F426724

General Info

Members Datasets Scaffolds Average Seq Length
374 195 748 120

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10113781|Ga0207695_101137813
Length 133
Sequence VIERRVGGTLVSTRQRRELKQRLEQERARLADAVAFLERENARSIEDELGEVSASGLDNHLADTATATFDRELEGGLEEGAQQTLADVEAALRRIEDGSFGTCEVCGKPIGAERLAAIPWARLCIDDQRKADT

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.32
Metatranscriptomes 6.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.89
Rhizosphere 88.77
Stem 0
Stem Tuber 0
Unclassified 19.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10113781 3300025913 Bacteria 2682
2 rootH1_10318263 3300003323 Bacteria 2307
3 Ga0058861_11757839 3300004800 Unclassified 507
4 Ga0070658_10011556 3300005327 Bacteria 7083
5 Ga0070658_10060515 3300005327 Bacteria 3084
6 Ga0070658_10273850 3300005327 Unclassified 1436
7 Ga0070683_100014696 3300005329 Bacteria 6858
8 Ga0070683_100358178 3300005329 Bacteria 1389
9 Ga0070683_100400954 3300005329 Unclassified 1308
10 Ga0070680_100020219 3300005336 Bacteria 5282
11 Ga0070680_100107422 3300005336 Bacteria 2321
12 Ga0070680_100147622 3300005336 Bacteria 1973
13 Ga0070680_100369820 3300005336 Unclassified 1220
14 Ga0070682_100206812 3300005337 Bacteria 1388
15 Ga0070660_100003611 3300005339 Bacteria 10692
16 Ga0070660_100006608 3300005339 Bacteria 8047
17 Ga0070660_100051211 3300005339 Bacteria 3179
18 Ga0070660_100097380 3300005339 Bacteria 2327
19 Ga0070660_100279911 3300005339 Bacteria 1365
20 Ga0070661_100020146 3300005344 Bacteria 4755
21 Ga0070661_100714168 3300005344 Unclassified 817
22 Ga0070659_100068194 3300005366 Bacteria 2821
23 Ga0070659_100148416 3300005366 Bacteria 1911
24 Ga0070714_100128444 3300005435 Bacteria 2263
25 Ga0070713_100137427 3300005436 Bacteria 2161
26 Ga0070713_100921185 3300005436 Unclassified 841
27 Ga0070710_10209834 3300005437 Bacteria 1234
28 Ga0070711_100059197 3300005439 Bacteria 2659
29 Ga0070711_100449266 3300005439 Bacteria 1055
30 Ga0070711_100819932 3300005439 Unclassified 790
31 Ga0070708_100401916 3300005445 Bacteria 1292
32 Ga0070663_101087086 3300005455 Bacteria 699
33 Ga0070678_100628654 3300005456 Unclassified 961
34 Ga0070678_101329672 3300005456 Bacteria 669
35 Ga0070681_10001213 3300005458 Bacteria 22417
36 Ga0070681_10053532 3300005458 Bacteria 4022
37 Ga0070681_10065555 3300005458 Bacteria 3600
38 Ga0070681_10176848 3300005458 Bacteria 2056
39 Ga0070681_10206834 3300005458 Bacteria 1880
40 Ga0070681_10276585 3300005458 Bacteria 1590
41 Ga0070679_100004486 3300005530 Bacteria 12895
42 Ga0070679_100020574 3300005530 Bacteria 6435
43 Ga0070679_100085330 3300005530 Bacteria 3144
44 Ga0070679_100136865 3300005530 Bacteria 2430
45 Ga0070679_100338167 3300005530 Bacteria 1454
46 Ga0070684_100013758 3300005535 Bacteria 6531
47 Ga0070684_100238281 3300005535 Bacteria 1662
48 Ga0070684_100674718 3300005535 Bacteria 963
49 Ga0068853_100707020 3300005539 Bacteria 961
50 Ga0068853_101297238 3300005539 Bacteria 704
51 Ga0068853_101402197 3300005539 Unclassified 676
52 Ga0068853_102362331 3300005539 Bacteria 515
53 Ga0070672_101260321 3300005543 Bacteria 659
54 Ga0070696_100006574 3300005546 Bacteria 7761
55 Ga0068855_100022769 3300005563 Bacteria 7508
56 Ga0068855_100048041 3300005563 Bacteria 5038
57 Ga0068855_100094701 3300005563 Bacteria 3443
58 Ga0068855_102019170 3300005563 Bacteria 582
59 Ga0070664_102327711 3300005564 Unclassified 508
60 Ga0068857_100044123 3300005577 Bacteria 3954
61 Ga0068857_100088246 3300005577 Bacteria 2774
62 Ga0068857_100571337 3300005577 Unclassified 1067
63 Ga0068854_100538055 3300005578 Bacteria 989
64 Ga0068856_100218148 3300005614 Bacteria 1923
65 Ga0068852_100306297 3300005616 Bacteria 1539
66 Ga0068851_10363259 3300005834 Bacteria 845
67 Ga0070717_10064666 3300006028 Bacteria 3039
68 Ga0070717_10553298 3300006028 Bacteria 1042
69 Ga0070717_10874561 3300006028 Bacteria 818
70 Ga0070717_10881285 3300006028 Bacteria 815
71 Ga0070716_100068540 3300006173 Unclassified 2076
72 Ga0070716_100113053 3300006173 Bacteria 1686
73 Ga0070712_100065860 3300006175 Bacteria 2573
74 Ga0070712_100455473 3300006175 Bacteria 1066
75 Ga0097621_100945499 3300006237 Bacteria 804
76 Ga0068871_100870321 3300006358 Bacteria 834
77 Ga0068865_101729856 3300006881 Unclassified 564
78 Ga0075435_101582677 3300007076 Bacteria 575
79 Ga0105240_10144222 3300009093 Bacteria 2843
80 Ga0105240_10168924 3300009093 Bacteria 2592
81 Ga0105240_11612204 3300009093 Bacteria 679
82 Ga0105245_10816636 3300009098 Bacteria 971
83 Ga0105243_10346085 3300009148 Bacteria 1363
84 Ga0105241_11197209 3300009174 Unclassified 719
85 Ga0105242_10050202 3300009176 Bacteria 3396
86 Ga0105242_13057307 3300009176 Bacteria 518
87 Ga0105248_10780757 3300009177 Bacteria 1078
88 Ga0105237_10039262 3300009545 Bacteria 4779
89 Ga0105237_10116600 3300009545 Bacteria 2664
90 Ga0105238_10089163 3300009551 Bacteria 3071
91 Ga0105238_10123201 3300009551 Bacteria 2572
92 Ga0105238_10649921 3300009551 Unclassified 1064
93 Ga0105238_12753496 3300009551 Bacteria 528
94 Ga0105239_10176058 3300010375 Bacteria 2393
95 Ga0105239_10686945 3300010375 Bacteria 1170
96 Ga0157373_10555740 3300013100 Bacteria 833
97 Ga0157370_10021632 3300013104 Bacteria 6408
98 Ga0157370_10064360 3300013104 Bacteria 3472
99 Ga0157370_10070570 3300013104 Bacteria 3297
100 Ga0157370_10796541 3300013104 Bacteria 860
101 Ga0157369_10155660 3300013105 Bacteria 2414
102 Ga0157369_10845119 3300013105 Bacteria 940
103 Ga0157369_10866318 3300013105 Bacteria 927
104 Ga0157374_10067355 3300013296 Bacteria 3366
105 Ga0157374_10116329 3300013296 Bacteria 2576
106 Ga0157378_12423834 3300013297 Bacteria 577
107 Ga0157372_10081192 3300013307 Bacteria 3670
108 Ga0157372_10194768 3300013307 Bacteria 2348
109 Ga0157372_10403604 3300013307 Unclassified 1592
110 Ga0157372_11405134 3300013307 Bacteria 805
111 Ga0182008_10118241 3300014497 Bacteria 1316
112 Ga0157376_11111118 3300014969 Bacteria 817
113 Ga0197907_10277863 3300020069 Bacteria 641
114 Ga0197907_11103359 3300020069 Bacteria 1014
115 Ga0197907_11267488 3300020069 Unclassified 1136
116 Ga0206356_10180693 3300020070 Bacteria 739
117 Ga0206356_10428047 3300020070 Bacteria 1987
118 Ga0206356_10523589 3300020070 Bacteria 1372
119 Ga0206356_10890757 3300020070 Bacteria 1629
120 Ga0206356_11685916 3300020070 Bacteria 3416
121 Ga0206356_11847063 3300020070 Unclassified 1185
122 Ga0206349_1775740 3300020075 Unclassified 1124
123 Ga0206352_10127840 3300020078 Bacteria 540
124 Ga0206352_10276572 3300020078 Unclassified 891
125 Ga0206350_10928494 3300020080 Unclassified 1238
126 Ga0206354_10432879 3300020081 Bacteria 3499
127 Ga0206354_10610459 3300020081 Bacteria 1696
128 Ga0206354_11508531 3300020081 Bacteria 948
129 Ga0206354_11643736 3300020081 Unclassified 1487
130 Ga0206353_10080666 3300020082 Bacteria 879
131 Ga0206353_10207671 3300020082 Bacteria 1359
132 Ga0206353_10721544 3300020082 Bacteria 1907
133 Ga0206353_11342755 3300020082 Bacteria 4133
134 Ga0206353_12056592 3300020082 Bacteria 5106
135 Ga0224712_10018854 3300022467 Bacteria 2314
136 Ga0224712_10388830 3300022467 Bacteria 664
137 Ga0207705_10021888 3300025909 Bacteria 4561
138 Ga0207654_10171179 3300025911 Unclassified 1410
139 Ga0207654_10405177 3300025911 Unclassified 949
140 Ga0207707_10002380 3300025912 Bacteria 16951
141 Ga0207707_10034890 3300025912 Bacteria 4400
142 Ga0207707_10053386 3300025912 Bacteria 3518
143 Ga0207707_10075380 3300025912 Bacteria 2943
144 Ga0207707_10136856 3300025912 Bacteria 2141
145 Ga0207707_10185716 3300025912 Bacteria 1814
146 Ga0207695_10261844 3300025913 Bacteria 1627
147 Ga0207695_10431644 3300025913 Bacteria 1201
148 Ga0207671_10054864 3300025914 Bacteria 2952
149 Ga0207693_10152990 3300025915 Bacteria 1815
150 Ga0207693_10185053 3300025915 Bacteria 1640
151 Ga0207693_11009113 3300025915 Bacteria 635
152 Ga0207663_10016856 3300025916 Bacteria 4062
153 Ga0207663_10149305 3300025916 Bacteria 1638
154 Ga0207663_11167812 3300025916 Unclassified 619
155 Ga0207660_10056310 3300025917 Bacteria 2813
156 Ga0207660_10140337 3300025917 Bacteria 1847
157 Ga0207657_10000054 3300025919 Bacteria 106767
158 Ga0207657_10001075 3300025919 Bacteria 28931
159 Ga0207657_10004160 3300025919 Bacteria 15336
160 Ga0207657_10033290 3300025919 Bacteria 4647
161 Ga0207657_10238273 3300025919 Unclassified 1453
162 Ga0207649_10058016 3300025920 Bacteria 2423
163 Ga0207649_10549294 3300025920 Bacteria 883
164 Ga0207649_11178830 3300025920 Bacteria 605
165 Ga0207652_10087828 3300025921 Bacteria 2727
166 Ga0207652_10137688 3300025921 Bacteria 2181
167 Ga0207652_10160688 3300025921 Bacteria 2014
168 Ga0207652_10166388 3300025921 Bacteria 1977
169 Ga0207652_10194527 3300025921 Bacteria 1824
170 Ga0207700_10257791 3300025928 Bacteria 1492
171 Ga0207664_10398156 3300025929 Bacteria 1224
172 Ga0207664_10968892 3300025929 Unclassified 763
173 Ga0207644_10469856 3300025931 Bacteria 1035
174 Ga0207690_10043519 3300025932 Bacteria 2955
175 Ga0207690_10300545 3300025932 Unclassified 1256
176 Ga0207690_11871138 3300025932 Unclassified 501
177 Ga0207686_10218995 3300025934 Unclassified 1373
178 Ga0207665_10952747 3300025939 Bacteria 682
179 Ga0207711_10650446 3300025941 Bacteria 983
180 Ga0207661_10524727 3300025944 Unclassified 1083
181 Ga0207667_10050745 3300025949 Bacteria 4376
182 Ga0207667_10174631 3300025949 Bacteria 2208
183 Ga0207667_10175124 3300025949 Bacteria 2204
184 Ga0207667_10340074 3300025949 Bacteria 1532
185 Ga0207640_10447363 3300025981 Bacteria 1064
186 Ga0207639_10056492 3300026041 Bacteria 3009
187 Ga0207639_11004045 3300026041 Unclassified 782
188 Ga0207639_11414781 3300026041 Bacteria 653
189 Ga0207678_10277074 3300026067 Bacteria 1439
190 Ga0207702_10032479 3300026078 Unclassified 4356
191 Ga0207702_10647223 3300026078 Bacteria 1039
192 Ga0207702_10838334 3300026078 Unclassified 910
193 Ga0207702_11385898 3300026078 Bacteria 697
194 Ga0207674_10056847 3300026116 Bacteria 3969
195 Ga0207674_10066998 3300026116 Bacteria 3615
196 Ga0207674_10675124 3300026116 Unclassified 997
197 Ga0207674_11026348 3300026116 Bacteria 794
198 Ga0207674_12279486 3300026116 Unclassified 504
199 Ga0207683_11950143 3300026121 Bacteria 536
200 Ga0207698_10312119 3300026142 Bacteria 1469
201 Ga0207698_10885060 3300026142 Bacteria 899
202 Ga0268266_10253992 3300028379 Unclassified 1627
203 Ga0265326_10037102 3300028558 Bacteria 1386
204 Ga0265318_10203557 3300028577 Bacteria 723
205 Ga0265323_10143588 3300028653 Bacteria 767
206 Ga0265322_10049273 3300028654 Bacteria 1196
207 Ga0265338_10047045 3300028800 Bacteria 3944
208 Ga0265338_10082470 3300028800 Bacteria 2692
209 Ga0265330_10282877 3300031235 Bacteria 699
210 Ga0265328_10036063 3300031239 Bacteria 1828
211 Ga0265339_10359387 3300031249 Bacteria 685
212 Ga0265331_10033448 3300031250 Bacteria 2542
213 Ga0265327_10016624 3300031251 Bacteria 4661
214 Ga0265327_10080450 3300031251 Bacteria 1611
215 Ga0265316_10031777 3300031344 Bacteria 4313
216 Ga0265313_10019644 3300031595 Bacteria 3753
217 Ga0316575_10351646 3300031665 Unclassified 628
218 Ga0265314_10002229 3300031711 Bacteria 20166
219 Ga0265314_10093848 3300031711 Bacteria 1947
220 Ga0265342_10015926 3300031712 Bacteria 4930
221 Ga0316576_10007295 3300031727 Bacteria 6947
222 Ga0316576_10039269 3300031727 Bacteria 3397
223 Ga0316578_10166400 3300031728 Bacteria 1329
224 Ga0373934_0298463 3300035086 Bacteria 668
225 Ga0373944_0050186 3300035089 Unclassified 1313
226 Ga0373936_0009649 3300035113 Bacteria 3638
227 Ga0373956_0089361 3300035119 Unclassified 1420
228 Ga0373943_0001881 3300035170 Bacteria 9492
229 Ga0373946_0218002 3300035171 Unclassified 920
230 Ga0373955_0030179 3300035172 Bacteria 2827
231 Ga0373924_0070805 3300035410 Unclassified 1471
232 Ga0373927_0370042 3300035695 Unclassified 945
233 Ga0373933_0247199 3300035724 Unclassified 1148
234 Ga0373937_0064577 3300036401 Bacteria 3367
235 Ga0373937_2019300 3300036401 Bacteria 523
236 Ga0316584_0086046 3300036712 Bacteria 2354
237 Ga0373925_0049227 3300037068 Bacteria 3141
238 Ga0395899_0023795 3300037312 Bacteria 4635
239 Ga0395900_0114172 3300037418 Bacteria 2772
240 Ga0395900_0183662 3300037418 Bacteria 2124
241 Ga0395898_0001509 3300037466 Bacteria 32076
242 Ga0395898_0091755 3300037466 Bacteria 2922
243 Ga0395905_0169448 3300037471 Bacteria 2051
244 Ga0395901_0049707 3300038443 Bacteria 4357
245 Ga0395901_0276606 3300038443 Bacteria 1745
246 Ga0436365_0338932 3300039437 Unclassified 580
247 Ga0436365_0571232 3300039437 Bacteria 517
248 Ga0436365_1929281 3300039437 Bacteria 837
249 Ga0436363_1582855 3300039450 Bacteria 2087
250 Ga0466969_0071509 3300044656 Bacteria 1668
251 Ga0466966_0210970 3300044684 Bacteria 1173
252 Ga0466966_0359682 3300044684 Bacteria 874
253 Ga0466961_0186160 3300044693 Bacteria 1288
254 Ga0466961_0263317 3300044693 Bacteria 1057
255 Ga0466963_0004394 3300044694 Bacteria 8190
256 Ga0466963_0022077 3300044694 Bacteria 4026
257 Ga0466963_0034324 3300044694 Bacteria 3300
258 Ga0466963_0138296 3300044694 Bacteria 1686
259 Ga0466963_0211501 3300044694 Bacteria 1357
260 Ga0466963_0277634 3300044694 Unclassified 1177
261 Ga0466963_0542204 3300044694 Bacteria 821
262 Ga0466963_0589497 3300044694 Unclassified 785
263 Ga0466963_0938690 3300044694 Bacteria 609
264 Ga0466964_0002988 3300044706 Bacteria 6122
265 Ga0466971_0405494 3300044719 Bacteria 665
266 Ga0466959_0026397 3300045049 Bacteria 4306
267 Ga0466959_0036589 3300045049 Bacteria 3627
268 Ga0466959_0314944 3300045049 Bacteria 1070
269 Ga0466958_0130535 3300045836 Unclassified 1578
270 Ga0466958_0457426 3300045836 Bacteria 827
271 Ga0466967_0010340 3300045976 Bacteria 6994
272 Ga0466967_0022022 3300045976 Bacteria 5190
273 Ga0466967_0059592 3300045976 Bacteria 3380
274 Ga0466967_0120211 3300045976 Bacteria 2426
275 Ga0466967_0205293 3300045976 Bacteria 1867
276 Ga0466967_0357784 3300045976 Bacteria 1414
277 Ga0466967_0399161 3300045976 Unclassified 1337
278 Ga0466967_0501271 3300045976 Bacteria 1191
279 Ga0466967_1010932 3300045976 Bacteria 828
280 Ga0466967_1111964 3300045976 Bacteria 787
281 Ga0466967_1657834 3300045976 Unclassified 637
282 Ga0495641_0092144 3300046461 Bacteria 1354
283 Ga0495651_0028003 3300046462 Unclassified 4392
284 Ga0495651_0422644 3300046462 Unclassified 866
285 Ga0495653_0235145 3300046463 Unclassified 1224
286 Ga0495664_0528532 3300046477 Bacteria 704
287 Ga0495608_0027410 3300046511 Bacteria 3876
288 Ga0495618_0304373 3300046514 Unclassified 990
289 Ga0495628_0079309 3300046516 Unclassified 2553
290 Ga0495630_0029084 3300046517 Bacteria 4107
291 Ga0495630_1011639 3300046517 Bacteria 631
292 Ga0495652_0067835 3300046529 Bacteria 2989
293 Ga0495640_0622715 3300046533 Bacteria 651
294 Ga0495587_0214478 3300046536 Unclassified 1086
295 Ga0495645_0010343 3300046543 Bacteria 6541
296 Ga0495667_0032795 3300046559 Bacteria 3477
297 Ga0495634_0513867 3300046642 Bacteria 701
298 Ga0495635_0138417 3300046663 Unclassified 1659
299 Ga0495657_0027919 3300046675 Bacteria 3974
300 Ga0495599_0168719 3300046678 Unclassified 1351
301 Ga0495599_0238077 3300046678 Unclassified 1110
302 Ga0495623_0040204 3300046679 Bacteria 2986
303 Ga0495647_0422027 3300046681 Bacteria 615
304 Ga0495658_0022928 3300046683 Bacteria 3308
305 Ga0495658_0032563 3300046683 Bacteria 2848
306 Ga0495624_0190758 3300046690 Unclassified 1247
307 Ga0495600_0362445 3300046809 Unclassified 906
308 Ga0495604_0066616 3300047317 Bacteria 2738
309 Ga0495604_0183815 3300047317 Unclassified 1461
310 Ga0495674_0221367 3300047319 Bacteria 1564
311 Ga0495674_0265940 3300047319 Unclassified 1408
312 Ga0495676_0117311 3300047321 Unclassified 1942
313 Ga0495680_0036742 3300047322 Unclassified 3929
314 Ga0495675_0080594 3300047444 Bacteria 2050
315 Ga0495684_0224154 3300047471 Unclassified 1377
316 Ga0495593_0081259 3300047673 Unclassified 1676
317 Ga0495602_0109705 3300048088 Bacteria 2244
318 Ga0495602_0261286 3300048088 Unclassified 1284
319 Ga0495614_0128600 3300048089 Unclassified 1120
320 Ga0496100_0001575 3300048903 Bacteria 11237
321 Ga0496100_0010229 3300048903 Bacteria 5306
322 Ga0496101_0012134 3300048904 Bacteria 5743
323 Ga0496101_0021975 3300048904 Bacteria 4386
324 Ga0496101_0972622 3300048904 Unclassified 668
325 Ga0496102_0077991 3300048905 Bacteria 3050
326 Ga0496102_0219062 3300048905 Bacteria 1794
327 Ga0496102_0695855 3300048905 Unclassified 939
328 Ga0496102_1083628 3300048905 Bacteria 721
329 Ga0496103_0034308 3300048906 Bacteria 3103
330 Ga0496103_0624513 3300048906 Bacteria 686
331 Ga0496104_0168608 3300048907 Bacteria 2099
332 Ga0496104_1540109 3300048907 Bacteria 568
333 Ga0496105_0000923 3300048908 Bacteria 20034
334 Ga0496106_0038949 3300048909 Bacteria 3559
335 Ga0496106_0060221 3300048909 Bacteria 2877
336 Ga0496106_0210609 3300048909 Bacteria 1548
337 Ga0496107_0018149 3300048910 Bacteria 4950
338 Ga0496108_0018060 3300048911 Bacteria 5769
339 Ga0496109_0017699 3300048912 Bacteria 6251
340 Ga0496110_0019587 3300048913 Bacteria 5698
341 Ga0496111_0057368 3300048914 Bacteria 2819
342 Ga0496112_0081215 3300048915 Bacteria 3206
343 Ga0496112_0098797 3300048915 Bacteria 2888
344 Ga0496112_0102149 3300048915 Bacteria 2837
345 Ga0496112_0224880 3300048915 Bacteria 1832
346 Ga0496112_0645454 3300048915 Bacteria 988
347 Ga0496112_0740147 3300048915 Bacteria 910
348 Ga0496113_0031613 3300048916 Bacteria 3843
349 Ga0496113_0347831 3300048916 Bacteria 1189
350 Ga0496113_1388254 3300048916 Unclassified 544
351 Ga0496114_0001536 3300048917 Bacteria 17490
352 Ga0496114_0165087 3300048917 Bacteria 1927
353 Ga0496114_0659006 3300048917 Bacteria 920
354 Ga0496115_0007667 3300048918 Bacteria 7953
355 Ga0496115_0079832 3300048918 Bacteria 2663
356 Ga0496115_0092031 3300048918 Bacteria 2479
357 Ga0501040_0260624 3300049576 Bacteria 1237
358 Ga0501043_0816122 3300049579 Bacteria 674
359 Ga0501067_0000684 3300049583 Bacteria 18236
360 Ga0501067_0053771 3300049583 Bacteria 2231
361 Ga0501069_0008637 3300049585 Bacteria 5363
362 Ga0501069_0198500 3300049585 Bacteria 1162
363 Ga0501070_0683209 3300049586 Bacteria 813
364 Ga0501070_0723968 3300049586 Bacteria 786
365 Ga0501070_1454733 3300049586 Bacteria 519
366 Ga0501075_0803598 3300049591 Bacteria 716
367 Ga0501077_0496992 3300049593 Bacteria 782
368 Ga0501080_0104688 3300049742 Bacteria 2624
369 Ga0501081_0063646 3300049743 Bacteria 2560
370 nmdc:mga0rr50_1480704_c1 3300050513 Bacteria 574
371 Ga0495601_0212156 3300053077 Unclassified 1265
372 Ga0495601_0644545 3300053077 Unclassified 678
373 Ga0495619_0025945 3300053085 Bacteria 3767
374 Ga0530510_0234185 3300061734 Bacteria 1366
375 Ga0207695_10113781
376 rootH1_10318263
377 Ga0058861_11757839
378 Ga0070658_10011556
379 Ga0070658_10060515
380 Ga0070658_10273850
381 Ga0070683_100014696
382 Ga0070683_100358178
383 Ga0070683_100400954
384 Ga0070680_100020219
385 Ga0070680_100107422
386 Ga0070680_100147622
387 Ga0070680_100369820
388 Ga0070682_100206812
389 Ga0070660_100003611
390 Ga0070660_100006608
391 Ga0070660_100051211
392 Ga0070660_100097380
393 Ga0070660_100279911
394 Ga0070661_100020146
395 Ga0070661_100714168
396 Ga0070659_100068194
397 Ga0070659_100148416
398 Ga0070714_100128444
399 Ga0070713_100137427
400 Ga0070713_100921185
401 Ga0070710_10209834
402 Ga0070711_100059197
403 Ga0070711_100449266
404 Ga0070711_100819932
405 Ga0070708_100401916
406 Ga0070663_101087086
407 Ga0070678_100628654
408 Ga0070678_101329672
409 Ga0070681_10001213
410 Ga0070681_10053532
411 Ga0070681_10065555
412 Ga0070681_10176848
413 Ga0070681_10206834
414 Ga0070681_10276585
415 Ga0070679_100004486
416 Ga0070679_100020574
417 Ga0070679_100085330
418 Ga0070679_100136865
419 Ga0070679_100338167
420 Ga0070684_100013758
421 Ga0070684_100238281
422 Ga0070684_100674718
423 Ga0068853_100707020
424 Ga0068853_101297238
425 Ga0068853_101402197
426 Ga0068853_102362331
427 Ga0070672_101260321
428 Ga0070696_100006574
429 Ga0068855_100022769
430 Ga0068855_100048041
431 Ga0068855_100094701
432 Ga0068855_102019170
433 Ga0070664_102327711
434 Ga0068857_100044123
435 Ga0068857_100088246
436 Ga0068857_100571337
437 Ga0068854_100538055
438 Ga0068856_100218148
439 Ga0068852_100306297
440 Ga0068851_10363259
441 Ga0070717_10064666
442 Ga0070717_10553298
443 Ga0070717_10874561
444 Ga0070717_10881285
445 Ga0070716_100068540
446 Ga0070716_100113053
447 Ga0070712_100065860
448 Ga0070712_100455473
449 Ga0097621_100945499
450 Ga0068871_100870321
451 Ga0068865_101729856
452 Ga0075435_101582677
453 Ga0105240_10144222
454 Ga0105240_10168924
455 Ga0105240_11612204
456 Ga0105245_10816636
457 Ga0105243_10346085
458 Ga0105241_11197209
459 Ga0105242_10050202
460 Ga0105242_13057307
461 Ga0105248_10780757
462 Ga0105237_10039262
463 Ga0105237_10116600
464 Ga0105238_10089163
465 Ga0105238_10123201
466 Ga0105238_10649921
467 Ga0105238_12753496
468 Ga0105239_10176058
469 Ga0105239_10686945
470 Ga0157373_10555740
471 Ga0157370_10021632
472 Ga0157370_10064360
473 Ga0157370_10070570
474 Ga0157370_10796541
475 Ga0157369_10155660
476 Ga0157369_10845119
477 Ga0157369_10866318
478 Ga0157374_10067355
479 Ga0157374_10116329
480 Ga0157378_12423834
481 Ga0157372_10081192
482 Ga0157372_10194768
483 Ga0157372_10403604
484 Ga0157372_11405134
485 Ga0182008_10118241
486 Ga0157376_11111118
487 Ga0197907_10277863
488 Ga0197907_11103359
489 Ga0197907_11267488
490 Ga0206356_10180693
491 Ga0206356_10428047
492 Ga0206356_10523589
493 Ga0206356_10890757
494 Ga0206356_11685916
495 Ga0206356_11847063
496 Ga0206349_1775740
497 Ga0206352_10127840
498 Ga0206352_10276572
499 Ga0206350_10928494
500 Ga0206354_10432879
501 Ga0206354_10610459
502 Ga0206354_11508531
503 Ga0206354_11643736
504 Ga0206353_10080666
505 Ga0206353_10207671
506 Ga0206353_10721544
507 Ga0206353_11342755
508 Ga0206353_12056592
509 Ga0224712_10018854
510 Ga0224712_10388830
511 Ga0207705_10021888
512 Ga0207654_10171179
513 Ga0207654_10405177
514 Ga0207707_10002380
515 Ga0207707_10034890
516 Ga0207707_10053386
517 Ga0207707_10075380
518 Ga0207707_10136856
519 Ga0207707_10185716
520 Ga0207695_10261844
521 Ga0207695_10431644
522 Ga0207671_10054864
523 Ga0207693_10152990
524 Ga0207693_10185053
525 Ga0207693_11009113
526 Ga0207663_10016856
527 Ga0207663_10149305
528 Ga0207663_11167812
529 Ga0207660_10056310
530 Ga0207660_10140337
531 Ga0207657_10000054
532 Ga0207657_10001075
533 Ga0207657_10004160
534 Ga0207657_10033290
535 Ga0207657_10238273
536 Ga0207649_10058016
537 Ga0207649_10549294
538 Ga0207649_11178830
539 Ga0207652_10087828
540 Ga0207652_10137688
541 Ga0207652_10160688
542 Ga0207652_10166388
543 Ga0207652_10194527
544 Ga0207700_10257791
545 Ga0207664_10398156
546 Ga0207664_10968892
547 Ga0207644_10469856
548 Ga0207690_10043519
549 Ga0207690_10300545
550 Ga0207690_11871138
551 Ga0207686_10218995
552 Ga0207665_10952747
553 Ga0207711_10650446
554 Ga0207661_10524727
555 Ga0207667_10050745
556 Ga0207667_10174631
557 Ga0207667_10175124
558 Ga0207667_10340074
559 Ga0207640_10447363
560 Ga0207639_10056492
561 Ga0207639_11004045
562 Ga0207639_11414781
563 Ga0207678_10277074
564 Ga0207702_10032479
565 Ga0207702_10647223
566 Ga0207702_10838334
567 Ga0207702_11385898
568 Ga0207674_10056847
569 Ga0207674_10066998
570 Ga0207674_10675124
571 Ga0207674_11026348
572 Ga0207674_12279486
573 Ga0207683_11950143
574 Ga0207698_10312119
575 Ga0207698_10885060
576 Ga0268266_10253992
577 Ga0265326_10037102
578 Ga0265318_10203557
579 Ga0265323_10143588
580 Ga0265322_10049273
581 Ga0265338_10047045
582 Ga0265338_10082470
583 Ga0265330_10282877
584 Ga0265328_10036063
585 Ga0265339_10359387
586 Ga0265331_10033448
587 Ga0265327_10016624
588 Ga0265327_10080450
589 Ga0265316_10031777
590 Ga0265313_10019644
591 Ga0316575_10351646
592 Ga0265314_10002229
593 Ga0265314_10093848
594 Ga0265342_10015926
595 Ga0316576_10007295
596 Ga0316576_10039269
597 Ga0316578_10166400
598 Ga0373934_0298463
599 Ga0373944_0050186
600 Ga0373936_0009649
601 Ga0373956_0089361
602 Ga0373943_0001881
603 Ga0373946_0218002
604 Ga0373955_0030179
605 Ga0373924_0070805
606 Ga0373927_0370042
607 Ga0373933_0247199
608 Ga0373937_0064577
609 Ga0373937_2019300
610 Ga0316584_0086046
611 Ga0373925_0049227
612 Ga0395899_0023795
613 Ga0395900_0114172
614 Ga0395900_0183662
615 Ga0395898_0001509
616 Ga0395898_0091755
617 Ga0395905_0169448
618 Ga0395901_0049707
619 Ga0395901_0276606
620 Ga0436365_0338932
621 Ga0436365_0571232
622 Ga0436365_1929281
623 Ga0436363_1582855
624 Ga0466969_0071509
625 Ga0466966_0210970
626 Ga0466966_0359682
627 Ga0466961_0186160
628 Ga0466961_0263317
629 Ga0466963_0004394
630 Ga0466963_0022077
631 Ga0466963_0034324
632 Ga0466963_0138296
633 Ga0466963_0211501
634 Ga0466963_0277634
635 Ga0466963_0542204
636 Ga0466963_0589497
637 Ga0466963_0938690
638 Ga0466964_0002988
639 Ga0466971_0405494
640 Ga0466959_0026397
641 Ga0466959_0036589
642 Ga0466959_0314944
643 Ga0466958_0130535
644 Ga0466958_0457426
645 Ga0466967_0010340
646 Ga0466967_0022022
647 Ga0466967_0059592
648 Ga0466967_0120211
649 Ga0466967_0205293
650 Ga0466967_0357784
651 Ga0466967_0399161
652 Ga0466967_0501271
653 Ga0466967_1010932
654 Ga0466967_1111964
655 Ga0466967_1657834
656 Ga0495641_0092144
657 Ga0495651_0028003
658 Ga0495651_0422644
659 Ga0495653_0235145
660 Ga0495664_0528532
661 Ga0495608_0027410
662 Ga0495618_0304373
663 Ga0495628_0079309
664 Ga0495630_0029084
665 Ga0495630_1011639
666 Ga0495652_0067835
667 Ga0495640_0622715
668 Ga0495587_0214478
669 Ga0495645_0010343
670 Ga0495667_0032795
671 Ga0495634_0513867
672 Ga0495635_0138417
673 Ga0495657_0027919
674 Ga0495599_0168719
675 Ga0495599_0238077
676 Ga0495623_0040204
677 Ga0495647_0422027
678 Ga0495658_0022928
679 Ga0495658_0032563
680 Ga0495624_0190758
681 Ga0495600_0362445
682 Ga0495604_0066616
683 Ga0495604_0183815
684 Ga0495674_0221367
685 Ga0495674_0265940
686 Ga0495676_0117311
687 Ga0495680_0036742
688 Ga0495675_0080594
689 Ga0495684_0224154
690 Ga0495593_0081259
691 Ga0495602_0109705
692 Ga0495602_0261286
693 Ga0495614_0128600
694 Ga0496100_0001575
695 Ga0496100_0010229
696 Ga0496101_0012134
697 Ga0496101_0021975
698 Ga0496101_0972622
699 Ga0496102_0077991
700 Ga0496102_0219062
701 Ga0496102_0695855
702 Ga0496102_1083628
703 Ga0496103_0034308
704 Ga0496103_0624513
705 Ga0496104_0168608
706 Ga0496104_1540109
707 Ga0496105_0000923
708 Ga0496106_0038949
709 Ga0496106_0060221
710 Ga0496106_0210609
711 Ga0496107_0018149
712 Ga0496108_0018060
713 Ga0496109_0017699
714 Ga0496110_0019587
715 Ga0496111_0057368
716 Ga0496112_0081215
717 Ga0496112_0098797
718 Ga0496112_0102149
719 Ga0496112_0224880
720 Ga0496112_0645454
721 Ga0496112_0740147
722 Ga0496113_0031613
723 Ga0496113_0347831
724 Ga0496113_1388254
725 Ga0496114_0001536
726 Ga0496114_0165087
727 Ga0496114_0659006
728 Ga0496115_0007667
729 Ga0496115_0079832
730 Ga0496115_0092031
731 Ga0501040_0260624
732 Ga0501043_0816122
733 Ga0501067_0000684
734 Ga0501067_0053771
735 Ga0501069_0008637
736 Ga0501069_0198500
737 Ga0501070_0683209
738 Ga0501070_0723968
739 Ga0501070_1454733
740 Ga0501075_0803598
741 Ga0501077_0496992
742 Ga0501080_0104688
743 Ga0501081_0063646
744 nmdc:mga0rr50_1480704_c1
745 Ga0495601_0212156
746 Ga0495601_0644545
747 Ga0495619_0025945
748 Ga0530510_0234185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

98

132

0.93

Map