Ga0207704_11068564
551 Ga0207691_10020501
552 Ga0207711_10049857
553 Ga0207711_10096354
554 Ga0207689_10800163
555 Ga0207679_10401190
556 Ga0207679_10572933
557 Ga0207651_10103728
558 Ga0207651_10377265
559 Ga0207640_10159800
560 Ga0207640_10323570
561 Ga0207658_10072084
562 Ga0207677_10047904
563 Ga0207639_10034318
564 Ga0207708_10005409
565 Ga0207708_10084886
566 Ga0207702_10035047
567 Ga0207702_11016493
568 Ga0207641_11812717
569 Ga0207648_10000097
570 Ga0207676_10003398
571 Ga0207674_10180178
572 Ga0207675_101213598
573 Ga0207683_10000038
574 Ga0207698_10106066
575 Ga0207428_10469175
576 Ga0224573_1003631
577 Ga0268266_10000751
578 Ga0268266_10447146
579 Ga0268265_10505280
580 Ga0268265_12461235
581 Ga0265338_10000456
582 Ga0265324_10000577
583 Ga0265760_10088563
584 Ga0265339_10167444
585 Ga0265331_10192157
586 Ga0265316_10095612
587 Ga0307408_100205543
588 Ga0307408_100982364
589 Ga0265314_10022570
590 Ga0307409_100912010
591 Ga0307416_100172818
592 Ga0307416_101682896
593 Ga0307416_102611878
594 Ga0307414_10025754
595 Ga0307415_100340046
596 Ga0373939_0066477
597 Ga0373945_0404173
598 Ga0316574_0097007
599 Ga0373937_0725422
600 Ga0373937_1707624
601 Ga0395899_0026275
602 Ga0395899_0086711
603 Ga0395900_0001661
604 Ga0395900_0004285
605 Ga0395900_0007978
606 Ga0395900_0451030
607 Ga0395900_0553150
608 Ga0395898_0003247
609 Ga0395898_0003970
610 Ga0395898_0775600
611 Ga0395898_0865853
612 Ga0395898_0961935
613 Ga0395905_0002976
614 Ga0395905_0004494
615 Ga0395905_0167380
616 Ga0395905_0562887
617 Ga0395905_0589956
618 Ga0395905_1014256
619 Ga0395905_1083075
620 Ga0395901_0002931
621 Ga0395901_0005613
622 Ga0395901_0013682
623 Ga0395901_0049308
624 Ga0395901_0609817
625 Ga0395901_0650073
626 Ga0439439_0094428
627 Ga0451793_0845064
628 Ga0451797_0214769
629 Ga0451797_0686476
630 Ga0451847_0812080
631 Ga0451843_0124407
632 Ga0451853_3017823
633 Ga0439442_143682
634 Ga0439454_028004
635 Ga0439460_0035160
636 Ga0466960_0181233
637 Ga0466960_0423737
638 Ga0466958_0240884
639 Ga0466967_0151860
640 Ga0466967_0443121
641 Ga0495617_173791
642 Ga0495627_109245
643 Ga0495603_0024889
644 Ga0495580_0017906
645 Ga0495582_0011042
646 Ga0495582_0046323
647 Ga0495605_0132587
648 Ga0495639_0108733
649 Ga0495584_0194026
650 Ga0495585_0049480
651 Ga0495585_0094091
652 Ga0495585_0366695
653 Ga0495594_0116916
654 Ga0495596_0135145
655 Ga0495616_0442361
656 Ga0495630_1091428
657 Ga0495631_0127114
658 Ga0495644_0220095
659 Ga0495663_0031435
660 Ga0495666_0123820
661 Ga0495642_0099654
662 Ga0495642_0291056
663 Ga0495598_0195530
664 Ga0495609_0055377
665 Ga0495609_0344953
666 Ga0495621_0255637
667 Ga0495656_0235290
668 Ga0495668_0119098
669 Ga0495611_0158317
670 Ga0495659_0029392
671 Ga0495659_0133479
672 Ga0495659_0169911
673 Ga0495661_0079344
674 Ga0495661_0298471
675 Ga0495588_0171074
676 Ga0495588_0412143
677 Ga0495588_0422927
678 Ga0495658_0056324
679 Ga0495658_0548690
680 Ga0495613_0131935
681 Ga0495671_0267217
682 Ga0495589_0038769
683 Ga0495589_0317152
684 Ga0495581_0005981
685 Ga0495581_0241356
686 Ga0495676_0011496
687 Ga0495683_0254724
688 Ga0495677_0122689
689 Ga0496100_0024245
690 Ga0496101_0176940
691 Ga0496101_0177591
692 Ga0496101_0510341
693 Ga0496102_0036106
694 Ga0496103_0057906
695 Ga0496104_0041238
696 Ga0496105_0031585
697 Ga0496105_0451200
698 Ga0496106_0045260
699 Ga0496106_0070064
700 Ga0496106_0938428
701 Ga0496107_0015928
702 Ga0496107_0060739
703 Ga0496107_1039438
704 Ga0496108_0007860
705 Ga0496108_0018872
706 Ga0496108_0215373
707 Ga0496109_0002044
708 Ga0496109_0217863
709 Ga0496110_0003214
710 Ga0496110_0198577
711 Ga0496110_0699430
712 Ga0496110_0959141
713 Ga0496111_0004165
714 Ga0496111_0191918
715 Ga0496111_0302660
716 Ga0496111_0499063
717 Ga0496112_0115897
718 Ga0496112_0186541
719 Ga0496112_0772243
720 Ga0496113_0450342
721 Ga0496114_0004248
722 Ga0496114_0257256
723 Ga0496115_0014761
724 Ga0501040_0111384
725 Ga0501040_0142005
726 Ga0501040_1091531
727 Ga0501041_0076506
728 Ga0501046_0069402
729 Ga0501067_0385559
730 Ga0501070_0592870
731 Ga0501071_0149620
732 Ga0501075_0046127
733 Ga0501075_0092823
734 Ga0501079_0188567
735 Ga0501081_1179084
736 nmdc:mga0yw44_320398_c1
737 nmdc:mga05p37_611230_c1
738 nmdc:mga05p37_7362_c1
739 nmdc:mga09592_1002982_c1
740 nmdc:mga0qj67_604749_c1
741 nmdc:mga06r32_5646_c1
742 nmdc:mga08y16_125896_c1
743 nmdc:mga08y16_601049_c1
744 nmdc:mga0n895_1746_c1
745 nmdc:mga0rr50_44823_c1
746 nmdc:mga0a205_693245_c1
747 Ga0495595_0141755
748 Ga0501084_0063943
749 Ga0590075_031146
750 Ga0530510_0062153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

29

147

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9657 2 125
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9577 2 125
2dyy-assembly4.cif.gz_K crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9329 18 126
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9291 19 125
3kjj-assembly1.cif.gz_B crystal structure of nmb1025, a member of yjgf protein family, from neisseria meningitidis (hexagonal crystal form) 0.9214 2 126
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9657 2 125 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9577 2 125 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9299 18 124 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9283 19 125 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9121 19 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A4R4R3J9-F1-model_v4 RidA family protein 0.9884 2 125
AF-A0A382AF47-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.988 48 125 GO:0016779
AF-A0A2S9F7I4-F1-model_v4 RidA family protein 0.9878 55 126
AF-A0A6M0SFC9-F1-model_v4 RidA family protein 0.9853 1 126
AF-A0A6M0SFC9-F1-model_v4 RidA family protein 0.9776 1 126

Map