F426650

General Info

Members Datasets Scaffolds Average Seq Length
374 191 356 259

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100597170|Ga0068862_1005971701
Length 295
Sequence MAWGLRLRQYLNYIFFLFSHFLKRAIILSGNKRWHKSYTWTILKMEEQTFGPRILLAVVVLIAGIWLLRLTKKWFGKFLGRKRLDPSIKPFLQGALSMVLQILLIXXXLQVLGIQMTMFAALIGAFGVAAGLALSGTLQNFTSGILILLLKPFRVGDNIIAQSQEGTVTSIQIFYTVVLTFDNRTVIVPNSKLSNEVIVNLSREGNRRMDIELKFGYNIPFEQVRDVINEAIDNADDFLKDPPSRVGIESLEADGYKVRINIWVKAHGFNDVRIAFQERLIQQFKNSSIKLPGME

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2818991444 Filimonas endophytica 3197 Isolate Unclassified
10 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
11 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
14 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
18 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
19 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
20 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.49
Nodule 0
Rhizoplane 0.27
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 9.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1730206 2162886007 Bacteria 1639
2 JGI24739J22299_10006853 3300001989 Bacteria 4290
3 JGI24739J22299_10022464 3300001989 Bacteria 2238
4 JGI24737J22298_10005329 3300001990 Bacteria 4449
5 JGI24735J21928_10000008 3300002067 Bacteria 319819
6 JGI25150J39212_1000019 3300002774 Bacteria 135244
7 JGI25151J46595_10000074 3300003187 Bacteria 135244
8 JGI25153J46596_10000056 3300003215 Bacteria 135244
9 rootH1_10128757 3300003316 Unclassified 2591
10 rootH2_10001535 3300003320 Bacteria 91957
11 rootH2_10015638 3300003320 Bacteria 1544
12 rootH2_10015843 3300003320 Bacteria 8427
13 rootH2_10021402 3300003320 Bacteria 63664
14 rootH2_10197730 3300003320 Bacteria 4706
15 rootH2_10303870 3300003320 Bacteria 1411
16 rootL2_10047432 3300003322 Bacteria 1752
17 rootL2_10154631 3300003322 Bacteria 3248
18 rootL2_10182640 3300003322 Bacteria 6724
19 rootL2_10251931 3300003322 Unclassified 2881
20 rootH1_10009422 3300003323 Bacteria 1438
21 rootH1_10014461 3300003323 Bacteria 4068
22 rootH1_10041027 3300003316 Bacteria 2323
23 rootH1_10041027 3300003323 Bacteria 12517
24 rootH1_10047160 3300003323 Bacteria 10997
25 rootH1_10065501 3300003323 Unclassified 2525
26 rootH1_10136569 3300003323 Bacteria 5641
27 rootH1_10139534 3300003323 Bacteria 7912
28 rootH1_10248936 3300003323 Bacteria 4812
29 rootH1_10311302 3300003323 Bacteria 1307
30 JGI25160J50197_1000558 3300003354 Bacteria 21115
31 Ga0055536_1000011 3300003781 Bacteria 275969
32 Ga0055536_1007346 3300003781 Bacteria 4951
33 Ga0055530_10002462 3300003791 Bacteria 11874
34 Ga0065165_1000123 3300005262 Bacteria 130852
35 Ga0065714_10002222 3300005288 Bacteria 46723
36 Ga0065714_10003705 3300005288 Bacteria 9405
37 Ga0065714_10064466 3300005288 Bacteria 64823
38 Ga0065714_10080343 3300005288 Bacteria 2446
39 Ga0065714_10089797 3300005288 Bacteria 1967
40 Ga0065704_10084462 3300005289 Bacteria 3332
41 Ga0070658_10415045 3300005327 Bacteria 1157
42 Ga0070683_100142538 3300005329 Bacteria 2270
43 Ga0070683_100304839 3300005329 Unclassified 1515
44 Ga0070670_100362345 3300005331 Bacteria 1275
45 Ga0070670_100633359 3300005331 Bacteria 958
46 Ga0070666_10000140 3300005335 Bacteria 50189
47 Ga0070680_100038065 3300005336 Bacteria 3889
48 Ga0070680_100085855 3300005336 Bacteria 2601
49 Ga0070682_100010514 3300005337 Bacteria 5252
50 Ga0068868_100014232 3300005338 Bacteria 5859
51 Ga0068868_100017914 3300005338 Bacteria 5284
52 Ga0070660_100008852 3300005339 Bacteria 7057
53 Ga0070660_100181872 3300005339 Bacteria 1701
54 Ga0070661_100059475 3300005344 Bacteria 2802
55 Ga0070661_100171375 3300005344 Unclassified 1648
56 Ga0070675_100008620 3300005354 Bacteria 7918
57 Ga0070675_100011348 3300005354 Bacteria 6973
58 Ga0070675_100044377 3300005354 Bacteria 3635
59 Ga0070673_100105424 3300005364 Bacteria 2329
60 Ga0070673_100157233 3300005364 Unclassified 1930
61 Ga0070667_100004852 3300005367 Bacteria 11265
62 Ga0070662_100000805 3300005457 Bacteria 19301
63 Ga0070662_100008063 3300005457 Bacteria 6856
64 Ga0070681_10007437 3300005458 Bacteria 10705
65 Ga0070681_10014213 3300005458 Bacteria 7921
66 Ga0070681_10039465 3300005458 Bacteria 4732
67 Ga0068867_100065409 3300005459 Bacteria 2706
68 Ga0070685_10059729 3300005466 Bacteria 2227
69 Ga0070679_100005385 3300005530 Bacteria 11852
70 Ga0070679_100218758 3300005530 Bacteria 1866
71 Ga0070684_100102223 3300005535 Bacteria 2562
72 Ga0068855_100005821 3300005563 Bacteria 15043
73 Ga0068855_100006014 3300005563 Bacteria 14799
74 Ga0068855_100030166 3300005563 Bacteria 6486
75 Ga0068855_100450754 3300005563 Bacteria 1404
76 Ga0068857_100036888 3300005577 Bacteria 4330
77 Ga0068857_100094284 3300005577 Bacteria 2680
78 Ga0068854_100061555 3300005578 Bacteria 2719
79 Ga0068856_100000063 3300005614 Bacteria 99730
80 Ga0068856_100001044 3300005614 Bacteria 29392
81 Ga0068856_100009161 3300005614 Bacteria 9624
82 Ga0068856_100266307 3300005614 Bacteria 1729
83 Ga0068856_100369076 3300005614 Bacteria 1454
84 Ga0068852_100002463 3300005616 Bacteria 12742
85 Ga0068852_100023899 3300005616 Bacteria 4930
86 Ga0068852_100028473 3300005616 Bacteria 4574
87 Ga0068852_100231178 3300005616 Bacteria 1763
88 Ga0068852_100469781 3300005616 Unclassified 1248
89 Ga0068859_100000106 3300005617 Bacteria 78128
90 Ga0068859_100021257 3300005617 Bacteria 6512
91 Ga0068864_100007219 3300005618 Bacteria 9132
92 Ga0068864_100297579 3300005618 Bacteria 1510
93 Ga0068851_10115775 3300005834 Bacteria 1436
94 Ga0068863_100004688 3300005841 Bacteria 13472
95 Ga0068858_100005716 3300005842 Bacteria 12154
96 Ga0068860_100001506 3300005843 Bacteria 25119
97 Ga0068860_100002082 3300005843 Bacteria 21091
98 Ga0068862_100597170 3300005844 Unclassified 1059
99 Ga0075366_10000769 3300006195 Bacteria 15276
100 Ga0075366_10070229 3300006195 Bacteria 2085
101 Ga0075366_10105107 3300006195 Bacteria 1697
102 Ga0097621_100003461 3300006237 Bacteria 10879
103 Ga0097621_100025362 3300006237 Bacteria 4637
104 Ga0068871_100003544 3300006358 Bacteria 10736
105 Ga0068871_100066222 3300006358 Bacteria 2960
106 Ga0068871_100181580 3300006358 Bacteria 1808
107 Ga0068865_100161524 3300006881 Bacteria 1710
108 Ga0097620_100000106 3300006931 Bacteria 78128
109 Ga0097620_100021257 3300006931 Bacteria 6512
110 Ga0105240_10016885 3300009093 Bacteria 9865
111 Ga0105240_10022532 3300009093 Bacteria 8347
112 Ga0105240_10081898 3300009093 Bacteria 3964
113 Ga0105240_10111338 3300009093 Bacteria 3312
114 Ga0111539_10015066 3300009094 Bacteria 9636
115 Ga0105245_10113070 3300009098 Bacteria 2528
116 Ga0105247_10002808 3300009101 Bacteria 11650
117 Ga0114129_10002230 3300009147 Bacteria 26734
118 Ga0105241_10004620 3300009174 Bacteria 10185
119 Ga0105241_10042491 3300009174 Bacteria 3439
120 Ga0105242_10591076 3300009176 Bacteria 1071
121 Ga0105237_10001192 3300009545 Bacteria 34799
122 Ga0105237_10001327 3300009545 Bacteria 32820
123 Ga0105237_10014907 3300009545 Bacteria 8105
124 Ga0105237_10025802 3300009545 Bacteria 6009
125 Ga0105237_10041470 3300009545 Bacteria 4642
126 Ga0105237_10056570 3300009545 Unclassified 3926
127 Ga0105249_10085502 3300009553 Bacteria 2939
128 Ga0105239_10000006 3300010375 Bacteria 442319
129 Ga0105239_10026080 3300010375 Bacteria 6434
130 Ga0105239_10026347 3300010375 Bacteria 6398
131 Ga0105239_10070140 3300010375 Bacteria 3850
132 Ga0105239_10293176 3300010375 Bacteria 1832
133 Ga0105246_10410757 3300011119 Bacteria 1127
134 Ga0105246_10586812 3300011119 Unclassified 961
135 Ga0157373_10000243 3300013100 Bacteria 44726
136 Ga0157373_10002981 3300013100 Bacteria 12815
137 Ga0157371_10005728 3300013102 Bacteria 10415
138 Ga0157371_10005795 3300013102 Bacteria 10341
139 Ga0157371_10017961 3300013102 Bacteria 5241
140 Ga0157371_10024459 3300013102 Bacteria 4410
141 Ga0157371_10073172 3300013102 Bacteria 2427
142 Ga0157371_10254334 3300013102 Bacteria 1265
143 Ga0157371_10281567 3300013102 Bacteria 1201
144 Ga0157370_10005099 3300013104 Bacteria 14819
145 Ga0157370_10017500 3300013104 Bacteria 7231
146 Ga0157370_10018669 3300013104 Bacteria 6972
147 Ga0157370_10052083 3300013104 Unclassified 3908
148 Ga0157370_10165457 3300013104 Bacteria 2057
149 Ga0157370_10242100 3300013104 Bacteria 1669
150 Ga0157370_10513440 3300013104 Bacteria 1100
151 Ga0157370_10563409 3300013104 Bacteria 1044
152 Ga0157370_10674090 3300013104 Bacteria 944
153 Ga0157370_10688588 3300013104 Unclassified 933
154 Ga0157369_10000460 3300013105 Bacteria 54042
155 Ga0157369_10019401 3300013105 Bacteria 7607
156 Ga0157369_10058155 3300013105 Bacteria 4171
157 Ga0157369_10094947 3300013105 Bacteria 3183
158 Ga0157374_10000809 3300013296 Bacteria 27407
159 Ga0157374_10010238 3300013296 Bacteria 8064
160 Ga0157378_10001820 3300013297 Bacteria 19117
161 Ga0157378_10022055 3300013297 Bacteria 5601
162 Ga0157378_10353983 3300013297 Bacteria 1435
163 Ga0157378_10866833 3300013297 Bacteria 932
164 Ga0163162_10000177 3300013306 Bacteria 58576
165 Ga0163162_10001924 3300013306 Bacteria 19554
166 Ga0163162_10008126 3300013306 Bacteria 10240
167 Ga0163162_10185108 3300013306 Bacteria 2209
168 Ga0163162_10902595 3300013306 Bacteria 997
169 Ga0157372_10001124 3300013307 Bacteria 29079
170 Ga0157372_10012048 3300013307 Bacteria 9209
171 Ga0157372_10015222 3300013307 Bacteria 8239
172 Ga0157372_10017471 3300013307 Bacteria 7700
173 Ga0157372_10071025 3300013307 Bacteria 3919
174 Ga0157372_10089201 3300013307 Bacteria 3503
175 Ga0157372_10173416 3300013307 Bacteria 2495
176 Ga0157372_10186284 3300013307 Bacteria 2404
177 Ga0157372_10222402 3300013307 Unclassified 2188
178 Ga0157372_10246615 3300013307 Unclassified 2073
179 Ga0157372_10258301 3300013307 Bacteria 2023
180 Ga0157372_10437185 3300013307 Bacteria 1525
181 Ga0157372_10554670 3300013307 Bacteria 1339
182 Ga0157375_10233766 3300013308 Bacteria 1997
183 Ga0157375_10626609 3300013308 Bacteria 1233
184 Ga0163163_10031317 3300014325 Bacteria 5133
185 Ga0163163_10108673 3300014325 Bacteria 2801
186 Ga0163163_10469676 3300014325 Bacteria 1319
187 Ga0157380_10232168 3300014326 Bacteria 1658
188 Ga0182008_10000592 3300014497 Bacteria 26709
189 Ga0157379_10015967 3300014968 Bacteria 6601
190 Ga0157379_10289237 3300014968 Bacteria 1492
191 Ga0157376_10002017 3300014969 Bacteria 13609
192 Ga0157376_10032558 3300014969 Bacteria 4187
193 Ga0182006_1000493 3300015261 Bacteria 30741
194 Ga0182006_1002256 3300015261 Bacteria 10652
195 Ga0182007_10000001 3300015262 Bacteria 1127301
196 Ga0163161_10001114 3300017792 Bacteria 20290
197 Ga0163161_10001368 3300017792 Bacteria 18086
198 Ga0163161_10047719 3300017792 Bacteria 3092
199 Ga0163161_10274139 3300017792 Bacteria 1321
200 Ga0213876_10003829 3300021384 Bacteria 8521
201 Ga0207425_1000007 3300025245 Bacteria 777411
202 Ga0209026_1000305 3300025250 Bacteria 53618
203 Ga0209026_1001310 3300025250 Bacteria 11212
204 Ga0209129_1000006 3300025258 Bacteria 777761
205 Ga0209676_1000001 3300025292 Bacteria 1852142
206 Ga0209676_1000984 3300025292 Bacteria 34022
207 Ga0209025_1000025 3300025294 Bacteria 524454
208 Ga0209758_1000016 3300025297 Bacteria 778557
209 Ga0209050_1000016 3300025298 Bacteria 729149
210 Ga0209050_1032502 3300025298 Bacteria 1604
211 Ga0207426_1000002 3300025302 Bacteria 1249660
212 Ga0207710_10024169 3300025900 Bacteria 2615
213 Ga0207680_10007467 3300025903 Bacteria 5333
214 Ga0207647_10007618 3300025904 Bacteria 7800
215 Ga0207647_10050923 3300025904 Bacteria 2562
216 Ga0207705_10217337 3300025909 Bacteria 1451
217 Ga0207654_10003026 3300025911 Bacteria 8530
218 Ga0207654_10121966 3300025911 Bacteria 1638
219 Ga0207707_10002433 3300025912 Bacteria 16750
220 Ga0207707_10113495 3300025912 Bacteria 2368
221 Ga0207695_10083273 3300025913 Bacteria 3231
222 Ga0207695_10121258 3300025913 Bacteria 2582
223 Ga0207695_10218784 3300025913 Bacteria 1813
224 Ga0207671_10000103 3300025914 Bacteria 129408
225 Ga0207671_10000807 3300025914 Bacteria 39591
226 Ga0207671_10004146 3300025914 Bacteria 14009
227 Ga0207671_10042226 3300025914 Unclassified 3375
228 Ga0207660_10005457 3300025917 Bacteria 8255
229 Ga0207660_10083426 3300025917 Unclassified 2353
230 Ga0207657_10013110 3300025919 Bacteria 8142
231 Ga0207649_10050841 3300025920 Bacteria 2565
232 Ga0207652_10056451 3300025921 Unclassified 3380
233 Ga0207650_10342486 3300025925 Bacteria 1228
234 Ga0207659_10006887 3300025926 Bacteria 6989
235 Ga0207644_10058612 3300025931 Bacteria 2784
236 Ga0207690_10106095 3300025932 Bacteria 2015
237 Ga0207690_10133253 3300025932 Bacteria 1821
238 Ga0207706_10002242 3300025933 Bacteria 18857
239 Ga0207706_10003798 3300025933 Bacteria 14398
240 Ga0207706_10293243 3300025933 Unclassified 1418
241 Ga0207670_10179227 3300025936 Bacteria 1595
242 Ga0207704_10177931 3300025938 Bacteria 1534
243 Ga0207691_10065437 3300025940 Bacteria 3290
244 Ga0207689_10000853 3300025942 Bacteria 29374
245 Ga0207689_10031614 3300025942 Bacteria 4405
246 Ga0207689_10524835 3300025942 Bacteria 993
247 Ga0207667_10000023 3300025949 Bacteria 362527
248 Ga0207667_10015756 3300025949 Bacteria 8572
249 Ga0207667_10135108 3300025949 Bacteria 2540
250 Ga0207667_10172711 3300025949 Bacteria 2221
251 Ga0207651_10141864 3300025960 Bacteria 1857
252 Ga0207651_10361999 3300025960 Bacteria 1224
253 Ga0207712_10023482 3300025961 Bacteria 4070
254 Ga0207640_10168888 3300025981 Bacteria 1628
255 Ga0207658_10006072 3300025986 Bacteria 8248
256 Ga0207677_10008955 3300026023 Bacteria 5616
257 Ga0207677_10140654 3300026023 Bacteria 1847
258 Ga0207677_10175216 3300026023 Bacteria 1681
259 Ga0207703_10004644 3300026035 Bacteria 11219
260 Ga0207639_10126836 3300026041 Bacteria 2106
261 Ga0207702_10000508 3300026078 Bacteria 43847
262 Ga0207702_10168988 3300026078 Bacteria 2003
263 Ga0207702_10238712 3300026078 Bacteria 1702
264 Ga0207702_10483829 3300026078 Bacteria 1205
265 Ga0207641_10000082 3300026088 Bacteria 138385
266 Ga0207641_10035840 3300026088 Bacteria 4137
267 Ga0207676_10051420 3300026095 Bacteria 3217
268 Ga0207676_10433633 3300026095 Bacteria 1235
269 Ga0207676_10604247 3300026095 Bacteria 1054
270 Ga0207674_10039689 3300026116 Bacteria 4880
271 Ga0207674_10048530 3300026116 Bacteria 4345
272 Ga0207698_10068689 3300026142 Bacteria 2799
273 Ga0207698_10621619 3300026142 Bacteria 1067
274 Ga0268264_10000810 3300028381 Bacteria 33689
275 Ga0268264_10002219 3300028381 Bacteria 17224
276 Ga0316181_1159428 3300030744 Bacteria 1576
277 Ga0307408_100000151 3300031548 Bacteria 77679
278 Ga0307408_100054109 3300031548 Bacteria 2901
279 Ga0307408_100062094 3300031548 Bacteria 2729
280 Ga0307405_10000010 3300031731 Bacteria 250978
281 Ga0307407_10000042 3300031903 Bacteria 65025
282 Ga0307412_10004292 3300031911 Bacteria 7947
283 Ga0307412_10010441 3300031911 Bacteria 5348
284 Ga0307412_10066314 3300031911 Bacteria 2446
285 Ga0307409_100393708 3300031995 Bacteria 1321
286 Ga0307409_100610418 3300031995 Bacteria 1079
287 Ga0307416_100000216 3300032002 Bacteria 30247
288 Ga0307414_10003794 3300032004 Bacteria 8120
289 Ga0307414_10006355 3300032004 Bacteria 6583
290 Ga0307414_10011264 3300032004 Bacteria 5235
291 Ga0307414_10013497 3300032004 Bacteria 4867
292 Ga0307414_10056983 3300032004 Bacteria 2744
293 Ga0395899_0000050 3300037312 Bacteria 224591
294 Ga0395899_0030182 3300037312 Unclassified 4078
295 Ga0395900_0000048 3300037418 Bacteria 227760
296 Ga0395900_0012592 3300037418 Bacteria 8654
297 Ga0395900_0189371 3300037418 Bacteria 2088
298 Ga0395900_0304385 3300037418 Bacteria 1579
299 Ga0395898_0036798 3300037466 Bacteria 4858
300 Ga0395905_0001400 3300037471 Bacteria 29214
301 Ga0395905_0110435 3300037471 Bacteria 2582
302 Ga0395901_0099629 3300038443 Unclassified 3047
303 Ga0436365_0204307 3300039437 Unclassified 2818
304 Ga0436365_0473715 3300039437 Bacteria 54513
305 Ga0451851_1141309 3300041507 Bacteria 1301
306 Ga0466969_0000258 3300044656 Bacteria 29040
307 Ga0466972_0000019 3300044658 Bacteria 198523
308 Ga0466966_0000049 3300044684 Bacteria 89046
309 Ga0466964_0323385 3300044706 Bacteria 784
310 Ga0466968_0081971 3300044735 Bacteria 1419
311 Ga0466968_0225475 3300044735 Bacteria 884
312 Ga0466970_0019084 3300044765 Bacteria 3553
313 Ga0466970_0441460 3300044765 Bacteria 745
314 Ga0466957_0000220 3300044842 Bacteria 26917
315 Ga0466959_0000195 3300045049 Bacteria 39999
316 Ga0495650_0000238 3300046471 Bacteria 110217
317 Ga0495650_0111247 3300046471 Bacteria 1017
318 Ga0495583_0040859 3300046506 Bacteria 2176
319 Ga0495606_0000008 3300046507 Bacteria 321373
320 Ga0495606_0011869 3300046507 Bacteria 7050
321 Ga0495610_0013050 3300046512 Bacteria 4958
322 Ga0495616_0031539 3300046513 Bacteria 2774
323 Ga0495643_0042877 3300046522 Unclassified 2464
324 Ga0495625_0000017 3300046660 Bacteria 299728
325 Ga0495661_0001264 3300046665 Bacteria 21758
326 Ga0495661_0073905 3300046665 Bacteria 1985
327 Ga0495649_0000008 3300046694 Bacteria 483706
328 Ga0495649_0092277 3300046694 Unclassified 1613
329 Ga0495660_0052814 3300046810 Bacteria 2207
330 Ga0495687_000631 3300047443 Bacteria 40299
331 Ga0495687_001980 3300047443 Bacteria 17467
332 Ga0495686_0000268 3300047472 Bacteria 93255
333 Ga0495686_0001710 3300047472 Bacteria 22659
334 Ga0495686_0015058 3300047472 Bacteria 5298
335 Ga0495686_0067750 3300047472 Bacteria 2203
336 Ga0495686_0074616 3300047472 Bacteria 2081
337 Ga0495686_0103164 3300047472 Bacteria 1718
338 Ga0495686_0110804 3300047472 Bacteria 1646
339 Ga0501033_0116176 3300049570 Unclassified 1944
340 Ga0501034_0127359 3300049571 Bacteria 2531
341 Ga0501223_000357 3300049663 Bacteria 11198
342 Ga0501080_0370111 3300049742 Unclassified 1292
343 Ga0501269_005033 3300049766 Unclassified 1589
344 Ga0501269_021359 3300049766 Bacteria 808
345 Ga0501035_0256690 3300049822 Unclassified 1483
346 Ga0501035_0295542 3300049822 Bacteria 1366
347 Ga0501044_0067343 3300049823 Bacteria 3648
348 nmdc:mga0k408_231152_c1 3300050493 Bacteria 1104
349 nmdc:mga0k408_29786_c1 3300050493 Unclassified 3109
350 nmdc:mga0k408_305725_c1 3300050493 Bacteria 949
351 nmdc:mga0k408_55_c2 3300050493 Bacteria 31438
352 nmdc:mga05p37_12118_c1 3300050507 Bacteria 10294
353 Ga0500594_0118192 3300053118 Bacteria 830
354 Ga0500616_0006044 3300053153 Bacteria 8036
355 Ga0500622_0000143 3300053156 Bacteria 76095
356 Ga0500627_0022347 3300053158 Bacteria 2564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10311302 rootH1_103113021 205
2 3300044706 Ga0466964_0323385 Ga0466964_0323385_37_690 205
3 3300044735 Ga0466968_0081971 Ga0466968_0081971_620_1273 205
4 3300053118 Ga0500594_0118192 Ga0500594_0118192_33_695 209
5 3300044765 Ga0466970_0441460 Ga0466970_0441460_24_692 210
6 3300013297 Ga0157378_10022055 Ga0157378_100220554 212
7 3300049766 Ga0501269_005033 Ga0501269_005033_767_1552 212
8 3300053158 Ga0500627_0022347 Ga0500627_0022347_731_1516 212
9 3300031911 Ga0307412_10010441 Ga0307412_100104412 214
10 3300005466 Ga0070685_10059729 Ga0070685_100597293 217
11 3300005834 Ga0068851_10115775 Ga0068851_101157751 217
12 3300025960 Ga0207651_10361999 Ga0207651_103619992 217
13 3300005329 Ga0070683_100304839 Ga0070683_1003048392 218
14 3300005344 Ga0070661_100171375 Ga0070661_1001713752 218
15 3300005616 Ga0068852_100469781 Ga0068852_1004697811 218
16 3300044842 Ga0466957_0000220 Ga0466957_0000220_5649_6365 226
17 3300025933 Ga0207706_10293243 Ga0207706_102932432 229
18 3300005364 Ga0070673_100157233 Ga0070673_1001572333 230
19 3300011119 Ga0105246_10410757 Ga0105246_104107572 230
20 3300026023 Ga0207677_10175216 Ga0207677_101752162 230
21 3300010375 Ga0105239_10070140 Ga0105239_100701403 231
22 3300005331 Ga0070670_100633359 Ga0070670_1006333591 232
23 3300005338 Ga0068868_100014232 Ga0068868_1000142324 232
24 3300006358 Ga0068871_100181580 Ga0068871_1001815802 232
25 3300009093 Ga0105240_10022532 Ga0105240_100225322 232
26 3300013297 Ga0157378_10001820 Ga0157378_1000182010 232
27 3300026023 Ga0207677_10008955 Ga0207677_100089552 232
28 3300047472 Ga0495686_0001710 Ga0495686_0001710_20695_21468 233
29 3300049766 Ga0501269_021359 Ga0501269_021359_48_782 233
30 3300005288 Ga0065714_10089797 Ga0065714_100897972 234
31 3300032004 Ga0307414_10013497 Ga0307414_100134972 234
32 3300037312 Ga0395899_0000050 Ga0395899_0000050_123337_124158 234
33 3300041507 Ga0451851_1141309 Ga0451851_1141309_418_1158 234
34 3300003322 rootL2_10182640 rootL2_101826403 235
35 3300005841 Ga0068863_100004688 Ga0068863_1000046886 235
36 3300013104 Ga0157370_10674090 Ga0157370_106740902 235
37 3300013308 Ga0157375_10233766 Ga0157375_102337661 235
38 3300026088 Ga0207641_10035840 Ga0207641_100358402 235
39 3300026095 Ga0207676_10433633 Ga0207676_104336332 235
40 3300044658 Ga0466972_0000019 Ga0466972_0000019_153477_154256 235
41 3300044765 Ga0466970_0019084 Ga0466970_0019084_1718_2497 235
42 3300014497 Ga0182008_10000592 Ga0182008_1000059217 236
43 3300047472 Ga0495686_0067750 Ga0495686_0067750_231_977 236
44 3300003781 Ga0055536_1000011 Ga0055536_1000011204 237
45 3300003791 Ga0055530_10002462 Ga0055530_100024629 237
46 3300005339 Ga0070660_100181872 Ga0070660_1001818721 237
47 3300005367 Ga0070667_100004852 Ga0070667_1000048522 237
48 3300005617 Ga0068859_100021257 Ga0068859_1000212573 237
49 3300005618 Ga0068864_100297579 Ga0068864_1002975791 237
50 3300005843 Ga0068860_100001506 Ga0068860_10000150610 237
51 3300006931 Ga0097620_100021257 Ga0097620_1000212575 237
52 3300009176 Ga0105242_10591076 Ga0105242_105910761 237
53 3300013105 Ga0157369_10058155 Ga0157369_100581553 237
54 3300013306 Ga0163162_10185108 Ga0163162_101851082 237
55 3300013307 Ga0157372_10437185 Ga0157372_104371852 237
56 3300014325 Ga0163163_10469676 Ga0163163_104696762 237
57 3300017792 Ga0163161_10274139 Ga0163161_102741392 237
58 3300021384 Ga0213876_10003829 Ga0213876_100038293 237
59 3300025292 Ga0209676_1000001 Ga0209676_1000001750 237
60 3300025298 Ga0209050_1000016 Ga0209050_1000016415 237
61 3300025942 Ga0207689_10031614 Ga0207689_100316144 237
62 3300025986 Ga0207658_10006072 Ga0207658_100060725 237
63 3300026095 Ga0207676_10604247 Ga0207676_106042471 237
64 3300028381 Ga0268264_10002219 Ga0268264_1000221911 237
65 3300032004 Ga0307414_10011264 Ga0307414_100112645 237
66 3300039437 Ga0436365_0473715 Ga0436365_0473715_7762_8550 237
67 3300003323 rootH1_10014461 rootH1_100144615 238
68 3300005288 Ga0065714_10003705 Ga0065714_100037056 238
69 3300015261 Ga0182006_1002256 Ga0182006_10022566 238
70 3300025909 Ga0207705_10217337 Ga0207705_102173371 238
71 3300031903 Ga0307407_10000042 Ga0307407_1000004211 238
72 3300031995 Ga0307409_100610418 Ga0307409_1006104181 238
73 3300032002 Ga0307416_100000216 Ga0307416_10000021611 238
74 3300032004 Ga0307414_10003794 Ga0307414_100037948 238
75 3300003316 rootH1_10128757 rootH1_101287572 239
76 3300005458 Ga0070681_10007437 Ga0070681_1000743710 239
77 3300005616 Ga0068852_100231178 Ga0068852_1002311782 239
78 3300013104 Ga0157370_10018669 Ga0157370_100186695 239
79 3300013105 Ga0157369_10094947 Ga0157369_100949472 239
80 3300031731 Ga0307405_10000010 Ga0307405_1000001012 239
81 3300003320 rootH2_10021402 rootH2_1002140235 240
82 3300013104 Ga0157370_10005099 Ga0157370_100050995 240
83 3300013104 Ga0157370_10017500 Ga0157370_100175006 240
84 3300013105 Ga0157369_10000460 Ga0157369_1000046027 240
85 3300013307 Ga0157372_10089201 Ga0157372_100892013 240
86 3300013307 Ga0157372_10186284 Ga0157372_101862843 240
87 3300015261 Ga0182006_1000493 Ga0182006_100049313 240
88 3300015262 Ga0182007_10000001 Ga0182007_10000001337 240
89 3300017792 Ga0163161_10001114 Ga0163161_100011143 240
90 3300026142 Ga0207698_10621619 Ga0207698_106216191 240
91 3300046694 Ga0495649_0092277 Ga0495649_0092277_88_876 240
92 3300005336 Ga0070680_100085855 Ga0070680_1000858552 241
93 3300025917 Ga0207660_10083426 Ga0207660_100834264 241
94 3300049570 Ga0501033_0116176 Ga0501033_0116176_391_1176 241
95 3300049571 Ga0501034_0127359 Ga0501034_0127359_761_1546 241
96 3300049742 Ga0501080_0370111 Ga0501080_0370111_436_1221 241
97 3300049822 Ga0501035_0256690 Ga0501035_0256690_354_1139 241
98 3300049823 Ga0501044_0067343 Ga0501044_0067343_894_1679 241
99 iso_pu_bacteria 2896109856 2896115061 241
100 3300005364 Ga0070673_100105424 Ga0070673_1001054243 242
101 3300013297 Ga0157378_10866833 Ga0157378_108668331 242
102 3300025960 Ga0207651_10141864 Ga0207651_101418642 242
103 3300005614 Ga0068856_100369076 Ga0068856_1003690761 243
104 3300026078 Ga0207702_10483829 Ga0207702_104838291 243
105 3300053153 Ga0500616_0006044 Ga0500616_0006044_2802_3587 243
106 3300009093 Ga0105240_10081898 Ga0105240_100818983 244
107 3300009545 Ga0105237_10001327 Ga0105237_1000132721 244
108 3300025913 Ga0207695_10218784 Ga0207695_102187843 244
109 3300025914 Ga0207671_10000807 Ga0207671_1000080734 244
110 3300025926 Ga0207659_10006887 Ga0207659_100068874 244
111 3300003323 rootH1_10041027 rootH1_1004102710 245
112 3300047472 Ga0495686_0000268 Ga0495686_0000268_42260_43036 245
113 iso_pu_bacteria 2522125168 2522550868 246
114 iso_pu_bacteria 2599185184 2599476789 246
115 iso_pu_bacteria 2842903701 2842906196 246
116 iso_pu_bacteria 2928078545 2928078696 246
117 iso_pu_bacteria 2928147474 2928151626 246
118 iso_pu_bacteria 2929154850 2929159982 246
119 iso_pu_bacteria 2932082852 2932084259 246
120 3300005459 Ga0068867_100065409 Ga0068867_1000654092 247
121 3300006195 Ga0075366_10105107 Ga0075366_101051072 247
122 3300047472 Ga0495686_0074616 Ga0495686_0074616_852_1637 247
123 3300047472 Ga0495686_0103164 Ga0495686_0103164_716_1501 247
124 3300050493 nmdc:mga0k408_29786_c1 nmdc:mga0k408_29786_c1_176_961 247
125 3300003320 rootH2_10015843 rootH2_100158432 248
126 3300003322 rootL2_10154631 rootL2_101546312 248
127 3300005327 Ga0070658_10415045 Ga0070658_104150452 248
128 3300005329 Ga0070683_100142538 Ga0070683_1001425382 248
129 3300005335 Ga0070666_10000140 Ga0070666_1000014040 248
130 3300005337 Ga0070682_100010514 Ga0070682_1000105145 248
131 3300005338 Ga0068868_100017914 Ga0068868_1000179142 248
132 3300005339 Ga0070660_100008852 Ga0070660_1000088522 248
133 3300005354 Ga0070675_100044377 Ga0070675_1000443774 248
134 3300005457 Ga0070662_100008063 Ga0070662_1000080635 248
135 3300005458 Ga0070681_10039465 Ga0070681_100394655 248
136 3300005530 Ga0070679_100218758 Ga0070679_1002187582 248
137 3300005535 Ga0070684_100102223 Ga0070684_1001022232 248
138 3300005563 Ga0068855_100030166 Ga0068855_1000301666 248
139 3300005577 Ga0068857_100094284 Ga0068857_1000942842 248
140 3300005578 Ga0068854_100061555 Ga0068854_1000615552 248
141 3300005614 Ga0068856_100009161 Ga0068856_1000091617 248
142 3300005616 Ga0068852_100023899 Ga0068852_1000238993 248
143 3300005616 Ga0068852_100028473 Ga0068852_1000284735 248
144 3300005617 Ga0068859_100000106 Ga0068859_1000001068 248
145 3300005618 Ga0068864_100007219 Ga0068864_1000072197 248
146 3300005842 Ga0068858_100005716 Ga0068858_1000057162 248
147 3300005843 Ga0068860_100002082 Ga0068860_10000208214 248
148 3300006237 Ga0097621_100003461 Ga0097621_1000034613 248
149 3300006237 Ga0097621_100025362 Ga0097621_1000253625 248
150 3300006358 Ga0068871_100003544 Ga0068871_10000354410 248
151 3300006358 Ga0068871_100066222 Ga0068871_1000662224 248
152 3300006881 Ga0068865_100161524 Ga0068865_1001615242 248
153 3300006931 Ga0097620_100000106 Ga0097620_1000001068 248
154 3300009098 Ga0105245_10113070 Ga0105245_101130703 248
155 3300009101 Ga0105247_10002808 Ga0105247_100028086 248
156 3300009174 Ga0105241_10004620 Ga0105241_1000462011 248
157 3300009545 Ga0105237_10014907 Ga0105237_100149079 248
158 3300009545 Ga0105237_10025802 Ga0105237_100258024 248
159 3300009553 Ga0105249_10085502 Ga0105249_100855022 248
160 3300010375 Ga0105239_10293176 Ga0105239_102931762 248
161 3300011119 Ga0105246_10586812 Ga0105246_105868121 248
162 3300013100 Ga0157373_10002981 Ga0157373_100029814 248
163 3300013102 Ga0157371_10005795 Ga0157371_1000579510 248
164 3300013104 Ga0157370_10052083 Ga0157370_100520834 248
165 3300013105 Ga0157369_10019401 Ga0157369_100194015 248
166 3300013296 Ga0157374_10010238 Ga0157374_1001023810 248
167 3300013297 Ga0157378_10353983 Ga0157378_103539831 248
168 3300013306 Ga0163162_10001924 Ga0163162_100019244 248
169 3300013306 Ga0163162_10902595 Ga0163162_109025951 248
170 3300013307 Ga0157372_10017471 Ga0157372_100174716 248
171 3300013307 Ga0157372_10173416 Ga0157372_101734162 248
172 3300013308 Ga0157375_10626609 Ga0157375_106266091 248
173 3300014325 Ga0163163_10031317 Ga0163163_100313173 248
174 3300014968 Ga0157379_10015967 Ga0157379_100159674 248
175 3300014968 Ga0157379_10289237 Ga0157379_102892372 248
176 3300014969 Ga0157376_10002017 Ga0157376_1000201710 248
177 3300014969 Ga0157376_10032558 Ga0157376_100325583 248
178 3300025900 Ga0207710_10024169 Ga0207710_100241693 248
179 3300025903 Ga0207680_10007467 Ga0207680_100074673 248
180 3300025911 Ga0207654_10003026 Ga0207654_100030262 248
181 3300025912 Ga0207707_10113495 Ga0207707_101134952 248
182 3300025914 Ga0207671_10000103 Ga0207671_1000010334 248
183 3300025919 Ga0207657_10013110 Ga0207657_100131104 248
184 3300025921 Ga0207652_10056451 Ga0207652_100564514 248
185 3300025931 Ga0207644_10058612 Ga0207644_100586122 248
186 3300025932 Ga0207690_10133253 Ga0207690_101332532 248
187 3300025933 Ga0207706_10003798 Ga0207706_1000379814 248
188 3300025936 Ga0207670_10179227 Ga0207670_101792272 248
189 3300025938 Ga0207704_10177931 Ga0207704_101779312 248
190 3300025940 Ga0207691_10065437 Ga0207691_100654373 248
191 3300025942 Ga0207689_10000853 Ga0207689_1000085325 248
192 3300025942 Ga0207689_10524835 Ga0207689_105248351 248
193 3300025949 Ga0207667_10172711 Ga0207667_101727112 248
194 3300025961 Ga0207712_10023482 Ga0207712_100234825 248
195 3300025981 Ga0207640_10168888 Ga0207640_101688882 248
196 3300026023 Ga0207677_10140654 Ga0207677_101406542 248
197 3300026035 Ga0207703_10004644 Ga0207703_100046449 248
198 3300026041 Ga0207639_10126836 Ga0207639_101268362 248
199 3300026088 Ga0207641_10000082 Ga0207641_1000008262 248
200 3300026095 Ga0207676_10051420 Ga0207676_100514203 248
201 3300026116 Ga0207674_10039689 Ga0207674_100396894 248
202 3300028381 Ga0268264_10000810 Ga0268264_1000081030 248
203 3300046471 Ga0495650_0111247 Ga0495650_0111247_129_911 248
204 iso_pu_bacteria 2818991444 2819589795 248
205 2162886007 SwRhRL2b_contig_1730206 SwRhRL2b_0883.00002500 249
206 3300001989 JGI24739J22299_10006853 JGI24739J22299_100068535 249
207 3300001989 JGI24739J22299_10022464 JGI24739J22299_100224642 249
208 3300001990 JGI24737J22298_10005329 JGI24737J22298_100053292 249
209 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008260 249
210 3300002774 JGI25150J39212_1000019 JGI25150J39212_100001924 249
211 3300003187 JGI25151J46595_10000074 JGI25151J46595_1000007424 249
212 3300003215 JGI25153J46596_10000056 JGI25153J46596_1000005624 249
213 3300003320 rootH2_10001535 rootH2_1000153560 249
214 3300003320 rootH2_10015638 rootH2_100156381 249
215 3300003320 rootH2_10197730 rootH2_101977306 249
216 3300003320 rootH2_10303870 rootH2_103038702 249
217 3300003322 rootL2_10047432 rootL2_100474324 249
218 3300003322 rootL2_10251931 rootL2_102519315 249
219 3300003323 rootH1_10009422 rootH1_100094221 249
220 3300003323 rootH1_10047160 rootH1_100471602 249
221 3300003323 rootH1_10065501 rootH1_100655014 249
222 3300003323 rootH1_10136569 rootH1_101365695 249
223 3300003323 rootH1_10139534 rootH1_101395346 249
224 3300003323 rootH1_10248936 rootH1_102489362 249
225 3300003354 JGI25160J50197_1000558 JGI25160J50197_10005587 249
226 3300003781 Ga0055536_1007346 Ga0055536_10073465 249
227 3300005262 Ga0065165_1000123 Ga0065165_100012379 249
228 3300005288 Ga0065714_10002222 Ga0065714_1000222213 249
229 3300005288 Ga0065714_10064466 Ga0065714_1006446657 249
230 3300005288 Ga0065714_10080343 Ga0065714_100803432 249
231 3300005289 Ga0065704_10084462 Ga0065704_100844623 249
232 3300005331 Ga0070670_100362345 Ga0070670_1003623451 249
233 3300005336 Ga0070680_100038065 Ga0070680_1000380653 249
234 3300005344 Ga0070661_100059475 Ga0070661_1000594752 249
235 3300005354 Ga0070675_100008620 Ga0070675_1000086202 249
236 3300005354 Ga0070675_100011348 Ga0070675_1000113483 249
237 3300005457 Ga0070662_100000805 Ga0070662_1000008057 249
238 3300005458 Ga0070681_10014213 Ga0070681_100142137 249
239 3300005530 Ga0070679_100005385 Ga0070679_1000053854 249
240 3300005563 Ga0068855_100005821 Ga0068855_1000058212 249
241 3300005563 Ga0068855_100006014 Ga0068855_1000060143 249
242 3300005563 Ga0068855_100450754 Ga0068855_1004507541 249
243 3300005577 Ga0068857_100036888 Ga0068857_1000368884 249
244 3300005614 Ga0068856_100000063 Ga0068856_10000006372 249
245 3300005614 Ga0068856_100001044 Ga0068856_10000104416 249
246 3300005614 Ga0068856_100266307 Ga0068856_1002663072 249
247 3300005616 Ga0068852_100002463 Ga0068852_1000024633 249
248 3300005844 Ga0068862_100597170 Ga0068862_1005971701 249
249 3300006195 Ga0075366_10000769 Ga0075366_100007697 249
250 3300006195 Ga0075366_10070229 Ga0075366_100702292 249
251 3300009093 Ga0105240_10016885 Ga0105240_100168855 249
252 3300009093 Ga0105240_10111338 Ga0105240_101113382 249
253 3300009094 Ga0111539_10015066 Ga0111539_100150664 249
254 3300009147 Ga0114129_10002230 Ga0114129_1000223015 249
255 3300009174 Ga0105241_10042491 Ga0105241_100424912 249
256 3300009545 Ga0105237_10001192 Ga0105237_1000119227 249
257 3300009545 Ga0105237_10041470 Ga0105237_100414702 249
258 3300009545 Ga0105237_10056570 Ga0105237_100565705 249
259 3300010375 Ga0105239_10000006 Ga0105239_10000006366 249
260 3300010375 Ga0105239_10026080 Ga0105239_100260804 249
261 3300010375 Ga0105239_10026347 Ga0105239_100263473 249
262 3300013100 Ga0157373_10000243 Ga0157373_1000024312 249
263 3300013102 Ga0157371_10005728 Ga0157371_100057286 249
264 3300013102 Ga0157371_10017961 Ga0157371_100179617 249
265 3300013102 Ga0157371_10024459 Ga0157371_100244593 249
266 3300013102 Ga0157371_10073172 Ga0157371_100731722 249
267 3300013102 Ga0157371_10254334 Ga0157371_102543341 249
268 3300013102 Ga0157371_10281567 Ga0157371_102815672 249
269 3300013104 Ga0157370_10165457 Ga0157370_101654571 249
270 3300013104 Ga0157370_10242100 Ga0157370_102421001 249
271 3300013104 Ga0157370_10513440 Ga0157370_105134402 249
272 3300013104 Ga0157370_10563409 Ga0157370_105634091 249
273 3300013104 Ga0157370_10688588 Ga0157370_106885882 249
274 3300013296 Ga0157374_10000809 Ga0157374_1000080920 249
275 3300013306 Ga0163162_10000177 Ga0163162_1000017713 249
276 3300013306 Ga0163162_10008126 Ga0163162_1000812613 249
277 3300013307 Ga0157372_10001124 Ga0157372_1000112412 249
278 3300013307 Ga0157372_10012048 Ga0157372_100120489 249
279 3300013307 Ga0157372_10015222 Ga0157372_100152225 249
280 3300013307 Ga0157372_10071025 Ga0157372_100710252 249
281 3300013307 Ga0157372_10222402 Ga0157372_102224021 249
282 3300013307 Ga0157372_10246615 Ga0157372_102466152 249
283 3300013307 Ga0157372_10258301 Ga0157372_102583012 249
284 3300013307 Ga0157372_10554670 Ga0157372_105546701 249
285 3300014325 Ga0163163_10108673 Ga0163163_101086732 249
286 3300014326 Ga0157380_10232168 Ga0157380_102321682 249
287 3300017792 Ga0163161_10001368 Ga0163161_1000136812 249
288 3300017792 Ga0163161_10047719 Ga0163161_100477193 249
289 3300025245 Ga0207425_1000007 Ga0207425_1000007295 249
290 3300025250 Ga0209026_1000305 Ga0209026_10003052 249
291 3300025250 Ga0209026_1001310 Ga0209026_10013102 249
292 3300025258 Ga0209129_1000006 Ga0209129_1000006295 249
293 3300025292 Ga0209676_1000984 Ga0209676_10009841 249
294 3300025294 Ga0209025_1000025 Ga0209025_1000025125 249
295 3300025297 Ga0209758_1000016 Ga0209758_1000016295 249
296 3300025298 Ga0209050_1032502 Ga0209050_10325021 249
297 3300025302 Ga0207426_1000002 Ga0207426_1000002860 249
298 3300025904 Ga0207647_10007618 Ga0207647_100076187 249
299 3300025904 Ga0207647_10050923 Ga0207647_100509232 249
300 3300025911 Ga0207654_10121966 Ga0207654_101219662 249
301 3300025912 Ga0207707_10002433 Ga0207707_100024337 249
302 3300025913 Ga0207695_10083273 Ga0207695_100832732 249
303 3300025913 Ga0207695_10121258 Ga0207695_101212584 249
304 3300025914 Ga0207671_10004146 Ga0207671_1000414611 249
305 3300025914 Ga0207671_10042226 Ga0207671_100422262 249
306 3300025917 Ga0207660_10005457 Ga0207660_100054579 249
307 3300025920 Ga0207649_10050841 Ga0207649_100508413 249
308 3300025925 Ga0207650_10342486 Ga0207650_103424862 249
309 3300025932 Ga0207690_10106095 Ga0207690_101060951 249
310 3300025933 Ga0207706_10002242 Ga0207706_1000224210 249
311 3300025949 Ga0207667_10000023 Ga0207667_10000023310 249
312 3300025949 Ga0207667_10015756 Ga0207667_100157566 249
313 3300025949 Ga0207667_10135108 Ga0207667_101351085 249
314 3300026078 Ga0207702_10000508 Ga0207702_1000050821 249
315 3300026078 Ga0207702_10168988 Ga0207702_101689882 249
316 3300026078 Ga0207702_10238712 Ga0207702_102387122 249
317 3300026116 Ga0207674_10048530 Ga0207674_100485304 249
318 3300026142 Ga0207698_10068689 Ga0207698_100686892 249
319 3300030744 Ga0316181_1159428 Ga0316181_11594283 249
320 3300031548 Ga0307408_100000151 Ga0307408_10000015154 249
321 3300031548 Ga0307408_100054109 Ga0307408_1000541093 249
322 3300031548 Ga0307408_100062094 Ga0307408_1000620943 249
323 3300031911 Ga0307412_10004292 Ga0307412_100042922 249
324 3300031911 Ga0307412_10066314 Ga0307412_100663141 249
325 3300031995 Ga0307409_100393708 Ga0307409_1003937082 249
326 3300032004 Ga0307414_10006355 Ga0307414_100063553 249
327 3300032004 Ga0307414_10056983 Ga0307414_100569833 249
328 3300037312 Ga0395899_0030182 Ga0395899_0030182_195_980 249
329 3300037418 Ga0395900_0000048 Ga0395900_0000048_77587_78372 249
330 3300037418 Ga0395900_0012592 Ga0395900_0012592_498_1283 249
331 3300037418 Ga0395900_0189371 Ga0395900_0189371_411_1202 249
332 3300037418 Ga0395900_0304385 Ga0395900_0304385_333_1127 249
333 3300037466 Ga0395898_0036798 Ga0395898_0036798_3653_4447 249
334 3300037471 Ga0395905_0001400 Ga0395905_0001400_1887_2672 249
335 3300037471 Ga0395905_0110435 Ga0395905_0110435_770_1555 249
336 3300038443 Ga0395901_0099629 Ga0395901_0099629_334_1119 249
337 3300039437 Ga0436365_0204307 Ga0436365_0204307_1823_2617 249
338 3300044656 Ga0466969_0000258 Ga0466969_0000258_21801_22598 249
339 3300044684 Ga0466966_0000049 Ga0466966_0000049_63779_64576 249
340 3300044735 Ga0466968_0225475 Ga0466968_0225475_24_821 249
341 3300045049 Ga0466959_0000195 Ga0466959_0000195_34399_35196 249
342 3300046471 Ga0495650_0000238 Ga0495650_0000238_66409_67194 249
343 3300046506 Ga0495583_0040859 Ga0495583_0040859_662_1447 249
344 3300046507 Ga0495606_0000008 Ga0495606_0000008_294183_294968 249
345 3300046507 Ga0495606_0011869 Ga0495606_0011869_5121_5906 249
346 3300046512 Ga0495610_0013050 Ga0495610_0013050_4027_4833 249
347 3300046513 Ga0495616_0031539 Ga0495616_0031539_544_1329 249
348 3300046522 Ga0495643_0042877 Ga0495643_0042877_342_1136 249
349 3300046660 Ga0495625_0000017 Ga0495625_0000017_26703_27488 249
350 3300046665 Ga0495661_0001264 Ga0495661_0001264_9586_10371 249
351 3300046665 Ga0495661_0073905 Ga0495661_0073905_313_1098 249
352 3300046694 Ga0495649_0000008 Ga0495649_0000008_279140_279925 249
353 3300046810 Ga0495660_0052814 Ga0495660_0052814_1017_1802 249
354 3300047443 Ga0495687_000631 Ga0495687_000631_8928_9713 249
355 3300047443 Ga0495687_001980 Ga0495687_001980_12615_13412 249
356 3300047472 Ga0495686_0015058 Ga0495686_0015058_4266_5051 249
357 3300047472 Ga0495686_0110804 Ga0495686_0110804_807_1598 249
358 3300049663 Ga0501223_000357 Ga0501223_000357_1232_2017 249
359 3300049822 Ga0501035_0295542 Ga0501035_0295542_527_1333 249
360 3300050493 nmdc:mga0k408_231152_c1 nmdc:mga0k408_231152_c1_289_1074 249
361 3300050493 nmdc:mga0k408_305725_c1 nmdc:mga0k408_305725_c1_18_815 249
362 3300050493 nmdc:mga0k408_55_c2 nmdc:mga0k408_55_c2_7567_8352 249
363 3300050507 nmdc:mga05p37_12118_c1 nmdc:mga05p37_12118_c1_1209_2006 249
364 3300053156 Ga0500622_0000143 Ga0500622_0000143_73795_74586 249
365 iso_pu_bacteria 2585427687 2586207444 249
366 iso_pu_bacteria 2738541302 2738855106 249
367 iso_pu_bacteria 2739367651 2739588640 249
368 iso_pu_bacteria 2739367656 2739615870 249
369 iso_pu_bacteria 2818991437 2819548114 249
370 iso_pu_bacteria 2842722452 2842723776 249
371 iso_pu_bacteria 2842909656 2842910282 249
372 iso_pu_bacteria 2904445276 2904445672 249
373 iso_pu_bacteria 2945997725 2946000633 249
374 iso_pu_bacteria 2954016120 2954017518 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00924

MS_channel_2nd

Mechanosensitive ion channel, beta-domain

136

203

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rm3-assembly1.cif.gz_SE0 evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome 0.9086 119 158
2eqj-assembly1.cif.gz_A solution structure of the tudor domain of metal-response element-binding transcription factor 2 0.8215 118 162
2xk0-assembly1.cif.gz_A solution structure of the tudor domain from drosophila polycomblike (pcl) 0.8162 119 161
7egt-assembly2.cif.gz_B the crystal structure of the c-terminal domain of t. thermophilus uvrd complexed with the n-terminal domain of uvrb 0.7671 119 162
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.7621 116 157
ID Description Score Start End Superfamily
af_P77338_945_994_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.962 118 156 2.30.30.60
af_Q58543_201_249_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9347 118 159 2.30.30.60
2oauF03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9345 162 244 3.30.70.100
af_A0A0P0WDR2_370_418_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9306 118 157 2.30.30.60
af_P0C0S1_129_178_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9277 118 159 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A7Y3FPK0-F1-model_v4 Mechanosensitive ion channel 0.9212 162 247 GO:0016020
AF-A0A2D7Y2H1-F1-model_v4 Small-conductance mechanosensitive channel 0.9172 162 249 GO:0005886
GO:0008381
AF-A0A7M3WTM0-F1-model_v4 Mechanosensitive ion channel MscS C-terminal domain-containing protein 0.9123 162 249 GO:0016020
AF-X1VE25-F1-model_v4 Mechanosensitive ion channel MscS C-terminal domain-containing protein 0.9096 162 248 GO:0008381
GO:0016020
AF-X1GD30-F1-model_v4 Mechanosensitive ion channel MscS domain-containing protein 0.8924 79 158 GO:0008381
GO:0016020

Feature Viewer

pLDDT pTM Quality
84.02 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map