F426641

General Info

Members Datasets Scaffolds Average Seq Length
374 209 748 276

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100010840|Ga0068855_1000108404
Length 305
Sequence VRFKRALIALPTAGGGRAKPVRLLYGAASVALLALVAPTQAFAADFDPSEEFKLNPWISIHLGPLDMSINKAVVYLLLATVLTCALGIFTMRFRFGGGKVGRRQTFGEIIYDVAQNQIAESNLPHKAIKLWFPYVTTLMLFIWVINLLGFLPLPLSGQTYHGIPVWGIYAATSSLSVTLALSLMTFLFTHIEGIRYNGPVKYFRSWIPPVPKLLLPLIVPIEILSQFMRLISLSVRLYANMLAGHILILTFIGLIFIFESWLAVPLVGISAVFYIFEVVIVVSIQAFIFAILSAIYIGSAIEPEH

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 19.52
Rhizosphere 79.95
Stem 0
Stem Tuber 0
Unclassified 3.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100010840 3300005563 Bacteria 11004
2 Ga0070658_10006459 3300005327 Bacteria 9501
3 Ga0070658_10022493 3300005327 Bacteria 5059
4 Ga0070683_100016894 3300005329 Bacteria 6439
5 Ga0070683_100152290 3300005329 Bacteria 2192
6 Ga0070680_100004743 3300005336 Bacteria 10235
7 Ga0070680_100175981 3300005336 Bacteria 1801
8 Ga0070680_100270057 3300005336 Bacteria 1440
9 Ga0070682_100009497 3300005337 Bacteria 5503
10 Ga0070660_100004112 3300005339 Bacteria 10037
11 Ga0070660_100048491 3300005339 Bacteria 3263
12 Ga0070691_10016747 3300005341 Bacteria 3370
13 Ga0070691_10110277 3300005341 Bacteria 1376
14 Ga0070661_100015363 3300005344 Bacteria 5403
15 Ga0070668_100037141 3300005347 Bacteria 3718
16 Ga0070671_100118552 3300005355 Unclassified 2226
17 Ga0070671_100325712 3300005355 Bacteria 1309
18 Ga0070710_10133922 3300005437 Bacteria 1513
19 Ga0070711_100010695 3300005439 Bacteria 5686
20 Ga0070711_100036362 3300005439 Bacteria 3299
21 Ga0070700_100055806 3300005441 Bacteria 2474
22 Ga0070694_100126507 3300005444 Bacteria 1840
23 Ga0070708_100009809 3300005445 Bacteria 7731
24 Ga0070708_100046787 3300005445 Bacteria 3819
25 Ga0070708_100380070 3300005445 Bacteria 1332
26 Ga0070663_100043588 3300005455 Bacteria 3158
27 Ga0070662_100055035 3300005457 Bacteria 2886
28 Ga0070681_10068756 3300005458 Bacteria 3508
29 Ga0070681_10090230 3300005458 Bacteria 3015
30 Ga0070681_10368071 3300005458 Bacteria 1348
31 Ga0070707_100081792 3300005468 Bacteria 3119
32 Ga0070699_100364828 3300005518 Bacteria 1302
33 Ga0070679_100029364 3300005530 Bacteria 5425
34 Ga0070679_100102494 3300005530 Bacteria 2848
35 Ga0070679_100438248 3300005530 Bacteria 1251
36 Ga0070684_100021870 3300005535 Bacteria 5328
37 Ga0070684_100023966 3300005535 Bacteria 5113
38 Ga0070696_100008760 3300005546 Bacteria 6769
39 Ga0070696_100056449 3300005546 Bacteria 2739
40 Ga0070693_100077640 3300005547 Bacteria 1971
41 Ga0070704_100040477 3300005549 Bacteria 3208
42 Ga0068855_100087972 3300005563 Bacteria 3589
43 Ga0068855_100092970 3300005563 Bacteria 3478
44 Ga0068855_100221452 3300005563 Bacteria 2121
45 Ga0070664_100300320 3300005564 Bacteria 1451
46 Ga0068857_100262787 3300005577 Bacteria 1584
47 Ga0068856_100011737 3300005614 Bacteria 8498
48 Ga0068852_100199488 3300005616 Bacteria 1893
49 Ga0070717_10103302 3300006028 Bacteria 2423
50 Ga0075432_10010998 3300006058 Bacteria 3074
51 Ga0070716_100081702 3300006173 Bacteria 1930
52 Ga0070712_100038936 3300006175 Bacteria 3251
53 Ga0070712_100267527 3300006175 Bacteria 1372
54 Ga0068871_100020357 3300006358 Bacteria 5081
55 Ga0075428_100015646 3300006844 Bacteria 8408
56 Ga0075428_100040169 3300006844 Bacteria 5149
57 Ga0075430_100032907 3300006846 Bacteria 4400
58 Ga0075433_10096765 3300006852 Bacteria 2612
59 Ga0075434_100120176 3300006871 Bacteria 2642
60 Ga0075434_100337069 3300006871 Bacteria 1529
61 Ga0075429_100092204 3300006880 Bacteria 2642
62 Ga0075436_100018971 3300006914 Bacteria 4710
63 Ga0075435_100222257 3300007076 Bacteria 1604
64 Ga0105250_10100135 3300009092 Bacteria 1182
65 Ga0105240_10085867 3300009093 Bacteria 3855
66 Ga0111539_10459818 3300009094 Bacteria 1482
67 Ga0105245_10016907 3300009098 Bacteria 6369
68 Ga0105245_10028534 3300009098 Bacteria 4924
69 Ga0105245_10036533 3300009098 Bacteria 4364
70 Ga0114129_10064739 3300009147 Bacteria 5102
71 Ga0114129_10234418 3300009147 Bacteria 2470
72 Ga0105243_10038759 3300009148 Bacteria 3712
73 Ga0105241_10096201 3300009174 Bacteria 2345
74 Ga0105241_10464160 3300009174 Bacteria 1122
75 Ga0105242_10062086 3300009176 Bacteria 3074
76 Ga0105248_10764504 3300009177 Bacteria 1090
77 Ga0105249_10009768 3300009553 Bacteria 8405
78 Ga0105239_10055374 3300010375 Bacteria 4349
79 Ga0105239_10143955 3300010375 Bacteria 2657
80 Ga0105246_10498894 3300011119 Bacteria 1033
81 Ga0157342_1001556 3300012507 Bacteria 1728
82 Ga0157373_10084226 3300013100 Bacteria 2241
83 Ga0157371_10307360 3300013102 Bacteria 1149
84 Ga0157370_10012514 3300013104 Bacteria 8795
85 Ga0157370_10022924 3300013104 Bacteria 6206
86 Ga0157369_10035208 3300013105 Bacteria 5491
87 Ga0157369_10105393 3300013105 Bacteria 3002
88 Ga0157369_10139951 3300013105 Bacteria 2561
89 Ga0157374_10090075 3300013296 Bacteria 2924
90 Ga0157372_10456892 3300013307 Bacteria 1488
91 Ga0157375_10211476 3300013308 Bacteria 2097
92 Ga0157375_10660884 3300013308 Bacteria 1201
93 Ga0163163_10073030 3300014325 Bacteria 3421
94 Ga0157377_10046627 3300014745 Unclassified 2425
95 Ga0157376_10103862 3300014969 Bacteria 2489
96 Ga0163161_10078163 3300017792 Bacteria 2432
97 Ga0206356_10688277 3300020070 Bacteria 2688
98 Ga0206356_11427927 3300020070 Bacteria 2788
99 Ga0206353_10731676 3300020082 Bacteria 2731
100 Ga0224712_10009172 3300022467 Bacteria 2968
101 Ga0207692_10008874 3300025898 Bacteria 4178
102 Ga0207699_10158970 3300025906 Bacteria 1502
103 Ga0207705_10006037 3300025909 Bacteria 9008
104 Ga0207705_10275875 3300025909 Bacteria 1286
105 Ga0207684_10303511 3300025910 Bacteria 1376
106 Ga0207654_10296482 3300025911 Bacteria 1098
107 Ga0207707_10026288 3300025912 Bacteria 5088
108 Ga0207707_10058811 3300025912 Bacteria 3345
109 Ga0207707_10062800 3300025912 Bacteria 3233
110 Ga0207707_10179891 3300025912 Bacteria 1846
111 Ga0207695_10332472 3300025913 Bacteria 1408
112 Ga0207671_10295923 3300025914 Bacteria 1278
113 Ga0207693_10000466 3300025915 Bacteria 36934
114 Ga0207693_10199338 3300025915 Bacteria 1574
115 Ga0207663_10008101 3300025916 Bacteria 5477
116 Ga0207663_10073250 3300025916 Bacteria 2216
117 Ga0207660_10017188 3300025917 Bacteria 4800
118 Ga0207660_10209945 3300025917 Bacteria 1524
119 Ga0207662_10072257 3300025918 Bacteria 2090
120 Ga0207657_10000976 3300025919 Bacteria 30357
121 Ga0207657_10012620 3300025919 Bacteria 8327
122 Ga0207649_10014527 3300025920 Bacteria 4410
123 Ga0207652_10006523 3300025921 Bacteria 9407
124 Ga0207652_10053102 3300025921 Bacteria 3481
125 Ga0207652_10123262 3300025921 Bacteria 2307
126 Ga0207646_10056470 3300025922 Bacteria 3509
127 Ga0207646_10102146 3300025922 Bacteria 2571
128 Ga0207646_10639193 3300025922 Bacteria 954
129 Ga0207664_10013781 3300025929 Bacteria 5818
130 Ga0207664_10048453 3300025929 Bacteria 3341
131 Ga0207644_10075407 3300025931 Bacteria 2478
132 Ga0207644_10131807 3300025931 Bacteria 1914
133 Ga0207706_10006838 3300025933 Bacteria 10540
134 Ga0207665_10009627 3300025939 Bacteria 6346
135 Ga0207665_10013106 3300025939 Bacteria 5449
136 Ga0207711_10405043 3300025941 Bacteria 1268
137 Ga0207661_10028210 3300025944 Bacteria 4297
138 Ga0207661_10114255 3300025944 Bacteria 2289
139 Ga0207679_10270600 3300025945 Bacteria 1453
140 Ga0207667_10056106 3300025949 Bacteria 4139
141 Ga0207667_10073840 3300025949 Bacteria 3544
142 Ga0207667_10124890 3300025949 Bacteria 2650
143 Ga0207712_10015714 3300025961 Bacteria 4888
144 Ga0207640_10415169 3300025981 Bacteria 1100
145 Ga0207677_10115274 3300026023 Bacteria 2010
146 Ga0207678_10025359 3300026067 Bacteria 5175
147 Ga0207702_10019066 3300026078 Bacteria 5678
148 Ga0207702_10160441 3300026078 Bacteria 2053
149 Ga0207675_100050145 3300026118 Bacteria 3895
150 Ga0207428_10002378 3300027907 Bacteria 18783
151 Ga0265337_1025992 3300028556 Bacteria 1778
152 Ga0265326_10043638 3300028558 Bacteria 1272
153 Ga0265334_10018473 3300028573 Bacteria 2875
154 Ga0265322_10003866 3300028654 Bacteria 4492
155 Ga0265322_10020040 3300028654 Bacteria 1917
156 Ga0265338_10020057 3300028800 Bacteria 7050
157 Ga0265338_10123376 3300028800 Bacteria 2060
158 Ga0265338_10147596 3300028800 Bacteria 1832
159 Ga0265325_10029071 3300031241 Bacteria 2973
160 Ga0265329_10013978 3300031242 Bacteria 2846
161 Ga0265339_10034758 3300031249 Bacteria 2831
162 Ga0265327_10024686 3300031251 Bacteria 3522
163 Ga0265316_10010457 3300031344 Bacteria 8453
164 Ga0265313_10008550 3300031595 Bacteria 6783
165 Ga0265314_10010158 3300031711 Bacteria 7888
166 Ga0265342_10070263 3300031712 Bacteria 2043
167 Ga0373958_0048337 3300034819 Bacteria 892
168 Ga0373959_0028684 3300034820 Bacteria 1112
169 Ga0373926_0008014 3300035083 Bacteria 3519
170 Ga0373951_0012843 3300035091 Bacteria 1884
171 Ga0373945_0002094 3300035116 Bacteria 6218
172 Ga0373943_0000526 3300035170 Bacteria 16580
173 Ga0373946_0089074 3300035171 Bacteria 1364
174 Ga0373935_0029920 3300035692 Bacteria 3372
175 Ga0373935_0089419 3300035692 Bacteria 2014
176 Ga0373927_0106447 3300035695 Bacteria 1826
177 Ga0373947_0002099 3300035725 Bacteria 12150
178 Ga0373947_0028266 3300035725 Bacteria 3286
179 Ga0373925_0003466 3300037068 Bacteria 12199
180 Ga0373925_0018064 3300037068 Bacteria 5122
181 Ga0373925_0019769 3300037068 Bacteria 4902
182 Ga0395899_0004506 3300037312 Bacteria 10861
183 Ga0395899_0011867 3300037312 Bacteria 6671
184 Ga0395899_0022065 3300037312 Bacteria 4828
185 Ga0395899_0060785 3300037312 Unclassified 2783
186 Ga0395899_0134348 3300037312 Bacteria 1764
187 Ga0395899_0184433 3300037312 Bacteria 1463
188 Ga0395900_0012444 3300037418 Bacteria 8701
189 Ga0395900_0015025 3300037418 Bacteria 7892
190 Ga0395900_0022576 3300037418 Bacteria 6438
191 Ga0395900_0029483 3300037418 Bacteria 5628
192 Ga0395900_0075819 3300037418 Bacteria 3457
193 Ga0395900_0309879 3300037418 Bacteria 1562
194 Ga0395898_0005290 3300037466 Bacteria 13956
195 Ga0395898_0007724 3300037466 Bacteria 11418
196 Ga0395898_0012512 3300037466 Bacteria 8774
197 Ga0395898_0054422 3300037466 Bacteria 3905
198 Ga0395898_0337352 3300037466 Unclassified 1437
199 Ga0395905_0037383 3300037471 Bacteria 4558
200 Ga0395905_0064805 3300037471 Bacteria 3420
201 Ga0395905_0075849 3300037471 Bacteria 3151
202 Ga0395905_0081707 3300037471 Bacteria 3028
203 Ga0395905_0108822 3300037471 Bacteria 2602
204 Ga0395905_0161702 3300037471 Unclassified 2104
205 Ga0395905_0712203 3300037471 Bacteria 906
206 Ga0436364_0333253 3300037853 Bacteria 1381
207 Ga0395901_0002494 3300038443 Bacteria 18642
208 Ga0395901_0006646 3300038443 Bacteria 11685
209 Ga0395901_0012033 3300038443 Bacteria 8777
210 Ga0395901_0032652 3300038443 Bacteria 5369
211 Ga0395901_0071353 3300038443 Bacteria 3619
212 Ga0395901_0091381 3300038443 Bacteria 3186
213 Ga0395901_0130506 3300038443 Bacteria 2640
214 Ga0395901_0160153 3300038443 Bacteria 2364
215 Ga0395901_0194471 3300038443 Bacteria 2127
216 Ga0395901_0280509 3300038443 Bacteria 1731
217 Ga0451845_0914248 3300041501 Bacteria 3133
218 Ga0439448_0110770 3300042005 Bacteria 937
219 Ga0466969_0038855 3300044656 Bacteria 2393
220 Ga0466963_0015369 3300044694 Bacteria 4738
221 Ga0453684_0488819 3300044712 Bacteria 1365
222 Ga0466967_0090186 3300045976 Bacteria 2784
223 Ga0495592_0160680 3300046454 Bacteria 1546
224 Ga0495603_0052236 3300046455 Bacteria 2427
225 Ga0495603_0075721 3300046455 Bacteria 1975
226 Ga0495603_0109044 3300046455 Bacteria 1615
227 Ga0495603_0132036 3300046455 Bacteria 1454
228 Ga0495629_0004856 3300046459 Bacteria 10082
229 Ga0495641_0001263 3300046461 Bacteria 21723
230 Ga0495641_0004310 3300046461 Bacteria 10122
231 Ga0495651_0052436 3300046462 Bacteria 3142
232 Ga0495653_0059111 3300046463 Bacteria 2911
233 Ga0495580_0276052 3300046472 Bacteria 1147
234 Ga0495582_0000219 3300046473 Bacteria 31735
235 Ga0495582_0030226 3300046473 Bacteria 2973
236 Ga0495582_0034867 3300046473 Bacteria 2766
237 Ga0495639_0000780 3300046475 Bacteria 14485
238 Ga0495662_0003579 3300046476 Bacteria 7848
239 Ga0495662_0172423 3300046476 Bacteria 1066
240 Ga0495584_0051612 3300046491 Bacteria 2070
241 Ga0495594_0000090 3300046499 Bacteria 41794
242 Ga0495594_0091371 3300046499 Bacteria 1706
243 Ga0495596_0012105 3300046500 Bacteria 3704
244 Ga0495607_0148556 3300046501 Bacteria 1202
245 Ga0495608_0118108 3300046511 Bacteria 1701
246 Ga0495616_0022285 3300046513 Bacteria 3421
247 Ga0495628_0204780 3300046516 Bacteria 1486
248 Ga0495630_0032555 3300046517 Bacteria 3885
249 Ga0495630_0325455 3300046517 Unclassified 1175
250 Ga0495637_0048174 3300046520 Bacteria 1796
251 Ga0495666_0074117 3300046526 Unclassified 1615
252 Ga0495652_0070408 3300046529 Bacteria 2923
253 Ga0495665_0000306 3300046531 Bacteria 24786
254 Ga0495598_0203570 3300046537 Bacteria 716
255 Ga0495667_0193864 3300046559 Bacteria 1301
256 Ga0495656_0176547 3300046615 Unclassified 1047
257 Ga0495634_0079048 3300046642 Bacteria 2154
258 Ga0495659_0065891 3300046664 Unclassified 1348
259 Ga0495588_0004025 3300046674 Bacteria 6467
260 Ga0495599_0027292 3300046678 Bacteria 3579
261 Ga0495647_0002838 3300046681 Bacteria 5502
262 Ga0495658_0000020 3300046683 Bacteria 87200
263 Ga0495658_0048552 3300046683 Bacteria 2394
264 Ga0495658_0226301 3300046683 Bacteria 1172
265 Ga0495658_0287754 3300046683 Bacteria 1038
266 Ga0495624_0023890 3300046690 Bacteria 4027
267 Ga0495670_0145074 3300046691 Bacteria 1243
268 Ga0495581_0005963 3300047315 Bacteria 7061
269 Ga0495581_0007600 3300047315 Bacteria 6267
270 Ga0495581_0071603 3300047315 Bacteria 2006
271 Ga0495604_0040872 3300047317 Bacteria 3639
272 Ga0495676_0006555 3300047321 Bacteria 10729
273 Ga0495676_0017886 3300047321 Bacteria 6256
274 Ga0495676_0064265 3300047321 Bacteria 2855
275 Ga0495680_0006043 3300047322 Bacteria 11318
276 Ga0495680_0223683 3300047322 Bacteria 1342
277 Ga0495679_050535 3300047446 Bacteria 1250
278 Ga0495684_0165138 3300047471 Bacteria 1649
279 Ga0495614_0018392 3300048089 Bacteria 3027
280 Ga0495626_0059428 3300048091 Bacteria 1744
281 Ga0496100_0033019 3300048903 Bacteria 3234
282 Ga0496100_0041573 3300048903 Bacteria 2931
283 Ga0496100_0117105 3300048903 Bacteria 1859
284 Ga0496101_0008883 3300048904 Bacteria 6580
285 Ga0496101_0009426 3300048904 Bacteria 6417
286 Ga0496101_0011721 3300048904 Bacteria 5827
287 Ga0496101_0031795 3300048904 Bacteria 3712
288 Ga0496101_0067858 3300048904 Bacteria 2605
289 Ga0496101_0120098 3300048904 Bacteria 1986
290 Ga0496102_0036496 3300048905 Bacteria 4428
291 Ga0496102_0070240 3300048905 Unclassified 3215
292 Ga0496102_0090732 3300048905 Bacteria 2828
293 Ga0496102_0104992 3300048905 Bacteria 2628
294 Ga0496102_0177674 3300048905 Unclassified 2005
295 Ga0496102_0382536 3300048905 Bacteria 1324
296 Ga0496102_0391120 3300048905 Bacteria 1308
297 Ga0496103_0005185 3300048906 Bacteria 7839
298 Ga0496103_0078791 3300048906 Bacteria 2069
299 Ga0496104_0000644 3300048907 Bacteria 29884
300 Ga0496104_0000667 3300048907 Bacteria 29417
301 Ga0496104_0030720 3300048907 Bacteria 4994
302 Ga0496104_0096431 3300048907 Bacteria 2829
303 Ga0496105_0000432 3300048908 Bacteria 27494
304 Ga0496105_0002426 3300048908 Bacteria 13511
305 Ga0496105_0005121 3300048908 Bacteria 9937
306 Ga0496105_0015942 3300048908 Bacteria 5994
307 Ga0496106_0020182 3300048909 Bacteria 4944
308 Ga0496106_0034578 3300048909 Bacteria 3775
309 Ga0496106_0048260 3300048909 Bacteria 3206
310 Ga0496106_0060740 3300048909 Bacteria 2865
311 Ga0496107_0001709 3300048910 Bacteria 13771
312 Ga0496107_0097497 3300048910 Bacteria 2152
313 Ga0496107_0129644 3300048910 Bacteria 1861
314 Ga0496108_0002491 3300048911 Bacteria 14736
315 Ga0496108_0003625 3300048911 Bacteria 12373
316 Ga0496108_0127783 3300048911 Bacteria 2183
317 Ga0496109_0002266 3300048912 Bacteria 15992
318 Ga0496109_0003179 3300048912 Bacteria 13682
319 Ga0496109_0034676 3300048912 Bacteria 4548
320 Ga0496109_0059712 3300048912 Bacteria 3484
321 Ga0496109_0398158 3300048912 Bacteria 1301
322 Ga0496110_0000149 3300048913 Bacteria 41626
323 Ga0496110_0014610 3300048913 Bacteria 6524
324 Ga0496110_0074686 3300048913 Bacteria 3011
325 Ga0496110_0852462 3300048913 Bacteria 816
326 Ga0496111_0001830 3300048914 Bacteria 12517
327 Ga0496111_0012186 3300048914 Bacteria 5816
328 Ga0496111_0015914 3300048914 Bacteria 5173
329 Ga0496111_0023208 3300048914 Bacteria 4354
330 Ga0496111_0212623 3300048914 Bacteria 1436
331 Ga0496111_0219120 3300048914 Unclassified 1414
332 Ga0496112_0000912 3300048915 Bacteria 21327
333 Ga0496112_0002661 3300048915 Bacteria 14442
334 Ga0496112_0015351 3300048915 Bacteria 7142
335 Ga0496112_0015832 3300048915 Bacteria 7047
336 Ga0496112_0028426 3300048915 Bacteria 5397
337 Ga0496112_0029775 3300048915 Bacteria 5282
338 Ga0496112_0085567 3300048915 Bacteria 3119
339 Ga0496112_0118877 3300048915 Unclassified 2613
340 Ga0496112_0405733 3300048915 Bacteria 1302
341 Ga0496113_0002347 3300048916 Bacteria 10957
342 Ga0496113_0014583 3300048916 Bacteria 5366
343 Ga0496113_0093986 3300048916 Bacteria 2316
344 Ga0496113_0131535 3300048916 Unclassified 1964
345 Ga0496113_0160767 3300048916 Bacteria 1776
346 Ga0496114_0024996 3300048917 Bacteria 4878
347 Ga0496114_0052476 3300048917 Bacteria 3397
348 Ga0496114_0072607 3300048917 Bacteria 2894
349 Ga0496114_0188280 3300048917 Bacteria 1804
350 Ga0496115_0003253 3300048918 Bacteria 11658
351 Ga0496115_0004870 3300048918 Bacteria 9743
352 Ga0496115_0018684 3300048918 Bacteria 5328
353 Ga0496115_0128935 3300048918 Bacteria 2084
354 Ga0501067_0001345 3300049583 Bacteria 13314
355 Ga0501068_0196117 3300049584 Bacteria 1280
356 Ga0501069_0141555 3300049585 Bacteria 1380
357 Ga0501075_0817156 3300049591 Bacteria 709
358 Ga0501076_0258640 3300049592 Bacteria 1425
359 nmdc:mga05p37_159704_c1 3300050507 Bacteria 2753
360 nmdc:mga05p37_180199_c1 3300050507 Bacteria 2571
361 nmdc:mga0qj67_12833_c1 3300050509 Bacteria 6320
362 nmdc:mga06r32_371325_c1 3300050510 Bacteria 1414
363 nmdc:mga08y16_294365_c1 3300050511 Bacteria 1674
364 nmdc:mga08y16_395069_c1 3300050511 Bacteria 1416
365 nmdc:mga0n895_323605_c1 3300050512 Bacteria 1563
366 nmdc:mga0n895_450472_c1 3300050512 Bacteria 1300
367 nmdc:mga0rr50_11997_c1 3300050513 Bacteria 5578
368 nmdc:mga08x19_10828_c1 3300050514 Bacteria 5484
369 nmdc:mga08x19_463759_c1 3300050514 Bacteria 892
370 nmdc:mga0a205_24995_c1 3300050515 Bacteria 5687
371 Ga0495601_0259485 3300053077 Bacteria 1134
372 Ga0495655_0007736 3300053083 Bacteria 2012
373 Ga0495595_0012611 3300053084 Bacteria 3556
374 Ga0495619_0244439 3300053085 Bacteria 1244
375 Ga0068855_100010840
376 Ga0070658_10006459
377 Ga0070658_10022493
378 Ga0070683_100016894
379 Ga0070683_100152290
380 Ga0070680_100004743
381 Ga0070680_100175981
382 Ga0070680_100270057
383 Ga0070682_100009497
384 Ga0070660_100004112
385 Ga0070660_100048491
386 Ga0070691_10016747
387 Ga0070691_10110277
388 Ga0070661_100015363
389 Ga0070668_100037141
390 Ga0070671_100118552
391 Ga0070671_100325712
392 Ga0070710_10133922
393 Ga0070711_100010695
394 Ga0070711_100036362
395 Ga0070700_100055806
396 Ga0070694_100126507
397 Ga0070708_100009809
398 Ga0070708_100046787
399 Ga0070708_100380070
400 Ga0070663_100043588
401 Ga0070662_100055035
402 Ga0070681_10068756
403 Ga0070681_10090230
404 Ga0070681_10368071
405 Ga0070707_100081792
406 Ga0070699_100364828
407 Ga0070679_100029364
408 Ga0070679_100102494
409 Ga0070679_100438248
410 Ga0070684_100021870
411 Ga0070684_100023966
412 Ga0070696_100008760
413 Ga0070696_100056449
414 Ga0070693_100077640
415 Ga0070704_100040477
416 Ga0068855_100087972
417 Ga0068855_100092970
418 Ga0068855_100221452
419 Ga0070664_100300320
420 Ga0068857_100262787
421 Ga0068856_100011737
422 Ga0068852_100199488
423 Ga0070717_10103302
424 Ga0075432_10010998
425 Ga0070716_100081702
426 Ga0070712_100038936
427 Ga0070712_100267527
428 Ga0068871_100020357
429 Ga0075428_100015646
430 Ga0075428_100040169
431 Ga0075430_100032907
432 Ga0075433_10096765
433 Ga0075434_100120176
434 Ga0075434_100337069
435 Ga0075429_100092204
436 Ga0075436_100018971
437 Ga0075435_100222257
438 Ga0105250_10100135
439 Ga0105240_10085867
440 Ga0111539_10459818
441 Ga0105245_10016907
442 Ga0105245_10028534
443 Ga0105245_10036533
444 Ga0114129_10064739
445 Ga0114129_10234418
446 Ga0105243_10038759
447 Ga0105241_10096201
448 Ga0105241_10464160
449 Ga0105242_10062086
450 Ga0105248_10764504
451 Ga0105249_10009768
452 Ga0105239_10055374
453 Ga0105239_10143955
454 Ga0105246_10498894
455 Ga0157342_1001556
456 Ga0157373_10084226
457 Ga0157371_10307360
458 Ga0157370_10012514
459 Ga0157370_10022924
460 Ga0157369_10035208
461 Ga0157369_10105393
462 Ga0157369_10139951
463 Ga0157374_10090075
464 Ga0157372_10456892
465 Ga0157375_10211476
466 Ga0157375_10660884
467 Ga0163163_10073030
468 Ga0157377_10046627
469 Ga0157376_10103862
470 Ga0163161_10078163
471 Ga0206356_10688277
472 Ga0206356_11427927
473 Ga0206353_10731676
474 Ga0224712_10009172
475 Ga0207692_10008874
476 Ga0207699_10158970
477 Ga0207705_10006037
478 Ga0207705_10275875
479 Ga0207684_10303511
480 Ga0207654_10296482
481 Ga0207707_10026288
482 Ga0207707_10058811
483 Ga0207707_10062800
484 Ga0207707_10179891
485 Ga0207695_10332472
486 Ga0207671_10295923
487 Ga0207693_10000466
488 Ga0207693_10199338
489 Ga0207663_10008101
490 Ga0207663_10073250
491 Ga0207660_10017188
492 Ga0207660_10209945
493 Ga0207662_10072257
494 Ga0207657_10000976
495 Ga0207657_10012620
496 Ga0207649_10014527
497 Ga0207652_10006523
498 Ga0207652_10053102
499 Ga0207652_10123262
500 Ga0207646_10056470
501 Ga0207646_10102146
502 Ga0207646_10639193
503 Ga0207664_10013781
504 Ga0207664_10048453
505 Ga0207644_10075407
506 Ga0207644_10131807
507 Ga0207706_10006838
508 Ga0207665_10009627
509 Ga0207665_10013106
510 Ga0207711_10405043
511 Ga0207661_10028210
512 Ga0207661_10114255
513 Ga0207679_10270600
514 Ga0207667_10056106
515 Ga0207667_10073840
516 Ga0207667_10124890
517 Ga0207712_10015714
518 Ga0207640_10415169
519 Ga0207677_10115274
520 Ga0207678_10025359
521 Ga0207702_10019066
522 Ga0207702_10160441
523 Ga0207675_100050145
524 Ga0207428_10002378
525 Ga0265337_1025992
526 Ga0265326_10043638
527 Ga0265334_10018473
528 Ga0265322_10003866
529 Ga0265322_10020040
530 Ga0265338_10020057
531 Ga0265338_10123376
532 Ga0265338_10147596
533 Ga0265325_10029071
534 Ga0265329_10013978
535 Ga0265339_10034758
536 Ga0265327_10024686
537 Ga0265316_10010457
538 Ga0265313_10008550
539 Ga0265314_10010158
540 Ga0265342_10070263
541 Ga0373958_0048337
542 Ga0373959_0028684
543 Ga0373926_0008014
544 Ga0373951_0012843
545 Ga0373945_0002094
546 Ga0373943_0000526
547 Ga0373946_0089074
548 Ga0373935_0029920
549 Ga0373935_0089419
550 Ga0373927_0106447
551 Ga0373947_0002099
552 Ga0373947_0028266
553 Ga0373925_0003466
554 Ga0373925_0018064
555 Ga0373925_0019769
556 Ga0395899_0004506
557 Ga0395899_0011867
558 Ga0395899_0022065
559 Ga0395899_0060785
560 Ga0395899_0134348
561 Ga0395899_0184433
562 Ga0395900_0012444
563 Ga0395900_0015025
564 Ga0395900_0022576
565 Ga0395900_0029483
566 Ga0395900_0075819
567 Ga0395900_0309879
568 Ga0395898_0005290
569 Ga0395898_0007724
570 Ga0395898_0012512
571 Ga0395898_0054422
572 Ga0395898_0337352
573 Ga0395905_0037383
574 Ga0395905_0064805
575 Ga0395905_0075849
576 Ga0395905_0081707
577 Ga0395905_0108822
578 Ga0395905_0161702
579 Ga0395905_0712203
580 Ga0436364_0333253
581 Ga0395901_0002494
582 Ga0395901_0006646
583 Ga0395901_0012033
584 Ga0395901_0032652
585 Ga0395901_0071353
586 Ga0395901_0091381
587 Ga0395901_0130506
588 Ga0395901_0160153
589 Ga0395901_0194471
590 Ga0395901_0280509
591 Ga0451845_0914248
592 Ga0439448_0110770
593 Ga0466969_0038855
594 Ga0466963_0015369
595 Ga0453684_0488819
596 Ga0466967_0090186
597 Ga0495592_0160680
598 Ga0495603_0052236
599 Ga0495603_0075721
600 Ga0495603_0109044
601 Ga0495603_0132036
602 Ga0495629_0004856
603 Ga0495641_0001263
604 Ga0495641_0004310
605 Ga0495651_0052436
606 Ga0495653_0059111
607 Ga0495580_0276052
608 Ga0495582_0000219
609 Ga0495582_0030226
610 Ga0495582_0034867
611 Ga0495639_0000780
612 Ga0495662_0003579
613 Ga0495662_0172423
614 Ga0495584_0051612
615 Ga0495594_0000090
616 Ga0495594_0091371
617 Ga0495596_0012105
618 Ga0495607_0148556
619 Ga0495608_0118108
620 Ga0495616_0022285
621 Ga0495628_0204780
622 Ga0495630_0032555
623 Ga0495630_0325455
624 Ga0495637_0048174
625 Ga0495666_0074117
626 Ga0495652_0070408
627 Ga0495665_0000306
628 Ga0495598_0203570
629 Ga0495667_0193864
630 Ga0495656_0176547
631 Ga0495634_0079048
632 Ga0495659_0065891
633 Ga0495588_0004025
634 Ga0495599_0027292
635 Ga0495647_0002838
636 Ga0495658_0000020
637 Ga0495658_0048552
638 Ga0495658_0226301
639 Ga0495658_0287754
640 Ga0495624_0023890
641 Ga0495670_0145074
642 Ga0495581_0005963
643 Ga0495581_0007600
644 Ga0495581_0071603
645 Ga0495604_0040872
646 Ga0495676_0006555
647 Ga0495676_0017886
648 Ga0495676_0064265
649 Ga0495680_0006043
650 Ga0495680_0223683
651 Ga0495679_050535
652 Ga0495684_0165138
653 Ga0495614_0018392
654 Ga0495626_0059428
655 Ga0496100_0033019
656 Ga0496100_0041573
657 Ga0496100_0117105
658 Ga0496101_0008883
659 Ga0496101_0009426
660 Ga0496101_0011721
661 Ga0496101_0031795
662 Ga0496101_0067858
663 Ga0496101_0120098
664 Ga0496102_0036496
665 Ga0496102_0070240
666 Ga0496102_0090732
667 Ga0496102_0104992
668 Ga0496102_0177674
669 Ga0496102_0382536
670 Ga0496102_0391120
671 Ga0496103_0005185
672 Ga0496103_0078791
673 Ga0496104_0000644
674 Ga0496104_0000667
675 Ga0496104_0030720
676 Ga0496104_0096431
677 Ga0496105_0000432
678 Ga0496105_0002426
679 Ga0496105_0005121
680 Ga0496105_0015942
681 Ga0496106_0020182
682 Ga0496106_0034578
683 Ga0496106_0048260
684 Ga0496106_0060740
685 Ga0496107_0001709
686 Ga0496107_0097497
687 Ga0496107_0129644
688 Ga0496108_0002491
689 Ga0496108_0003625
690 Ga0496108_0127783
691 Ga0496109_0002266
692 Ga0496109_0003179
693 Ga0496109_0034676
694 Ga0496109_0059712
695 Ga0496109_0398158
696 Ga0496110_0000149
697 Ga0496110_0014610
698 Ga0496110_0074686
699 Ga0496110_0852462
700 Ga0496111_0001830
701 Ga0496111_0012186
702 Ga0496111_0015914
703 Ga0496111_0023208
704 Ga0496111_0212623
705 Ga0496111_0219120
706 Ga0496112_0000912
707 Ga0496112_0002661
708 Ga0496112_0015351
709 Ga0496112_0015832
710 Ga0496112_0028426
711 Ga0496112_0029775
712 Ga0496112_0085567
713 Ga0496112_0118877
714 Ga0496112_0405733
715 Ga0496113_0002347
716 Ga0496113_0014583
717 Ga0496113_0093986
718 Ga0496113_0131535
719 Ga0496113_0160767
720 Ga0496114_0024996
721 Ga0496114_0052476
722 Ga0496114_0072607
723 Ga0496114_0188280
724 Ga0496115_0003253
725 Ga0496115_0004870
726 Ga0496115_0018684
727 Ga0496115_0128935
728 Ga0501067_0001345
729 Ga0501068_0196117
730 Ga0501069_0141555
731 Ga0501075_0817156
732 Ga0501076_0258640
733 nmdc:mga05p37_159704_c1
734 nmdc:mga05p37_180199_c1
735 nmdc:mga0qj67_12833_c1
736 nmdc:mga06r32_371325_c1
737 nmdc:mga08y16_294365_c1
738 nmdc:mga08y16_395069_c1
739 nmdc:mga0n895_323605_c1
740 nmdc:mga0n895_450472_c1
741 nmdc:mga0rr50_11997_c1
742 nmdc:mga08x19_10828_c1
743 nmdc:mga08x19_463759_c1
744 nmdc:mga0a205_24995_c1
745 Ga0495601_0259485
746 Ga0495655_0007736
747 Ga0495595_0012611
748 Ga0495619_0244439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

73

298

0.86

Map