F426809

General Info

Members Datasets Scaffolds Average Seq Length
374 180 748 256

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0034131|Ga0466959_0034131_1581_2432
Length 283
Sequence LVLATQEAGDITGPITRRVTSRRMRIRVGHSADPDDAFMVWALEAGAVDTRGLELEPVVSDIQTLNEWALEGRLEVTALSAGAYPAVADRYLLLPHGASFGDGYGPVVVAREQLDLHDVEIVTPGPLTTAKRVLHLALGEEIPTRDLPFDQVLDEVVSGRGEAGLLIHEGQLTYADAGLVKLLDLGAWWQEHVALPLPLGLVGIRRDLGPRDDVSHVLREAIVAGLEHRDDAMAYAVGFGRGIDRETADRFVSMYVNDLTLDMGERGRAAVARLLGRDPEFAR

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 1.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.89
Rhizosphere 89.84
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0034131 3300045049 Bacteria 3765
2 Ga0070658_10022886 3300005327 Bacteria 5015
3 Ga0070658_10089706 3300005327 Bacteria 2531
4 Ga0070658_10098767 3300005327 Bacteria 2412
5 Ga0070658_10477013 3300005327 Bacteria 1076
6 Ga0070683_100018974 3300005329 Bacteria 6102
7 Ga0070683_100072264 3300005329 Bacteria 3220
8 Ga0070683_100878592 3300005329 Bacteria 860
9 Ga0070680_100020497 3300005336 Bacteria 5247
10 Ga0070680_100301483 3300005336 Bacteria 1359
11 Ga0068868_100473619 3300005338 Bacteria 1093
12 Ga0070660_100005650 3300005339 Bacteria 8666
13 Ga0070660_100046379 3300005339 Bacteria 3331
14 Ga0070660_100065879 3300005339 Bacteria 2820
15 Ga0070660_100377901 3300005339 Bacteria 1169
16 Ga0070661_100024932 3300005344 Bacteria 4293
17 Ga0070661_100052368 3300005344 Bacteria 2988
18 Ga0070661_100162715 3300005344 Bacteria 1691
19 Ga0070659_100058187 3300005366 Bacteria 3050
20 Ga0070667_100004071 3300005367 Bacteria 12361
21 Ga0070713_100338849 3300005436 Bacteria 1393
22 Ga0070711_100075281 3300005439 Bacteria 2390
23 Ga0070694_100085115 3300005444 Bacteria 2207
24 Ga0070663_100222707 3300005455 Bacteria 1482
25 Ga0070681_10017064 3300005458 Bacteria 7256
26 Ga0070681_10048148 3300005458 Bacteria 4260
27 Ga0070681_10097088 3300005458 Bacteria 2894
28 Ga0070681_10184720 3300005458 Bacteria 2006
29 Ga0070681_10409448 3300005458 Bacteria 1268
30 Ga0070679_100033283 3300005530 Bacteria 5104
31 Ga0070679_100081140 3300005530 Bacteria 3233
32 Ga0070679_100107846 3300005530 Bacteria 2771
33 Ga0070679_100131388 3300005530 Bacteria 2485
34 Ga0070679_100388710 3300005530 Bacteria 1341
35 Ga0070679_100399712 3300005530 Bacteria 1320
36 Ga0070684_100063791 3300005535 Bacteria 3231
37 Ga0070684_100069285 3300005535 Bacteria 3102
38 Ga0070684_100133131 3300005535 Bacteria 2244
39 Ga0070684_100147939 3300005535 Bacteria 2127
40 Ga0070665_100064543 3300005548 Bacteria 3672
41 Ga0068855_100009327 3300005563 Bacteria 11852
42 Ga0068855_100029008 3300005563 Bacteria 6618
43 Ga0068855_100074845 3300005563 Bacteria 3932
44 Ga0068855_100186946 3300005563 Bacteria 2339
45 Ga0068855_100371079 3300005563 Bacteria 1573
46 Ga0068855_100380556 3300005563 Bacteria 1550
47 Ga0068855_100812732 3300005563 Unclassified 993
48 Ga0068857_100042898 3300005577 Bacteria 4013
49 Ga0068857_100060753 3300005577 Bacteria 3357
50 Ga0068856_100272471 3300005614 Bacteria 1708
51 Ga0068852_100025736 3300005616 Bacteria 4772
52 Ga0068852_100026479 3300005616 Bacteria 4714
53 Ga0068852_100255673 3300005616 Bacteria 1680
54 Ga0068852_100268796 3300005616 Bacteria 1640
55 Ga0070717_10043433 3300006028 Bacteria 3669
56 Ga0070712_100021648 3300006175 Bacteria 4226
57 Ga0075433_10221920 3300006852 Bacteria 1679
58 Ga0075434_100007870 3300006871 Bacteria 9873
59 Ga0075435_100223364 3300007076 Bacteria 1600
60 Ga0105240_10052404 3300009093 Bacteria 5131
61 Ga0105240_10073576 3300009093 Bacteria 4219
62 Ga0105240_10094763 3300009093 Bacteria 3640
63 Ga0105240_10264099 3300009093 Bacteria 1985
64 Ga0105245_10029864 3300009098 Bacteria 4820
65 Ga0105248_10500986 3300009177 Bacteria 1369
66 Ga0105237_10113275 3300009545 Bacteria 2705
67 Ga0105237_10139933 3300009545 Bacteria 2414
68 Ga0105238_10072011 3300009551 Bacteria 3453
69 Ga0105239_10064567 3300010375 Bacteria 4019
70 Ga0105239_10462499 3300010375 Bacteria 1440
71 Ga0157373_10063948 3300013100 Bacteria 2604
72 Ga0157373_10358384 3300013100 Bacteria 1041
73 Ga0157371_10172619 3300013102 Bacteria 1545
74 Ga0157370_10014001 3300013104 Bacteria 8237
75 Ga0157370_10041061 3300013104 Bacteria 4466
76 Ga0157370_10051680 3300013104 Bacteria 3926
77 Ga0157370_10181310 3300013104 Bacteria 1957
78 Ga0157369_10029083 3300013105 Bacteria 6109
79 Ga0157369_10091319 3300013105 Bacteria 3251
80 Ga0157369_10119474 3300013105 Bacteria 2797
81 Ga0157369_10461987 3300013105 Bacteria 1314
82 Ga0157374_10040394 3300013296 Bacteria 4296
83 Ga0157372_10037160 3300013307 Bacteria 5369
84 Ga0157372_10066708 3300013307 Bacteria 4043
85 Ga0157372_10162926 3300013307 Bacteria 2578
86 Ga0157372_10308784 3300013307 Bacteria 1841
87 Ga0157372_10841762 3300013307 Bacteria 1065
88 Ga0197907_11074965 3300020069 Bacteria 1324
89 Ga0197907_11171484 3300020069 Bacteria 1626
90 Ga0206356_10270218 3300020070 Bacteria 3163
91 Ga0206354_10113511 3300020081 Bacteria 1512
92 Ga0206354_10438909 3300020081 Bacteria 2633
93 Ga0206353_10435521 3300020082 Bacteria 3881
94 Ga0206353_10849945 3300020082 Bacteria 1753
95 Ga0207705_10051058 3300025909 Bacteria 2977
96 Ga0207705_10068077 3300025909 Bacteria 2577
97 Ga0207707_10004608 3300025912 Bacteria 12110
98 Ga0207707_10119699 3300025912 Bacteria 2301
99 Ga0207707_10185769 3300025912 Bacteria 1814
100 Ga0207695_10063373 3300025913 Bacteria 3812
101 Ga0207671_10185386 3300025914 Bacteria 1621
102 Ga0207693_10038420 3300025915 Bacteria 3771
103 Ga0207663_10126540 3300025916 Bacteria 1758
104 Ga0207663_10159936 3300025916 Bacteria 1589
105 Ga0207660_10009676 3300025917 Bacteria 6239
106 Ga0207660_10347943 3300025917 Bacteria 1187
107 Ga0207657_10000610 3300025919 Bacteria 37898
108 Ga0207657_10007328 3300025919 Bacteria 11317
109 Ga0207657_10036107 3300025919 Bacteria 4426
110 Ga0207657_10051502 3300025919 Bacteria 3578
111 Ga0207657_10376775 3300025919 Bacteria 1118
112 Ga0207649_10020935 3300025920 Bacteria 3756
113 Ga0207649_10030091 3300025920 Bacteria 3212
114 Ga0207649_10045623 3300025920 Bacteria 2688
115 Ga0207652_10042811 3300025921 Bacteria 3855
116 Ga0207652_10049053 3300025921 Bacteria 3612
117 Ga0207652_10102052 3300025921 Bacteria 2535
118 Ga0207646_10377319 3300025922 Bacteria 1281
119 Ga0207694_10116299 3300025924 Bacteria 2131
120 Ga0207694_10456909 3300025924 Unclassified 1067
121 Ga0207700_10040597 3300025928 Bacteria 3398
122 Ga0207700_10234757 3300025928 Bacteria 1561
123 Ga0207664_10314424 3300025929 Bacteria 1381
124 Ga0207665_10290696 3300025939 Bacteria 1219
125 Ga0207661_10040252 3300025944 Bacteria 3673
126 Ga0207661_10094512 3300025944 Bacteria 2497
127 Ga0207661_10249910 3300025944 Bacteria 1576
128 Ga0207679_10029791 3300025945 Bacteria 3804
129 Ga0207667_10110309 3300025949 Bacteria 2838
130 Ga0207667_10141620 3300025949 Bacteria 2476
131 Ga0207667_10155426 3300025949 Bacteria 2353
132 Ga0207667_10189535 3300025949 Bacteria 2110
133 Ga0207667_10219890 3300025949 Bacteria 1946
134 Ga0207667_10228543 3300025949 Bacteria 1905
135 Ga0207667_10268892 3300025949 Bacteria 1743
136 Ga0207667_10512890 3300025949 Bacteria 1215
137 Ga0207667_10557346 3300025949 Bacteria 1159
138 Ga0207667_10747673 3300025949 Unclassified 977
139 Ga0207640_10050959 3300025981 Bacteria 2688
140 Ga0207658_10031488 3300025986 Bacteria 3767
141 Ga0207639_10157710 3300026041 Bacteria 1909
142 Ga0207678_10375573 3300026067 Bacteria 1228
143 Ga0207702_10102599 3300026078 Bacteria 2528
144 Ga0207702_10112955 3300026078 Bacteria 2418
145 Ga0207702_10284382 3300026078 Bacteria 1565
146 Ga0207674_10020357 3300026116 Bacteria 7168
147 Ga0207674_10042724 3300026116 Bacteria 4679
148 Ga0207674_10052082 3300026116 Bacteria 4175
149 Ga0207683_10487711 3300026121 Bacteria 1138
150 Ga0207698_10014358 3300026142 Bacteria 5262
151 Ga0207698_10069301 3300026142 Bacteria 2788
152 Ga0207698_10171341 3300026142 Bacteria 1912
153 Ga0207698_10177670 3300026142 Bacteria 1882
154 Ga0207698_10411021 3300026142 Bacteria 1296
155 Ga0268266_10058938 3300028379 Bacteria 3307
156 Ga0265334_10034976 3300028573 Bacteria 1991
157 Ga0265318_10075781 3300028577 Bacteria 1245
158 Ga0265338_10029160 3300028800 Bacteria 5479
159 Ga0265320_10022772 3300031240 Bacteria 3346
160 Ga0265325_10028088 3300031241 Bacteria 3036
161 Ga0265340_10065480 3300031247 Bacteria 1730
162 Ga0265327_10034341 3300031251 Bacteria 2815
163 Ga0265316_10046610 3300031344 Bacteria 3433
164 Ga0265313_10014003 3300031595 Bacteria 4775
165 Ga0265314_10021866 3300031711 Bacteria 4906
166 Ga0265314_10193821 3300031711 Bacteria 1207
167 Ga0265342_10072456 3300031712 Bacteria 2005
168 Ga0373944_0004868 3300035089 Bacteria 3517
169 Ga0373945_0000929 3300035116 Bacteria 8716
170 Ga0373945_0001630 3300035116 Bacteria 6879
171 Ga0373943_0000541 3300035170 Bacteria 16358
172 Ga0373943_0006978 3300035170 Bacteria 5067
173 Ga0373946_0006657 3300035171 Bacteria 4197
174 Ga0373946_0061417 3300035171 Bacteria 1600
175 Ga0373955_0089486 3300035172 Bacteria 1752
176 Ga0373924_0018394 3300035410 Bacteria 2692
177 Ga0373935_0290178 3300035692 Bacteria 1154
178 Ga0373927_0052153 3300035695 Bacteria 2646
179 Ga0373933_0012395 3300035724 Bacteria 4708
180 Ga0373947_0000920 3300035725 Bacteria 17863
181 Ga0373947_0011462 3300035725 Bacteria 5085
182 Ga0373947_0305113 3300035725 Unclassified 1062
183 Ga0373937_0071582 3300036401 Bacteria 3197
184 Ga0373937_0610277 3300036401 Bacteria 1036
185 Ga0373925_0005249 3300037068 Bacteria 9678
186 Ga0395899_0068451 3300037312 Bacteria 2602
187 Ga0395899_0203016 3300037312 Unclassified 1381
188 Ga0395900_0006366 3300037418 Bacteria 12310
189 Ga0395900_0059693 3300037418 Bacteria 3926
190 Ga0395900_0172942 3300037418 Bacteria 2198
191 Ga0395900_0355051 3300037418 Bacteria 1439
192 Ga0395898_0003052 3300037466 Bacteria 18969
193 Ga0395898_0015914 3300037466 Bacteria 7707
194 Ga0395898_0176201 3300037466 Bacteria 2044
195 Ga0395898_0310884 3300037466 Bacteria 1503
196 Ga0395898_0324331 3300037466 Bacteria 1469
197 Ga0395898_0562046 3300037466 Bacteria 1083
198 Ga0395905_0083187 3300037471 Bacteria 2999
199 Ga0395905_0168049 3300037471 Bacteria 2061
200 Ga0395901_0002248 3300038443 Bacteria 19701
201 Ga0395901_0431877 3300038443 Bacteria 1349
202 Ga0395901_0860016 3300038443 Unclassified 891
203 Ga0436365_1076414 3300039437 Bacteria 1912
204 Ga0436360_0945782 3300039438 Bacteria 5909
205 Ga0436362_0204265 3300039453 Bacteria 5984
206 Ga0466969_0036331 3300044656 Bacteria 2489
207 Ga0466969_0135197 3300044656 Bacteria 1142
208 Ga0466966_0091004 3300044684 Bacteria 1894
209 Ga0466966_0171367 3300044684 Bacteria 1319
210 Ga0466961_0092072 3300044693 Bacteria 1914
211 Ga0466961_0120390 3300044693 Bacteria 1648
212 Ga0466963_0003084 3300044694 Bacteria 9444
213 Ga0466963_0003232 3300044694 Bacteria 9281
214 Ga0466963_0007320 3300044694 Bacteria 6579
215 Ga0466963_0044102 3300044694 Bacteria 2935
216 Ga0466963_0052287 3300044694 Bacteria 2710
217 Ga0466963_0056962 3300044694 Bacteria 2602
218 Ga0466963_0080260 3300044694 Bacteria 2208
219 Ga0466963_0140922 3300044694 Bacteria 1670
220 Ga0466963_0293172 3300044694 Bacteria 1144
221 Ga0466963_0394860 3300044694 Bacteria 975
222 Ga0466971_0010913 3300044719 Bacteria 3972
223 Ga0466971_0043533 3300044719 Bacteria 2017
224 Ga0466968_0055102 3300044735 Bacteria 1706
225 Ga0466957_0011480 3300044842 Bacteria 5112
226 Ga0466957_0126738 3300044842 Bacteria 1632
227 Ga0466957_0235222 3300044842 Bacteria 1214
228 Ga0466960_0083078 3300044901 Bacteria 1618
229 Ga0466959_0006422 3300045049 Bacteria 8139
230 Ga0466959_0172839 3300045049 Bacteria 1515
231 Ga0466959_0225888 3300045049 Bacteria 1297
232 Ga0466958_0005254 3300045836 Bacteria 6939
233 Ga0466958_0021548 3300045836 Bacteria 3768
234 Ga0466958_0128460 3300045836 Bacteria 1590
235 Ga0466967_0010954 3300045976 Bacteria 6835
236 Ga0466967_0011760 3300045976 Bacteria 6654
237 Ga0466967_0024048 3300045976 Bacteria 5002
238 Ga0466967_0024940 3300045976 Bacteria 4923
239 Ga0466967_0034755 3300045976 Bacteria 4282
240 Ga0466967_0035133 3300045976 Bacteria 4262
241 Ga0466967_0054084 3300045976 Bacteria 3531
242 Ga0466967_0231801 3300045976 Bacteria 1758
243 Ga0466967_0352467 3300045976 Bacteria 1425
244 Ga0466967_0699583 3300045976 Bacteria 1004
245 Ga0466967_0772183 3300045976 Bacteria 953
246 Ga0495592_0086169 3300046454 Bacteria 2263
247 Ga0495592_0221410 3300046454 Archaea 1265
248 Ga0495629_0043835 3300046459 Bacteria 3140
249 Ga0495641_0000331 3300046461 Bacteria 38511
250 Ga0495641_0049655 3300046461 Bacteria 1920
251 Ga0495651_0031693 3300046462 Bacteria 4121
252 Ga0495651_0127790 3300046462 Bacteria 1859
253 Ga0495651_0210821 3300046462 Bacteria 1352
254 Ga0495653_0035813 3300046463 Bacteria 3915
255 Ga0495653_0166713 3300046463 Bacteria 1524
256 Ga0495582_0002336 3300046473 Bacteria 10624
257 Ga0495605_0043823 3300046474 Bacteria 2216
258 Ga0495639_0002368 3300046475 Bacteria 8233
259 Ga0495639_0014577 3300046475 Bacteria 3405
260 Ga0495662_0029828 3300046476 Bacteria 2632
261 Ga0495664_0072346 3300046477 Bacteria 2060
262 Ga0495594_0112725 3300046499 Bacteria 1534
263 Ga0495608_0002892 3300046511 Bacteria 12307
264 Ga0495608_0051070 3300046511 Bacteria 2741
265 Ga0495608_0071511 3300046511 Bacteria 2263
266 Ga0495618_0085067 3300046514 Bacteria 2021
267 Ga0495628_0057921 3300046516 Bacteria 3047
268 Ga0495628_0061762 3300046516 Bacteria 2938
269 Ga0495628_0085545 3300046516 Bacteria 2446
270 Ga0495628_0251524 3300046516 Bacteria 1319
271 Ga0495666_0198936 3300046526 Bacteria 921
272 Ga0495652_0126220 3300046529 Bacteria 2032
273 Ga0495665_0001497 3300046531 Bacteria 12525
274 Ga0495640_0159427 3300046533 Bacteria 1446
275 Ga0495587_0054791 3300046536 Bacteria 2349
276 Ga0495645_0024342 3300046543 Bacteria 4393
277 Ga0495667_0015929 3300046559 Bacteria 5081
278 Ga0495667_0197894 3300046559 Bacteria 1286
279 Ga0495635_0027100 3300046663 Bacteria 3987
280 Ga0495635_0055795 3300046663 Bacteria 2721
281 Ga0495657_0028280 3300046675 Bacteria 3946
282 Ga0495657_0123156 3300046675 Bacteria 1631
283 Ga0495599_0017082 3300046678 Bacteria 4509
284 Ga0495623_0014155 3300046679 Bacteria 5166
285 Ga0495646_0100023 3300046680 Bacteria 1664
286 Ga0495647_0012937 3300046681 Archaea 2881
287 Ga0495658_0001079 3300046683 Bacteria 14352
288 Ga0495658_0156655 3300046683 Bacteria 1402
289 Ga0495613_0085029 3300046689 Bacteria 2296
290 Ga0495613_0282448 3300046689 Bacteria 1152
291 Ga0495624_0001304 3300046690 Bacteria 19574
292 Ga0495624_0263304 3300046690 Bacteria 1042
293 Ga0495600_0035789 3300046809 Bacteria 3226
294 Ga0495600_0097695 3300046809 Bacteria 1914
295 Ga0495600_0390278 3300046809 Bacteria 867
296 Ga0495581_0046207 3300047315 Bacteria 2515
297 Ga0495604_0006225 3300047317 Bacteria 9471
298 Ga0495604_0077139 3300047317 Bacteria 2505
299 Ga0495674_0011550 3300047319 Bacteria 8334
300 Ga0495674_0025068 3300047319 Bacteria 5474
301 Ga0495674_0066749 3300047319 Bacteria 3119
302 Ga0495674_0356045 3300047319 Bacteria 1187
303 Ga0495674_0421583 3300047319 Bacteria 1075
304 Ga0495674_0427602 3300047319 Bacteria 1066
305 Ga0495676_0000268 3300047321 Bacteria 42236
306 Ga0495680_0002726 3300047322 Bacteria 17830
307 Ga0495680_0010078 3300047322 Bacteria 8449
308 Ga0495680_0010333 3300047322 Bacteria 8331
309 Ga0495680_0050461 3300047322 Bacteria 3253
310 Ga0495675_0070311 3300047444 Bacteria 2210
311 Ga0495684_0003661 3300047471 Bacteria 11976
312 Ga0495684_0024787 3300047471 Bacteria 4613
313 Ga0495684_0191640 3300047471 Bacteria 1511
314 Ga0495593_0079591 3300047673 Bacteria 1696
315 Ga0496100_0007242 3300048903 Bacteria 6102
316 Ga0496100_0034583 3300048903 Bacteria 3173
317 Ga0496101_0000942 3300048904 Bacteria 17171
318 Ga0496101_0007104 3300048904 Bacteria 7241
319 Ga0496101_0214134 3300048904 Bacteria 1493
320 Ga0496102_0026011 3300048905 Bacteria 5216
321 Ga0496102_0041221 3300048905 Bacteria 4179
322 Ga0496102_0119618 3300048905 Bacteria 2460
323 Ga0496103_0004940 3300048906 Bacteria 8050
324 Ga0496103_0024735 3300048906 Bacteria 3624
325 Ga0496104_0084047 3300048907 Bacteria 3036
326 Ga0496104_0201884 3300048907 Bacteria 1900
327 Ga0496104_0207724 3300048907 Bacteria 1870
328 Ga0496105_0002512 3300048908 Bacteria 13305
329 Ga0496105_0047317 3300048908 Bacteria 3550
330 Ga0496105_0084539 3300048908 Bacteria 2621
331 Ga0496106_0000850 3300048909 Bacteria 22149
332 Ga0496106_0278374 3300048909 Bacteria 1340
333 Ga0496107_0004295 3300048910 Bacteria 9643
334 Ga0496107_0084928 3300048910 Bacteria 2310
335 Ga0496108_0007894 3300048911 Bacteria 8628
336 Ga0496108_0046862 3300048911 Bacteria 3613
337 Ga0496108_0349046 3300048911 Bacteria 1291
338 Ga0496109_0005751 3300048912 Bacteria 10374
339 Ga0496109_0119983 3300048912 Bacteria 2449
340 Ga0496110_0516276 3300048913 Bacteria 1087
341 Ga0496111_0157342 3300048914 Bacteria 1686
342 Ga0496112_0032371 3300048915 Bacteria 5077
343 Ga0496112_0038689 3300048915 Bacteria 4658
344 Ga0496114_0018567 3300048917 Bacteria 5625
345 Ga0496114_0020799 3300048917 Bacteria 5327
346 Ga0496114_0027964 3300048917 Bacteria 4624
347 Ga0496115_0001257 3300048918 Bacteria 18199
348 Ga0496115_0008928 3300048918 Bacteria 7435
349 Ga0496115_0129649 3300048918 Bacteria 2078
350 Ga0496115_0324040 3300048918 Bacteria 1260
351 Ga0496115_0334650 3300048918 Bacteria 1236
352 Ga0501042_0206950 3300049578 Bacteria 1415
353 Ga0501067_0000154 3300049583 Bacteria 38151
354 Ga0501069_0001465 3300049585 Bacteria 11614
355 Ga0501069_0076451 3300049585 Bacteria 1882
356 Ga0501070_0061076 3300049586 Bacteria 3123
357 Ga0501071_0061987 3300049587 Bacteria 2709
358 Ga0501074_0018627 3300049590 Bacteria 5044
359 Ga0501077_0014036 3300049593 Bacteria 5024
360 Ga0501080_0186326 3300049742 Bacteria 1908
361 Ga0501080_0393021 3300049742 Bacteria 1248
362 nmdc:mga0n895_14634_c2 3300050512 Bacteria 5905
363 nmdc:mga0a205_21088_c1 3300050515 Bacteria 4471
364 Ga0495612_0030325 3300053078 Bacteria 2178
365 Ga0495595_0017810 3300053084 Bacteria 3060
366 Ga0495595_0042750 3300053084 Bacteria 2076
367 Ga0495619_0019092 3300053085 Bacteria 4355
368 Ga0495619_0136629 3300053085 Bacteria 1686
369 Ga0495619_0164570 3300053085 Bacteria 1533
370 Ga0495619_0234083 3300053085 Unclassified 1273
371 Ga0501084_0526050 3300054114 Bacteria 1000
372 Ga0501082_0101180 3300060353 Bacteria 2493
373 Ga0466962_0001750 3300061719 Bacteria 10213
374 Ga0466962_0076925 3300061719 Bacteria 1595
375 Ga0466959_0034131
376 Ga0070658_10022886
377 Ga0070658_10089706
378 Ga0070658_10098767
379 Ga0070658_10477013
380 Ga0070683_100018974
381 Ga0070683_100072264
382 Ga0070683_100878592
383 Ga0070680_100020497
384 Ga0070680_100301483
385 Ga0068868_100473619
386 Ga0070660_100005650
387 Ga0070660_100046379
388 Ga0070660_100065879
389 Ga0070660_100377901
390 Ga0070661_100024932
391 Ga0070661_100052368
392 Ga0070661_100162715
393 Ga0070659_100058187
394 Ga0070667_100004071
395 Ga0070713_100338849
396 Ga0070711_100075281
397 Ga0070694_100085115
398 Ga0070663_100222707
399 Ga0070681_10017064
400 Ga0070681_10048148
401 Ga0070681_10097088
402 Ga0070681_10184720
403 Ga0070681_10409448
404 Ga0070679_100033283
405 Ga0070679_100081140
406 Ga0070679_100107846
407 Ga0070679_100131388
408 Ga0070679_100388710
409 Ga0070679_100399712
410 Ga0070684_100063791
411 Ga0070684_100069285
412 Ga0070684_100133131
413 Ga0070684_100147939
414 Ga0070665_100064543
415 Ga0068855_100009327
416 Ga0068855_100029008
417 Ga0068855_100074845
418 Ga0068855_100186946
419 Ga0068855_100371079
420 Ga0068855_100380556
421 Ga0068855_100812732
422 Ga0068857_100042898
423 Ga0068857_100060753
424 Ga0068856_100272471
425 Ga0068852_100025736
426 Ga0068852_100026479
427 Ga0068852_100255673
428 Ga0068852_100268796
429 Ga0070717_10043433
430 Ga0070712_100021648
431 Ga0075433_10221920
432 Ga0075434_100007870
433 Ga0075435_100223364
434 Ga0105240_10052404
435 Ga0105240_10073576
436 Ga0105240_10094763
437 Ga0105240_10264099
438 Ga0105245_10029864
439 Ga0105248_10500986
440 Ga0105237_10113275
441 Ga0105237_10139933
442 Ga0105238_10072011
443 Ga0105239_10064567
444 Ga0105239_10462499
445 Ga0157373_10063948
446 Ga0157373_10358384
447 Ga0157371_10172619
448 Ga0157370_10014001
449 Ga0157370_10041061
450 Ga0157370_10051680
451 Ga0157370_10181310
452 Ga0157369_10029083
453 Ga0157369_10091319
454 Ga0157369_10119474
455 Ga0157369_10461987
456 Ga0157374_10040394
457 Ga0157372_10037160
458 Ga0157372_10066708
459 Ga0157372_10162926
460 Ga0157372_10308784
461 Ga0157372_10841762
462 Ga0197907_11074965
463 Ga0197907_11171484
464 Ga0206356_10270218
465 Ga0206354_10113511
466 Ga0206354_10438909
467 Ga0206353_10435521
468 Ga0206353_10849945
469 Ga0207705_10051058
470 Ga0207705_10068077
471 Ga0207707_10004608
472 Ga0207707_10119699
473 Ga0207707_10185769
474 Ga0207695_10063373
475 Ga0207671_10185386
476 Ga0207693_10038420
477 Ga0207663_10126540
478 Ga0207663_10159936
479 Ga0207660_10009676
480 Ga0207660_10347943
481 Ga0207657_10000610
482 Ga0207657_10007328
483 Ga0207657_10036107
484 Ga0207657_10051502
485 Ga0207657_10376775
486 Ga0207649_10020935
487 Ga0207649_10030091
488 Ga0207649_10045623
489 Ga0207652_10042811
490 Ga0207652_10049053
491 Ga0207652_10102052
492 Ga0207646_10377319
493 Ga0207694_10116299
494 Ga0207694_10456909
495 Ga0207700_10040597
496 Ga0207700_10234757
497 Ga0207664_10314424
498 Ga0207665_10290696
499 Ga0207661_10040252
500 Ga0207661_10094512
501 Ga0207661_10249910
502 Ga0207679_10029791
503 Ga0207667_10110309
504 Ga0207667_10141620
505 Ga0207667_10155426
506 Ga0207667_10189535
507 Ga0207667_10219890
508 Ga0207667_10228543
509 Ga0207667_10268892
510 Ga0207667_10512890
511 Ga0207667_10557346
512 Ga0207667_10747673
513 Ga0207640_10050959
514 Ga0207658_10031488
515 Ga0207639_10157710
516 Ga0207678_10375573
517 Ga0207702_10102599
518 Ga0207702_10112955
519 Ga0207702_10284382
520 Ga0207674_10020357
521 Ga0207674_10042724
522 Ga0207674_10052082
523 Ga0207683_10487711
524 Ga0207698_10014358
525 Ga0207698_10069301
526 Ga0207698_10171341
527 Ga0207698_10177670
528 Ga0207698_10411021
529 Ga0268266_10058938
530 Ga0265334_10034976
531 Ga0265318_10075781
532 Ga0265338_10029160
533 Ga0265320_10022772
534 Ga0265325_10028088
535 Ga0265340_10065480
536 Ga0265327_10034341
537 Ga0265316_10046610
538 Ga0265313_10014003
539 Ga0265314_10021866
540 Ga0265314_10193821
541 Ga0265342_10072456
542 Ga0373944_0004868
543 Ga0373945_0000929
544 Ga0373945_0001630
545 Ga0373943_0000541
546 Ga0373943_0006978
547 Ga0373946_0006657
548 Ga0373946_0061417
549 Ga0373955_0089486
550 Ga0373924_0018394
551 Ga0373935_0290178
552 Ga0373927_0052153
553 Ga0373933_0012395
554 Ga0373947_0000920
555 Ga0373947_0011462
556 Ga0373947_0305113
557 Ga0373937_0071582
558 Ga0373937_0610277
559 Ga0373925_0005249
560 Ga0395899_0068451
561 Ga0395899_0203016
562 Ga0395900_0006366
563 Ga0395900_0059693
564 Ga0395900_0172942
565 Ga0395900_0355051
566 Ga0395898_0003052
567 Ga0395898_0015914
568 Ga0395898_0176201
569 Ga0395898_0310884
570 Ga0395898_0324331
571 Ga0395898_0562046
572 Ga0395905_0083187
573 Ga0395905_0168049
574 Ga0395901_0002248
575 Ga0395901_0431877
576 Ga0395901_0860016
577 Ga0436365_1076414
578 Ga0436360_0945782
579 Ga0436362_0204265
580 Ga0466969_0036331
581 Ga0466969_0135197
582 Ga0466966_0091004
583 Ga0466966_0171367
584 Ga0466961_0092072
585 Ga0466961_0120390
586 Ga0466963_0003084
587 Ga0466963_0003232
588 Ga0466963_0007320
589 Ga0466963_0044102
590 Ga0466963_0052287
591 Ga0466963_0056962
592 Ga0466963_0080260
593 Ga0466963_0140922
594 Ga0466963_0293172
595 Ga0466963_0394860
596 Ga0466971_0010913
597 Ga0466971_0043533
598 Ga0466968_0055102
599 Ga0466957_0011480
600 Ga0466957_0126738
601 Ga0466957_0235222
602 Ga0466960_0083078
603 Ga0466959_0006422
604 Ga0466959_0172839
605 Ga0466959_0225888
606 Ga0466958_0005254
607 Ga0466958_0021548
608 Ga0466958_0128460
609 Ga0466967_0010954
610 Ga0466967_0011760
611 Ga0466967_0024048
612 Ga0466967_0024940
613 Ga0466967_0034755
614 Ga0466967_0035133
615 Ga0466967_0054084
616 Ga0466967_0231801
617 Ga0466967_0352467
618 Ga0466967_0699583
619 Ga0466967_0772183
620 Ga0495592_0086169
621 Ga0495592_0221410
622 Ga0495629_0043835
623 Ga0495641_0000331
624 Ga0495641_0049655
625 Ga0495651_0031693
626 Ga0495651_0127790
627 Ga0495651_0210821
628 Ga0495653_0035813
629 Ga0495653_0166713
630 Ga0495582_0002336
631 Ga0495605_0043823
632 Ga0495639_0002368
633 Ga0495639_0014577
634 Ga0495662_0029828
635 Ga0495664_0072346
636 Ga0495594_0112725
637 Ga0495608_0002892
638 Ga0495608_0051070
639 Ga0495608_0071511
640 Ga0495618_0085067
641 Ga0495628_0057921
642 Ga0495628_0061762
643 Ga0495628_0085545
644 Ga0495628_0251524
645 Ga0495666_0198936
646 Ga0495652_0126220
647 Ga0495665_0001497
648 Ga0495640_0159427
649 Ga0495587_0054791
650 Ga0495645_0024342
651 Ga0495667_0015929
652 Ga0495667_0197894
653 Ga0495635_0027100
654 Ga0495635_0055795
655 Ga0495657_0028280
656 Ga0495657_0123156
657 Ga0495599_0017082
658 Ga0495623_0014155
659 Ga0495646_0100023
660 Ga0495647_0012937
661 Ga0495658_0001079
662 Ga0495658_0156655
663 Ga0495613_0085029
664 Ga0495613_0282448
665 Ga0495624_0001304
666 Ga0495624_0263304
667 Ga0495600_0035789
668 Ga0495600_0097695
669 Ga0495600_0390278
670 Ga0495581_0046207
671 Ga0495604_0006225
672 Ga0495604_0077139
673 Ga0495674_0011550
674 Ga0495674_0025068
675 Ga0495674_0066749
676 Ga0495674_0356045
677 Ga0495674_0421583
678 Ga0495674_0427602
679 Ga0495676_0000268
680 Ga0495680_0002726
681 Ga0495680_0010078
682 Ga0495680_0010333
683 Ga0495680_0050461
684 Ga0495675_0070311
685 Ga0495684_0003661
686 Ga0495684_0024787
687 Ga0495684_0191640
688 Ga0495593_0079591
689 Ga0496100_0007242
690 Ga0496100_0034583
691 Ga0496101_0000942
692 Ga0496101_0007104
693 Ga0496101_0214134
694 Ga0496102_0026011
695 Ga0496102_0041221
696 Ga0496102_0119618
697 Ga0496103_0004940
698 Ga0496103_0024735
699 Ga0496104_0084047
700 Ga0496104_0201884
701 Ga0496104_0207724
702 Ga0496105_0002512
703 Ga0496105_0047317
704 Ga0496105_0084539
705 Ga0496106_0000850
706 Ga0496106_0278374
707 Ga0496107_0004295
708 Ga0496107_0084928
709 Ga0496108_0007894
710 Ga0496108_0046862
711 Ga0496108_0349046
712 Ga0496109_0005751
713 Ga0496109_0119983
714 Ga0496110_0516276
715 Ga0496111_0157342
716 Ga0496112_0032371
717 Ga0496112_0038689
718 Ga0496114_0018567
719 Ga0496114_0020799
720 Ga0496114_0027964
721 Ga0496115_0001257
722 Ga0496115_0008928
723 Ga0496115_0129649
724 Ga0496115_0324040
725 Ga0496115_0334650
726 Ga0501042_0206950
727 Ga0501067_0000154
728 Ga0501069_0001465
729 Ga0501069_0076451
730 Ga0501070_0061076
731 Ga0501071_0061987
732 Ga0501074_0018627
733 Ga0501077_0014036
734 Ga0501080_0186326
735 Ga0501080_0393021
736 nmdc:mga0n895_14634_c2
737 nmdc:mga0a205_21088_c1
738 Ga0495612_0030325
739 Ga0495595_0017810
740 Ga0495595_0042750
741 Ga0495619_0019092
742 Ga0495619_0136629
743 Ga0495619_0164570
744 Ga0495619_0234083
745 Ga0501084_0526050
746 Ga0501082_0101180
747 Ga0466962_0001750
748 Ga0466962_0076925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02621

VitK2_biosynth

Menaquinone biosynthesis

26

280

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9414 3 238
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9288 3 238
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9045 3 238
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.8927 3 238
7an8-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.782 2 245
ID Description Score Start End Superfamily
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9436 65 155 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9143 65 155 3.40.190.10
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9052 3 238 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8844 3 238 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7925 63 146 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4P5QWP6-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9673 4 245 GO:0009234
GO:0016830
AF-A0A3M2FE20-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9657 1 238 GO:0009234
GO:0016830
AF-A0A538HUZ7-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9645 2 244 GO:0009234
GO:0016020
GO:0016830
AF-A0A7Y3MSU5-F1-model_v4 ABC transporter substrate-binding protein 0.9643 18 164 GO:0009234
GO:0016829
AF-A0A7X7QJQ0-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9638 3 245 GO:0009234
GO:0016830

Map