F426785

General Info

Members Datasets Scaffolds Average Seq Length
374 202 748 298

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0455353|Ga0395905_0455353_68_1039
Length 323
Sequence LLGLEYWLPNTYSPIDSSCRIINLAFDMDLRDLRYFEVMAKLEHVGKASEQLHRTQPALTGCVRRLEQECGAPLFEKAGRGIRLTAAGKVLLKWAQRMRFDVEDARNEIASLGRGLSGHVRIGIVPTAAQFLLPPVARQLLRDAPEVTLRTVVGLIDMLKPLLRSGELDLMVGTESPPEDGFVSQMLAEDAIVVAASATHELFDVRPTLRDLTHYRWALQPPGAPTRDWLDHTFDRRRLPRPRVQVESTMLLMLPTLIAETGLLSFISRHHLEEKQRGSKLKEIALKETTMKRRLVVTHRANGYLSPAAARLITLLSDAHKSS

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
191 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
194 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
195 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
199 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
200 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
201 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
202 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.04
Nodule 0
Rhizoplane 4.28
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0455353 3300037471 Bacteria 1178
2 JGI25152J39213_1001786 3300002773 Bacteria 8753
3 JGI25150J39212_1004953 3300002774 Bacteria 2891
4 JGI25159J45721_1000054 3300002987 Bacteria 56576
5 JGI25153J46596_10016809 3300003215 Bacteria 2913
6 rootH2_10026134 3300003320 Bacteria 8032
7 rootL2_10051422 3300003322 Bacteria 10607
8 rootL2_10124933 3300003322 Bacteria 3891
9 rootH1_10013149 3300003323 Bacteria 7009
10 rootH1_10114801 3300003323 Bacteria 3605
11 JGI25160J50197_1000088 3300003354 Bacteria 93050
12 JGI25160J50197_1000119 3300003354 Bacteria 71366
13 JGI25161J50226_1000056 3300003374 Bacteria 103097
14 Ga0055526_1026147 3300003771 Bacteria 1851
15 Ga0055530_10019631 3300003791 Bacteria 2042
16 Ga0055530_10030551 3300003791 Bacteria 1425
17 Ga0055543_1000719 3300004625 Bacteria 16780
18 Ga0065165_1002517 3300005262 Bacteria 15273
19 Ga0065165_1004463 3300005262 Bacteria 8652
20 Ga0070658_10399168 3300005327 Bacteria 1181
21 Ga0070676_10013313 3300005328 Bacteria 4507
22 Ga0070676_10082920 3300005328 Bacteria 1949
23 Ga0070676_10094407 3300005328 Bacteria 1838
24 Ga0070676_10212148 3300005328 Bacteria 1275
25 Ga0070670_100017853 3300005331 Bacteria 6089
26 Ga0070670_100034030 3300005331 Bacteria 4387
27 Ga0070670_100045060 3300005331 Bacteria 3791
28 Ga0070670_100060363 3300005331 Bacteria 3255
29 Ga0070670_100192001 3300005331 Bacteria 1774
30 Ga0070677_10071663 3300005333 Bacteria 1459
31 Ga0070677_10081311 3300005333 Bacteria 1387
32 Ga0068869_100027900 3300005334 Bacteria 3940
33 Ga0068869_100077372 3300005334 Bacteria 2475
34 Ga0070666_10075298 3300005335 Bacteria 2301
35 Ga0068868_100048061 3300005338 Bacteria 3346
36 Ga0068868_100078999 3300005338 Bacteria 2635
37 Ga0068868_100141151 3300005338 Bacteria 1977
38 Ga0070660_100053688 3300005339 Bacteria 3109
39 Ga0070687_100258595 3300005343 Bacteria 1085
40 Ga0070661_100065779 3300005344 Bacteria 2664
41 Ga0070668_100064831 3300005347 Bacteria 2833
42 Ga0070668_100120070 3300005347 Bacteria 2100
43 Ga0070669_100009229 3300005353 Bacteria 7028
44 Ga0070669_100379765 3300005353 Bacteria 1152
45 Ga0070675_100002775 3300005354 Bacteria 13176
46 Ga0070675_100006288 3300005354 Bacteria 9115
47 Ga0070675_100051221 3300005354 Bacteria 3392
48 Ga0070675_100174876 3300005354 Bacteria 1853
49 Ga0070675_100496318 3300005354 Bacteria 1099
50 Ga0070671_100001733 3300005355 Bacteria 16582
51 Ga0070671_100043490 3300005355 Bacteria 3733
52 Ga0070671_100050893 3300005355 Bacteria 3445
53 Ga0070671_100077548 3300005355 Bacteria 2777
54 Ga0070671_100170207 3300005355 Bacteria 1842
55 Ga0070671_100300689 3300005355 Bacteria 1366
56 Ga0070673_100023924 3300005364 Bacteria 4470
57 Ga0070673_100174428 3300005364 Bacteria 1837
58 Ga0070673_100382849 3300005364 Bacteria 1254
59 Ga0070688_100127535 3300005365 Bacteria 1712
60 Ga0070659_100026231 3300005366 Bacteria 4482
61 Ga0070667_100033916 3300005367 Bacteria 4270
62 Ga0070667_100074681 3300005367 Bacteria 2892
63 Ga0070700_100021409 3300005441 Bacteria 3759
64 Ga0070663_100078905 3300005455 Bacteria 2414
65 Ga0070678_100006938 3300005456 Bacteria 6681
66 Ga0070678_100032026 3300005456 Bacteria 3634
67 Ga0070678_100114853 3300005456 Bacteria 2113
68 Ga0070678_100143418 3300005456 Bacteria 1914
69 Ga0070678_100239331 3300005456 Bacteria 1517
70 Ga0070662_100005647 3300005457 Bacteria 8001
71 Ga0070662_100034250 3300005457 Bacteria 3580
72 Ga0070662_100043885 3300005457 Bacteria 3201
73 Ga0070662_100087037 3300005457 Bacteria 2338
74 Ga0070662_100087375 3300005457 Bacteria 2334
75 Ga0068867_100002629 3300005459 Bacteria 12667
76 Ga0068867_100039081 3300005459 Bacteria 3458
77 Ga0070706_100001495 3300005467 Bacteria 24530
78 Ga0070707_100055570 3300005468 Bacteria 3795
79 Ga0070698_100457551 3300005471 Bacteria 1212
80 Ga0070684_100119211 3300005535 Bacteria 2373
81 Ga0068853_100078474 3300005539 Bacteria 2886
82 Ga0070672_100008277 3300005543 Bacteria 7106
83 Ga0070672_100084032 3300005543 Bacteria 2556
84 Ga0070672_100188654 3300005543 Bacteria 1720
85 Ga0070665_100047111 3300005548 Bacteria 4327
86 Ga0070664_100071648 3300005564 Bacteria 2970
87 Ga0070664_100305234 3300005564 Bacteria 1439
88 Ga0068857_100028768 3300005577 Bacteria 4903
89 Ga0068857_100103062 3300005577 Bacteria 2562
90 Ga0068857_100171447 3300005577 Bacteria 1973
91 Ga0068854_100081295 3300005578 Bacteria 2393
92 Ga0068854_100089082 3300005578 Bacteria 2292
93 Ga0068856_100008774 3300005614 Bacteria 9834
94 Ga0068856_100346574 3300005614 Bacteria 1504
95 Ga0070702_100014558 3300005615 Bacteria 3992
96 Ga0068852_100329870 3300005616 Bacteria 1484
97 Ga0068852_100400467 3300005616 Bacteria 1350
98 Ga0068859_100019713 3300005617 Bacteria 6773
99 Ga0068859_100101303 3300005617 Bacteria 2937
100 Ga0068864_100003054 3300005618 Bacteria 13822
101 Ga0068864_100190269 3300005618 Bacteria 1881
102 Ga0068864_100247528 3300005618 Bacteria 1653
103 Ga0068864_100697909 3300005618 Bacteria 991
104 Ga0068861_100004236 3300005719 Bacteria 9621
105 Ga0068861_100006400 3300005719 Bacteria 8023
106 Ga0068851_10008193 3300005834 Bacteria 4823
107 Ga0068851_10100462 3300005834 Bacteria 1534
108 Ga0068851_10111865 3300005834 Bacteria 1459
109 Ga0068863_100010186 3300005841 Bacteria 9142
110 Ga0068863_100096324 3300005841 Bacteria 2809
111 Ga0068863_100567453 3300005841 Bacteria 1121
112 Ga0068858_100177256 3300005842 Bacteria 2012
113 Ga0068860_100001567 3300005843 Bacteria 24631
114 Ga0068860_100169156 3300005843 Bacteria 2110
115 Ga0068860_100440568 3300005843 Bacteria 1294
116 Ga0068862_100002724 3300005844 Bacteria 15511
117 Ga0068862_100009123 3300005844 Bacteria 8211
118 Ga0068862_100110683 3300005844 Bacteria 2410
119 Ga0068862_100279818 3300005844 Bacteria 1529
120 Ga0075363_100168067 3300006048 Bacteria 1244
121 Ga0075364_10054184 3300006051 Bacteria 2623
122 Ga0075364_10136021 3300006051 Bacteria 1651
123 Ga0075362_10006079 3300006177 Bacteria 4471
124 Ga0075362_10044577 3300006177 Bacteria 1968
125 Ga0075369_10054608 3300006186 Bacteria 1735
126 Ga0075366_10006244 3300006195 Bacteria 6513
127 Ga0075366_10007756 3300006195 Bacteria 5943
128 Ga0075366_10007959 3300006195 Bacteria 5866
129 Ga0075366_10010910 3300006195 Bacteria 5113
130 Ga0075366_10048322 3300006195 Bacteria 2523
131 Ga0075366_10072696 3300006195 Bacteria 2049
132 Ga0097621_100003791 3300006237 Bacteria 10468
133 Ga0097621_100201192 3300006237 Bacteria 1729
134 Ga0075370_10000362 3300006353 Bacteria 16636
135 Ga0075370_10024421 3300006353 Bacteria 3338
136 Ga0075370_10049943 3300006353 Bacteria 2372
137 Ga0075370_10088312 3300006353 Bacteria 1787
138 Ga0068871_100044609 3300006358 Bacteria 3567
139 Ga0068871_100411360 3300006358 Unclassified 1206
140 Ga0075430_100112463 3300006846 Bacteria 2270
141 Ga0075429_100000524 3300006880 Bacteria 29113
142 Ga0068865_100035851 3300006881 Bacteria 3340
143 Ga0097620_100019712 3300006931 Bacteria 6773
144 Ga0097620_100101302 3300006931 Bacteria 2937
145 Ga0105240_10015955 3300009093 Bacteria 10188
146 Ga0105245_10005501 3300009098 Bacteria 11125
147 Ga0105245_10025220 3300009098 Bacteria 5226
148 Ga0105245_10048639 3300009098 Bacteria 3794
149 Ga0105245_10445680 3300009098 Bacteria 1302
150 Ga0105243_10002671 3300009148 Bacteria 14814
151 Ga0105243_10048876 3300009148 Bacteria 3336
152 Ga0105241_10097216 3300009174 Bacteria 2334
153 Ga0105241_10142363 3300009174 Bacteria 1954
154 Ga0105241_10291761 3300009174 Bacteria 1397
155 Ga0105248_10005796 3300009177 Bacteria 13577
156 Ga0105248_10016039 3300009177 Bacteria 8245
157 Ga0105248_10344487 3300009177 Bacteria 1678
158 Ga0105248_10452418 3300009177 Bacteria 1447
159 Ga0105237_10026935 3300009545 Bacteria 5873
160 Ga0105237_10285733 3300009545 Bacteria 1652
161 Ga0105238_10008813 3300009551 Bacteria 10092
162 Ga0105249_10031078 3300009553 Bacteria 4828
163 Ga0105249_10048252 3300009553 Unclassified 3882
164 Ga0105249_10276815 3300009553 Bacteria 1674
165 Ga0105239_10154539 3300010375 Bacteria 2562
166 Ga0157369_10191542 3300013105 Bacteria 2148
167 Ga0157374_10003503 3300013296 Bacteria 13199
168 Ga0157378_10007266 3300013297 Bacteria 9673
169 Ga0157378_10021298 3300013297 Bacteria 5699
170 Ga0157378_10100754 3300013297 Bacteria 2637
171 Ga0163162_10004491 3300013306 Bacteria 13443
172 Ga0157372_10003760 3300013307 Bacteria 16304
173 Ga0157375_10006758 3300013308 Bacteria 9990
174 Ga0157375_10008158 3300013308 Bacteria 9165
175 Ga0157375_10060513 3300013308 Bacteria 3756
176 Ga0157375_10224200 3300013308 Bacteria 2039
177 Ga0157380_10179774 3300014326 Bacteria 1857
178 Ga0182008_10003006 3300014497 Bacteria 10370
179 Ga0157377_10000013 3300014745 Bacteria 267125
180 Ga0157377_10063799 3300014745 Bacteria 2111
181 Ga0157379_10100818 3300014968 Bacteria 2592
182 Ga0157379_10130564 3300014968 Bacteria 2261
183 Ga0157379_10383161 3300014968 Bacteria 1290
184 Ga0157376_10002462 3300014969 Bacteria 12519
185 Ga0157376_10005505 3300014969 Bacteria 8855
186 Ga0182007_10001489 3300015262 Bacteria 12533
187 Ga0163161_10012811 3300017792 Bacteria 5826
188 Ga0163161_10070452 3300017792 Bacteria 2556
189 Ga0207425_1000292 3300025245 Bacteria 36526
190 Ga0209129_1000025 3300025258 Bacteria 413639
191 Ga0209673_1008791 3300025273 Bacteria 4454
192 Ga0209673_1021616 3300025273 Bacteria 2245
193 Ga0209130_1000040 3300025284 Bacteria 262926
194 Ga0209564_1000003 3300025295 Bacteria 1585848
195 Ga0209564_1000039 3300025295 Bacteria 413604
196 Ga0209758_1000163 3300025297 Bacteria 151988
197 Ga0209050_1001962 3300025298 Bacteria 19466
198 Ga0209050_1002058 3300025298 Bacteria 18542
199 Ga0207426_1000188 3300025302 Bacteria 153510
200 Ga0209051_1024709 3300025303 Bacteria 2463
201 Ga0207656_10005469 3300025321 Bacteria 4493
202 Ga0207682_10048326 3300025893 Bacteria 1754
203 Ga0207682_10056865 3300025893 Bacteria 1629
204 Ga0207680_10017391 3300025903 Bacteria 3798
205 Ga0207680_10066555 3300025903 Bacteria 2217
206 Ga0207645_10189795 3300025907 Bacteria 1350
207 Ga0207643_10017025 3300025908 Bacteria 3969
208 Ga0207705_10220644 3300025909 Bacteria 1440
209 Ga0207684_10017748 3300025910 Bacteria 6105
210 Ga0207695_10089791 3300025913 Bacteria 3089
211 Ga0207671_10043551 3300025914 Bacteria 3319
212 Ga0207657_10033941 3300025919 Bacteria 4594
213 Ga0207657_10279011 3300025919 Bacteria 1327
214 Ga0207681_10122478 3300025923 Bacteria 1909
215 Ga0207694_10111636 3300025924 Bacteria 2175
216 Ga0207650_10045946 3300025925 Bacteria 3214
217 Ga0207650_10057319 3300025925 Bacteria 2897
218 Ga0207650_10075790 3300025925 Bacteria 2540
219 Ga0207650_10129472 3300025925 Bacteria 1973
220 Ga0207650_10414990 3300025925 Bacteria 1116
221 Ga0207659_10048309 3300025926 Bacteria 3014
222 Ga0207659_10268360 3300025926 Bacteria 1391
223 Ga0207687_10020750 3300025927 Bacteria 4359
224 Ga0207687_10032884 3300025927 Bacteria 3515
225 Ga0207687_10045438 3300025927 Bacteria 3036
226 Ga0207644_10002694 3300025931 Bacteria 11450
227 Ga0207644_10033240 3300025931 Bacteria 3603
228 Ga0207644_10041838 3300025931 Bacteria 3243
229 Ga0207644_10260679 3300025931 Bacteria 1386
230 Ga0207706_10002486 3300025933 Bacteria 17973
231 Ga0207706_10121361 3300025933 Bacteria 2298
232 Ga0207706_10139077 3300025933 Bacteria 2136
233 Ga0207706_10221006 3300025933 Bacteria 1659
234 Ga0207709_10001121 3300025935 Bacteria 19644
235 Ga0207669_10304428 3300025937 Bacteria 1213
236 Ga0207669_10362481 3300025937 Bacteria 1124
237 Ga0207704_10020313 3300025938 Bacteria 3511
238 Ga0207691_10004814 3300025940 Bacteria 13056
239 Ga0207691_10010991 3300025940 Bacteria 8686
240 Ga0207711_10008644 3300025941 Bacteria 8516
241 Ga0207711_10013202 3300025941 Bacteria 6862
242 Ga0207711_10113415 3300025941 Bacteria 2413
243 Ga0207711_10623204 3300025941 Unclassified 1006
244 Ga0207689_10000927 3300025942 Bacteria 28139
245 Ga0207689_10035252 3300025942 Bacteria 4158
246 Ga0207689_10305733 3300025942 Bacteria 1318
247 Ga0207679_10053249 3300025945 Bacteria 2973
248 Ga0207679_10122511 3300025945 Bacteria 2073
249 Ga0207679_10377544 3300025945 Bacteria 1242
250 Ga0207651_10191304 3300025960 Bacteria 1632
251 Ga0207651_10202704 3300025960 Bacteria 1591
252 Ga0207712_10014876 3300025961 Bacteria 5009
253 Ga0207712_10425580 3300025961 Bacteria 1121
254 Ga0207668_10010684 3300025972 Bacteria 5555
255 Ga0207668_10262455 3300025972 Bacteria 1408
256 Ga0207640_10025309 3300025981 Bacteria 3591
257 Ga0207640_10181834 3300025981 Bacteria 1577
258 Ga0207658_10026536 3300025986 Bacteria 4062
259 Ga0207658_10119064 3300025986 Bacteria 2102
260 Ga0207658_10184752 3300025986 Bacteria 1728
261 Ga0207677_10002083 3300026023 Bacteria 10527
262 Ga0207677_10028182 3300026023 Bacteria 3547
263 Ga0207677_10071673 3300026023 Bacteria 2446
264 Ga0207677_10434537 3300026023 Bacteria 1121
265 Ga0207639_10010496 3300026041 Bacteria 6416
266 Ga0207639_10107659 3300026041 Bacteria 2265
267 Ga0207678_10001416 3300026067 Bacteria 21987
268 Ga0207678_10063234 3300026067 Bacteria 3180
269 Ga0207678_10255755 3300026067 Bacteria 1500
270 Ga0207708_10025949 3300026075 Bacteria 4433
271 Ga0207708_10191627 3300026075 Bacteria 1628
272 Ga0207702_10006503 3300026078 Bacteria 10061
273 Ga0207641_10070354 3300026088 Bacteria 3006
274 Ga0207641_10161834 3300026088 Bacteria 2035
275 Ga0207641_10434336 3300026088 Bacteria 1266
276 Ga0207641_10569421 3300026088 Bacteria 1106
277 Ga0207648_10000006 3300026089 Bacteria 223855
278 Ga0207648_10005525 3300026089 Bacteria 12740
279 Ga0207648_10008105 3300026089 Bacteria 10229
280 Ga0207648_10146738 3300026089 Bacteria 2081
281 Ga0207676_10010035 3300026095 Bacteria 6738
282 Ga0207676_10077830 3300026095 Bacteria 2684
283 Ga0207676_10148245 3300026095 Bacteria 2017
284 Ga0207676_10324224 3300026095 Bacteria 1415
285 Ga0207676_10342851 3300026095 Bacteria 1379
286 Ga0207676_10555877 3300026095 Bacteria 1097
287 Ga0207674_10050395 3300026116 Bacteria 4254
288 Ga0207674_10175416 3300026116 Bacteria 2096
289 Ga0207675_100001503 3300026118 Bacteria 23361
290 Ga0207675_100012003 3300026118 Bacteria 8096
291 Ga0207683_10017319 3300026121 Bacteria 6140
292 Ga0207683_10036719 3300026121 Bacteria 4268
293 Ga0207683_10059274 3300026121 Bacteria 3363
294 Ga0207683_10221398 3300026121 Bacteria 1724
295 Ga0207698_10251132 3300026142 Bacteria 1619
296 Ga0268266_10052974 3300028379 Bacteria 3485
297 Ga0268265_10010659 3300028380 Bacteria 6208
298 Ga0268265_10140004 3300028380 Bacteria 2024
299 Ga0268264_10009726 3300028381 Bacteria 7960
300 Ga0268264_10081556 3300028381 Bacteria 2765
301 Ga0307515_10126499 3300028794 Bacteria 2850
302 Ga0307513_10000012 3300031456 Bacteria 328865
303 Ga0307513_10074387 3300031456 Bacteria 3533
304 Ga0307408_100051311 3300031548 Bacteria 2971
305 Ga0307408_100076909 3300031548 Bacteria 2484
306 Ga0307514_10000241 3300031649 Bacteria 142059
307 Ga0307516_10006212 3300031730 Bacteria 14054
308 Ga0307516_10137897 3300031730 Bacteria 2212
309 Ga0307516_10374206 3300031730 Bacteria 1087
310 Ga0307406_10076714 3300031901 Bacteria 2209
311 Ga0307412_10023592 3300031911 Bacteria 3788
312 Ga0307412_10073104 3300031911 Bacteria 2345
313 Ga0307412_10387978 3300031911 Bacteria 1133
314 Ga0307409_100005591 3300031995 Bacteria 7269
315 Ga0307416_100107516 3300032002 Bacteria 2448
316 Ga0373932_0049147 3300035112 Bacteria 1246
317 Ga0373941_0009529 3300035115 Bacteria 2450
318 Ga0395905_0015199 3300037471 Bacteria 7321
319 Ga0451789_0321540 3300041443 Bacteria 5160
320 Ga0451795_0840045 3300041456 Bacteria 2946
321 Ga0451800_0047507 3300041459 Bacteria 4829
322 Ga0451804_0826430 3300041463 Bacteria 2204
323 Ga0466972_0004948 3300044658 Bacteria 6688
324 Ga0453684_0017647 3300044712 Bacteria 11033
325 Ga0495638_0028985 3300046460 Bacteria 3571
326 Ga0495650_0001700 3300046471 Bacteria 20252
327 Ga0495632_0001453 3300046519 Bacteria 19693
328 Ga0495642_0014615 3300046528 Bacteria 3043
329 Ga0495621_0007765 3300046539 Bacteria 3188
330 Ga0495597_0003723 3300046542 Bacteria 8703
331 Ga0495661_0002118 3300046665 Bacteria 15560
332 Ga0495687_000196 3300047443 Bacteria 87053
333 Ga0495687_004760 3300047443 Bacteria 8966
334 Ga0495626_0028598 3300048091 Bacteria 2701
335 Ga0496102_0011320 3300048905 Bacteria 7687
336 Ga0496105_0043671 3300048908 Bacteria 3697
337 Ga0496106_0013992 3300048909 Bacteria 5932
338 Ga0496107_0038781 3300048910 Bacteria 3416
339 Ga0496108_0073106 3300048911 Bacteria 2895
340 Ga0496108_0379231 3300048911 Bacteria 1235
341 Ga0496109_0022054 3300048912 Bacteria 5637
342 Ga0496109_0071998 3300048912 Bacteria 3174
343 Ga0496110_0011404 3300048913 Bacteria 7273
344 Ga0496111_0035972 3300048914 Bacteria 3540
345 Ga0496112_0199723 3300048915 Bacteria 1959
346 Ga0496113_0098280 3300048916 Bacteria 2266
347 Ga0496124_0144457 3300048927 Bacteria 1874
348 Ga0496124_0285840 3300048927 Unclassified 1200
349 nmdc:mga03n38_35151_c1 3300050490 Bacteria 2144
350 nmdc:mga0k408_10082_c1 3300050493 Bacteria 5103
351 nmdc:mga0k408_113859_c1 3300050493 Bacteria 1600
352 nmdc:mga0k408_160647_c1 3300050493 Unclassified 1339
353 nmdc:mga0k408_426_c2 3300050493 Bacteria 9284
354 nmdc:mga0k408_4893_c1 3300050493 Bacteria 7104
355 nmdc:mga06z11_37820_c1 3300050494 Bacteria 2179
356 nmdc:mga07m45_117_c1 3300050496 Bacteria 31533
357 nmdc:mga07m45_4350_c1 3300050496 Bacteria 6929
358 nmdc:mga09592_279_c1 3300050508 Bacteria 37141
359 nmdc:mga0rr50_371812_c1 3300050513 Bacteria 1204
360 nmdc:mga0sz30_15348_c1 3300050516 Bacteria 3026
361 nmdc:mga0sz30_21966_c1 3300050516 Bacteria 2587
362 Ga0500646_0007814 3300053090 Bacteria 2733
363 Ga0500569_010376 3300053109 Bacteria 2193
364 Ga0500628_001289 3300053129 Bacteria 4338
365 Ga0500652_000027 3300053131 Bacteria 98912
366 Ga0500655_001823 3300053133 Bacteria 3976
367 Ga0500577_0078854 3300053142 Bacteria 1308
368 Ga0500604_0001183 3300053151 Bacteria 7256
369 Ga0500622_0001911 3300053156 Bacteria 15717
370 2587736495 2585428058 Bacteria 6853932
371 2643972542 2643221592 Bacteria 6608788
372 2644138450 2643221625 Bacteria 6512927
373 2644273050 2643221648 Bacteria 6521465
374 2644302301 2643221654 Bacteria 5273570
375 Ga0395905_0455353
376 JGI25152J39213_1001786
377 JGI25150J39212_1004953
378 JGI25159J45721_1000054
379 JGI25153J46596_10016809
380 rootH2_10026134
381 rootL2_10051422
382 rootL2_10124933
383 rootH1_10013149
384 rootH1_10114801
385 JGI25160J50197_1000088
386 JGI25160J50197_1000119
387 JGI25161J50226_1000056
388 Ga0055526_1026147
389 Ga0055530_10019631
390 Ga0055530_10030551
391 Ga0055543_1000719
392 Ga0065165_1002517
393 Ga0065165_1004463
394 Ga0070658_10399168
395 Ga0070676_10013313
396 Ga0070676_10082920
397 Ga0070676_10094407
398 Ga0070676_10212148
399 Ga0070670_100017853
400 Ga0070670_100034030
401 Ga0070670_100045060
402 Ga0070670_100060363
403 Ga0070670_100192001
404 Ga0070677_10071663
405 Ga0070677_10081311
406 Ga0068869_100027900
407 Ga0068869_100077372
408 Ga0070666_10075298
409 Ga0068868_100048061
410 Ga0068868_100078999
411 Ga0068868_100141151
412 Ga0070660_100053688
413 Ga0070687_100258595
414 Ga0070661_100065779
415 Ga0070668_100064831
416 Ga0070668_100120070
417 Ga0070669_100009229
418 Ga0070669_100379765
419 Ga0070675_100002775
420 Ga0070675_100006288
421 Ga0070675_100051221
422 Ga0070675_100174876
423 Ga0070675_100496318
424 Ga0070671_100001733
425 Ga0070671_100043490
426 Ga0070671_100050893
427 Ga0070671_100077548
428 Ga0070671_100170207
429 Ga0070671_100300689
430 Ga0070673_100023924
431 Ga0070673_100174428
432 Ga0070673_100382849
433 Ga0070688_100127535
434 Ga0070659_100026231
435 Ga0070667_100033916
436 Ga0070667_100074681
437 Ga0070700_100021409
438 Ga0070663_100078905
439 Ga0070678_100006938
440 Ga0070678_100032026
441 Ga0070678_100114853
442 Ga0070678_100143418
443 Ga0070678_100239331
444 Ga0070662_100005647
445 Ga0070662_100034250
446 Ga0070662_100043885
447 Ga0070662_100087037
448 Ga0070662_100087375
449 Ga0068867_100002629
450 Ga0068867_100039081
451 Ga0070706_100001495
452 Ga0070707_100055570
453 Ga0070698_100457551
454 Ga0070684_100119211
455 Ga0068853_100078474
456 Ga0070672_100008277
457 Ga0070672_100084032
458 Ga0070672_100188654
459 Ga0070665_100047111
460 Ga0070664_100071648
461 Ga0070664_100305234
462 Ga0068857_100028768
463 Ga0068857_100103062
464 Ga0068857_100171447
465 Ga0068854_100081295
466 Ga0068854_100089082
467 Ga0068856_100008774
468 Ga0068856_100346574
469 Ga0070702_100014558
470 Ga0068852_100329870
471 Ga0068852_100400467
472 Ga0068859_100019713
473 Ga0068859_100101303
474 Ga0068864_100003054
475 Ga0068864_100190269
476 Ga0068864_100247528
477 Ga0068864_100697909
478 Ga0068861_100004236
479 Ga0068861_100006400
480 Ga0068851_10008193
481 Ga0068851_10100462
482 Ga0068851_10111865
483 Ga0068863_100010186
484 Ga0068863_100096324
485 Ga0068863_100567453
486 Ga0068858_100177256
487 Ga0068860_100001567
488 Ga0068860_100169156
489 Ga0068860_100440568
490 Ga0068862_100002724
491 Ga0068862_100009123
492 Ga0068862_100110683
493 Ga0068862_100279818
494 Ga0075363_100168067
495 Ga0075364_10054184
496 Ga0075364_10136021
497 Ga0075362_10006079
498 Ga0075362_10044577
499 Ga0075369_10054608
500 Ga0075366_10006244
501 Ga0075366_10007756
502 Ga0075366_10007959
503 Ga0075366_10010910
504 Ga0075366_10048322
505 Ga0075366_10072696
506 Ga0097621_100003791
507 Ga0097621_100201192
508 Ga0075370_10000362
509 Ga0075370_10024421
510 Ga0075370_10049943
511 Ga0075370_10088312
512 Ga0068871_100044609
513 Ga0068871_100411360
514 Ga0075430_100112463
515 Ga0075429_100000524
516 Ga0068865_100035851
517 Ga0097620_100019712
518 Ga0097620_100101302
519 Ga0105240_10015955
520 Ga0105245_10005501
521 Ga0105245_10025220
522 Ga0105245_10048639
523 Ga0105245_10445680
524 Ga0105243_10002671
525 Ga0105243_10048876
526 Ga0105241_10097216
527 Ga0105241_10142363
528 Ga0105241_10291761
529 Ga0105248_10005796
530 Ga0105248_10016039
531 Ga0105248_10344487
532 Ga0105248_10452418
533 Ga0105237_10026935
534 Ga0105237_10285733
535 Ga0105238_10008813
536 Ga0105249_10031078
537 Ga0105249_10048252
538 Ga0105249_10276815
539 Ga0105239_10154539
540 Ga0157369_10191542
541 Ga0157374_10003503
542 Ga0157378_10007266
543 Ga0157378_10021298
544 Ga0157378_10100754
545 Ga0163162_10004491
546 Ga0157372_10003760
547 Ga0157375_10006758
548 Ga0157375_10008158
549 Ga0157375_10060513
550 Ga0157375_10224200
551 Ga0157380_10179774
552 Ga0182008_10003006
553 Ga0157377_10000013
554 Ga0157377_10063799
555 Ga0157379_10100818
556 Ga0157379_10130564
557 Ga0157379_10383161
558 Ga0157376_10002462
559 Ga0157376_10005505
560 Ga0182007_10001489
561 Ga0163161_10012811
562 Ga0163161_10070452
563 Ga0207425_1000292
564 Ga0209129_1000025
565 Ga0209673_1008791
566 Ga0209673_1021616
567 Ga0209130_1000040
568 Ga0209564_1000003
569 Ga0209564_1000039
570 Ga0209758_1000163
571 Ga0209050_1001962
572 Ga0209050_1002058
573 Ga0207426_1000188
574 Ga0209051_1024709
575 Ga0207656_10005469
576 Ga0207682_10048326
577 Ga0207682_10056865
578 Ga0207680_10017391
579 Ga0207680_10066555
580 Ga0207645_10189795
581 Ga0207643_10017025
582 Ga0207705_10220644
583 Ga0207684_10017748
584 Ga0207695_10089791
585 Ga0207671_10043551
586 Ga0207657_10033941
587 Ga0207657_10279011
588 Ga0207681_10122478
589 Ga0207694_10111636
590 Ga0207650_10045946
591 Ga0207650_10057319
592 Ga0207650_10075790
593 Ga0207650_10129472
594 Ga0207650_10414990
595 Ga0207659_10048309
596 Ga0207659_10268360
597 Ga0207687_10020750
598 Ga0207687_10032884
599 Ga0207687_10045438
600 Ga0207644_10002694
601 Ga0207644_10033240
602 Ga0207644_10041838
603 Ga0207644_10260679
604 Ga0207706_10002486
605 Ga0207706_10121361
606 Ga0207706_10139077
607 Ga0207706_10221006
608 Ga0207709_10001121
609 Ga0207669_10304428
610 Ga0207669_10362481
611 Ga0207704_10020313
612 Ga0207691_10004814
613 Ga0207691_10010991
614 Ga0207711_10008644
615 Ga0207711_10013202
616 Ga0207711_10113415
617 Ga0207711_10623204
618 Ga0207689_10000927
619 Ga0207689_10035252
620 Ga0207689_10305733
621 Ga0207679_10053249
622 Ga0207679_10122511
623 Ga0207679_10377544
624 Ga0207651_10191304
625 Ga0207651_10202704
626 Ga0207712_10014876
627 Ga0207712_10425580
628 Ga0207668_10010684
629 Ga0207668_10262455
630 Ga0207640_10025309
631 Ga0207640_10181834
632 Ga0207658_10026536
633 Ga0207658_10119064
634 Ga0207658_10184752
635 Ga0207677_10002083
636 Ga0207677_10028182
637 Ga0207677_10071673
638 Ga0207677_10434537
639 Ga0207639_10010496
640 Ga0207639_10107659
641 Ga0207678_10001416
642 Ga0207678_10063234
643 Ga0207678_10255755
644 Ga0207708_10025949
645 Ga0207708_10191627
646 Ga0207702_10006503
647 Ga0207641_10070354
648 Ga0207641_10161834
649 Ga0207641_10434336
650 Ga0207641_10569421
651 Ga0207648_10000006
652 Ga0207648_10005525
653 Ga0207648_10008105
654 Ga0207648_10146738
655 Ga0207676_10010035
656 Ga0207676_10077830
657 Ga0207676_10148245
658 Ga0207676_10324224
659 Ga0207676_10342851
660 Ga0207676_10555877
661 Ga0207674_10050395
662 Ga0207674_10175416
663 Ga0207675_100001503
664 Ga0207675_100012003
665 Ga0207683_10017319
666 Ga0207683_10036719
667 Ga0207683_10059274
668 Ga0207683_10221398
669 Ga0207698_10251132
670 Ga0268266_10052974
671 Ga0268265_10010659
672 Ga0268265_10140004
673 Ga0268264_10009726
674 Ga0268264_10081556
675 Ga0307515_10126499
676 Ga0307513_10000012
677 Ga0307513_10074387
678 Ga0307408_100051311
679 Ga0307408_100076909
680 Ga0307514_10000241
681 Ga0307516_10006212
682 Ga0307516_10137897
683 Ga0307516_10374206
684 Ga0307406_10076714
685 Ga0307412_10023592
686 Ga0307412_10073104
687 Ga0307412_10387978
688 Ga0307409_100005591
689 Ga0307416_100107516
690 Ga0373932_0049147
691 Ga0373941_0009529
692 Ga0395905_0015199
693 Ga0451789_0321540
694 Ga0451795_0840045
695 Ga0451800_0047507
696 Ga0451804_0826430
697 Ga0466972_0004948
698 Ga0453684_0017647
699 Ga0495638_0028985
700 Ga0495650_0001700
701 Ga0495632_0001453
702 Ga0495642_0014615
703 Ga0495621_0007765
704 Ga0495597_0003723
705 Ga0495661_0002118
706 Ga0495687_000196
707 Ga0495687_004760
708 Ga0495626_0028598
709 Ga0496102_0011320
710 Ga0496105_0043671
711 Ga0496106_0013992
712 Ga0496107_0038781
713 Ga0496108_0073106
714 Ga0496108_0379231
715 Ga0496109_0022054
716 Ga0496109_0071998
717 Ga0496110_0011404
718 Ga0496111_0035972
719 Ga0496112_0199723
720 Ga0496113_0098280
721 Ga0496124_0144457
722 Ga0496124_0285840
723 nmdc:mga03n38_35151_c1
724 nmdc:mga0k408_10082_c1
725 nmdc:mga0k408_113859_c1
726 nmdc:mga0k408_160647_c1
727 nmdc:mga0k408_426_c2
728 nmdc:mga0k408_4893_c1
729 nmdc:mga06z11_37820_c1
730 nmdc:mga07m45_117_c1
731 nmdc:mga07m45_4350_c1
732 nmdc:mga09592_279_c1
733 nmdc:mga0rr50_371812_c1
734 nmdc:mga0sz30_15348_c1
735 nmdc:mga0sz30_21966_c1
736 Ga0500646_0007814
737 Ga0500569_010376
738 Ga0500628_001289
739 Ga0500652_000027
740 Ga0500655_001823
741 Ga0500577_0078854
742 Ga0500604_0001183
743 Ga0500622_0001911
744 2587736495
745 2643972542
746 2644138450
747 2644273050
748 2644302301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

30

89

0.98

PF03466

LysR_substrate

LysR substrate binding domain

113

321

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.9372 1 65
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9332 1 86
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.923 1 86
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9155 1 88
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9151 1 88
ID Description Score Start End Superfamily
af_Q57748_4_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9719 2 85 1.10.10.10
af_Q2G1Q6_4_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9647 1 83 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9556 2 71 1.10.10.10
af_P05827_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9556 1 82 1.10.10.10
af_Q2G0U3_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9535 1 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0F4JEL2-F1-model_v4 LysR family transcriptional regulator 0.9508 1 76 GO:0003677
GO:0003700
GO:0032993
AF-S5MXE1-F1-model_v4 Nitrogen assimilation regulatory protein Nac 0.9469 1 88 GO:0003677
GO:0003700
GO:2000142
AF-A0A0F4JEL2-F1-model_v4 LysR family transcriptional regulator 0.9275 1 76 GO:0003677
GO:0003700
GO:0032993
AF-A0A376JFC9-F1-model_v4 deleted 0.9158 1 89
AF-A0A6N0X1J7-F1-model_v4 LysR family transcriptional regulator 0.8899 90 295 GO:0005829
GO:0006355

Map