F426637

General Info

Members Datasets Scaffolds Average Seq Length
374 208 748 423

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100026328|Ga0070697_1000263283
Length 503
Sequence LSRTGKSYVMSGLSPTGKVRLTAAAKAWAVRRSFTRRRNADTTYGFFRVHQHDGKADESRQRHPCKDAGLHDWAIVRRVHPMQPAERILAEVDRAADEIVRFTTDLVRIPTVNPPGEEYEACAHFLGDDLMRRGFDVEYLTADRRPEHTARHPRVNVVGSRRGGAGPVVHLNGHIDVVPPGGGWTVGPFDGLVRDGRIFGRGVCDMKAGIAAAVFAAEALERAGVRLPGTIEISGTVDEESGGFAGVAHLAEIGRIKKGRTDFVIIPEPLNVDRICIGHRGVYWFEVTAHGRIGHGSMPFLGVSAIDGMGRLLHAVRDVLMPALASRQTAVPVVPPGARHATINVNGIDGGQPVDGIQTPCIADRCRAVFDRRFLLEEGFDAAKREIADLVARVADGAGGVRFDVRDLMVVHPTRTPDGSPVVAAIDQAIRRVLGRPAELIASPGTYDHKHVARIAGVPHCVAYGPGELELAHQPDEYCRIDDLVNATKVIALATLDLMGYGI

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
172 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
198 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
199 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 2.67
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100026328 3300005536 Bacteria 4645
2 Ga0065712_10004925 3300005290 Bacteria 4055
3 Ga0065712_10071843 3300005290 Bacteria 5032
4 Ga0065712_10072379 3300005290 Bacteria 4780
5 Ga0070676_10001644 3300005328 Bacteria 11374
6 Ga0070676_10068072 3300005328 Bacteria 2131
7 Ga0070670_100002529 3300005331 Bacteria 15081
8 Ga0070666_10035053 3300005335 Bacteria 3327
9 Ga0070666_10049536 3300005335 Bacteria 2823
10 Ga0070666_10070793 3300005335 Bacteria 2373
11 Ga0070680_100029545 3300005336 Bacteria 4402
12 Ga0070680_100238714 3300005336 Bacteria 1536
13 Ga0068868_100013865 3300005338 Bacteria 5925
14 Ga0070689_100099351 3300005340 Bacteria 2302
15 Ga0070687_100020173 3300005343 Bacteria 3112
16 Ga0070668_100134156 3300005347 Bacteria 1989
17 Ga0070668_100137420 3300005347 Unclassified 1967
18 Ga0070669_100061202 3300005353 Bacteria 2766
19 Ga0070675_100004573 3300005354 Bacteria 10562
20 Ga0070675_100009376 3300005354 Bacteria 7615
21 Ga0070675_100065065 3300005354 Bacteria 3014
22 Ga0070675_100247447 3300005354 Bacteria 1559
23 Ga0070671_100059528 3300005355 Bacteria 3179
24 Ga0070671_100075408 3300005355 Bacteria 2817
25 Ga0070674_100085351 3300005356 Bacteria 2266
26 Ga0070674_100274686 3300005356 Bacteria 1333
27 Ga0070673_100018639 3300005364 Bacteria 4963
28 Ga0070673_100131168 3300005364 Bacteria 2103
29 Ga0070673_100305398 3300005364 Bacteria 1402
30 Ga0070667_100003724 3300005367 Bacteria 12942
31 Ga0070667_100133593 3300005367 Bacteria 2168
32 Ga0070713_100139776 3300005436 Bacteria 2144
33 Ga0070701_10008715 3300005438 Bacteria 4404
34 Ga0070701_10058296 3300005438 Bacteria 2026
35 Ga0070700_100010701 3300005441 Bacteria 5067
36 Ga0070700_100031609 3300005441 Bacteria 3173
37 Ga0070694_100006130 3300005444 Bacteria 7294
38 Ga0070708_100075997 3300005445 Bacteria 3032
39 Ga0070663_100053846 3300005455 Bacteria 2874
40 Ga0070681_10038782 3300005458 Bacteria 4777
41 Ga0068867_100020875 3300005459 Bacteria 4672
42 Ga0068867_100054669 3300005459 Bacteria 2949
43 Ga0070698_100017397 3300005471 Bacteria 7576
44 Ga0070698_100069220 3300005471 Bacteria 3544
45 Ga0070698_100257459 3300005471 Bacteria 1677
46 Ga0070699_100004064 3300005518 Bacteria 12934
47 Ga0070679_100005983 3300005530 Bacteria 11309
48 Ga0070679_100019812 3300005530 Bacteria 6550
49 Ga0070672_100006192 3300005543 Bacteria 8013
50 Ga0070672_100093357 3300005543 Bacteria 2430
51 Ga0070686_100000289 3300005544 Bacteria 33772
52 Ga0070686_100042829 3300005544 Bacteria 2837
53 Ga0070686_100122094 3300005544 Bacteria 1790
54 Ga0070695_100018049 3300005545 Bacteria 4283
55 Ga0070696_100009482 3300005546 Bacteria 6519
56 Ga0070696_100034473 3300005546 Bacteria 3482
57 Ga0070693_100162399 3300005547 Bacteria 1424
58 Ga0070665_100019726 3300005548 Bacteria 6768
59 Ga0070665_100179690 3300005548 Bacteria 2117
60 Ga0070665_100320591 3300005548 Bacteria 1554
61 Ga0070704_100007160 3300005549 Bacteria 6626
62 Ga0068855_100007756 3300005563 Bacteria 12962
63 Ga0068855_100086501 3300005563 Bacteria 3625
64 Ga0068855_100170872 3300005563 Archaea 2462
65 Ga0068854_100001842 3300005578 Bacteria 12910
66 Ga0068856_100066280 3300005614 Archaea 3568
67 Ga0070702_100034201 3300005615 Bacteria 2800
68 Ga0070702_100105243 3300005615 Bacteria 1739
69 Ga0068859_100009585 3300005617 Bacteria 9778
70 Ga0068859_100046992 3300005617 Bacteria 4335
71 Ga0068859_100053560 3300005617 Bacteria 4058
72 Ga0068859_100122205 3300005617 Bacteria 2671
73 Ga0068864_100040257 3300005618 Bacteria 3998
74 Ga0068864_100043118 3300005618 Bacteria 3862
75 Ga0068864_100045934 3300005618 Bacteria 3747
76 Ga0068864_100196604 3300005618 Bacteria 1851
77 Ga0068866_10026875 3300005718 Bacteria 2724
78 Ga0068863_100027812 3300005841 Bacteria 5397
79 Ga0068860_100276667 3300005843 Bacteria 1639
80 Ga0068862_100009850 3300005844 Bacteria 7892
81 Ga0068862_100079628 3300005844 Bacteria 2840
82 Ga0068862_100116317 3300005844 Bacteria 2352
83 Ga0081455_10048277 3300005937 Bacteria 3680
84 Ga0081539_10015977 3300005985 Bacteria 5405
85 Ga0070717_10013422 3300006028 Bacteria 6279
86 Ga0075365_10005380 3300006038 Bacteria 6897
87 Ga0075362_10034611 3300006177 Bacteria 2203
88 Ga0075367_10047017 3300006178 Bacteria 2537
89 Ga0075367_10088590 3300006178 Bacteria 1881
90 Ga0097621_100009870 3300006237 Bacteria 6951
91 Ga0097621_100184476 3300006237 Bacteria 1804
92 Ga0068871_100097550 3300006358 Bacteria 2457
93 Ga0075428_100003688 3300006844 Bacteria 16797
94 Ga0075428_100009910 3300006844 Bacteria 10583
95 Ga0075428_100060950 3300006844 Bacteria 4131
96 Ga0075430_100002479 3300006846 Bacteria 15382
97 Ga0075430_100012440 3300006846 Bacteria 7241
98 Ga0075430_100136257 3300006846 Bacteria 2045
99 Ga0075433_10005009 3300006852 Bacteria 10376
100 Ga0075433_10109150 3300006852 Bacteria 2455
101 Ga0075434_100108335 3300006871 Bacteria 2788
102 Ga0075434_100362289 3300006871 Bacteria 1471
103 Ga0075429_100000904 3300006880 Bacteria 23465
104 Ga0075429_100083775 3300006880 Bacteria 2779
105 Ga0068865_100001375 3300006881 Bacteria 14154
106 Ga0068865_100007975 3300006881 Bacteria 6536
107 Ga0068865_100028253 3300006881 Bacteria 3712
108 Ga0075436_100057598 3300006914 Bacteria 2683
109 Ga0097620_100009585 3300006931 Bacteria 9778
110 Ga0097620_100046993 3300006931 Bacteria 4335
111 Ga0097620_100053563 3300006931 Bacteria 4058
112 Ga0097620_100122200 3300006931 Bacteria 2671
113 Ga0075435_100004472 3300007076 Bacteria 9608
114 Ga0075435_100006378 3300007076 Bacteria 8338
115 Ga0075435_100007942 3300007076 Bacteria 7593
116 Ga0075435_100008654 3300007076 Bacteria 7317
117 Ga0075435_100011200 3300007076 Bacteria 6582
118 Ga0105240_10213879 3300009093 Bacteria 2251
119 Ga0105240_10290293 3300009093 Archaea 1875
120 Ga0111539_10001248 3300009094 Bacteria 33874
121 Ga0111539_10015154 3300009094 Bacteria 9605
122 Ga0111539_10025773 3300009094 Bacteria 7201
123 Ga0111539_10145271 3300009094 Bacteria 2777
124 Ga0105245_10025967 3300009098 Bacteria 5154
125 Ga0105245_10059219 3300009098 Bacteria 3448
126 Ga0105245_10155658 3300009098 Bacteria 2164
127 Ga0114129_10008132 3300009147 Bacteria 14952
128 Ga0114129_10015599 3300009147 Bacteria 10803
129 Ga0114129_10024275 3300009147 Bacteria 8589
130 Ga0114129_10034380 3300009147 Bacteria 7159
131 Ga0114129_10048941 3300009147 Bacteria 5941
132 Ga0114129_10078675 3300009147 Bacteria 4586
133 Ga0114129_10096477 3300009147 Bacteria 4093
134 Ga0114129_10299566 3300009147 Bacteria 2143
135 Ga0105243_10032318 3300009148 Bacteria 4042
136 Ga0105243_10041545 3300009148 Bacteria 3597
137 Ga0105241_10006557 3300009174 Bacteria 8580
138 Ga0105241_10158744 3300009174 Viruses 1857
139 Ga0105242_10002905 3300009176 Bacteria 13397
140 Ga0105242_10007747 3300009176 Bacteria 8263
141 Ga0105242_10033780 3300009176 Bacteria 4098
142 Ga0105242_10062240 3300009176 Bacteria 3071
143 Ga0105242_10146763 3300009176 Bacteria 2053
144 Ga0105248_10005851 3300009177 Bacteria 13514
145 Ga0105248_10008645 3300009177 Bacteria 11186
146 Ga0105248_10018576 3300009177 Bacteria 7686
147 Ga0105248_10142687 3300009177 Bacteria 2702
148 Ga0105248_10202049 3300009177 Bacteria 2239
149 Ga0105237_10381286 3300009545 Unclassified 1415
150 Ga0105249_10086883 3300009553 Bacteria 2917
151 Ga0157370_10177958 3300013104 Bacteria 1977
152 Ga0157369_10181439 3300013105 Bacteria 2215
153 Ga0157378_10059176 3300013297 Bacteria 3418
154 Ga0163162_10010368 3300013306 Bacteria 9058
155 Ga0157372_10205391 3300013307 Bacteria 2283
156 Ga0163163_10026545 3300014325 Bacteria 5538
157 Ga0157380_10013183 3300014326 Bacteria 6020
158 Ga0157380_10023760 3300014326 Bacteria 4628
159 Ga0157377_10016857 3300014745 Bacteria 3767
160 Ga0157377_10039827 3300014745 Unclassified 2600
161 Ga0157377_10045273 3300014745 Bacteria 2457
162 Ga0157379_10010915 3300014968 Bacteria 7919
163 Ga0157379_10023650 3300014968 Bacteria 5454
164 Ga0157376_10072574 3300014969 Bacteria 2928
165 Ga0207697_10000133 3300025315 Bacteria 35922
166 Ga0207682_10023030 3300025893 Bacteria 2458
167 Ga0207642_10015403 3300025899 Bacteria 2848
168 Ga0207642_10078252 3300025899 Bacteria 1597
169 Ga0207688_10014426 3300025901 Bacteria 4295
170 Ga0207680_10037753 3300025903 Bacteria 2791
171 Ga0207645_10003615 3300025907 Bacteria 11695
172 Ga0207645_10005463 3300025907 Bacteria 9199
173 Ga0207643_10010808 3300025908 Bacteria 4923
174 Ga0207707_10133239 3300025912 Bacteria 2173
175 Ga0207662_10043825 3300025918 Bacteria 2640
176 Ga0207646_10083247 3300025922 Bacteria 2861
177 Ga0207681_10045133 3300025923 Bacteria 2957
178 Ga0207681_10091011 3300025923 Bacteria 2178
179 Ga0207650_10021073 3300025925 Bacteria 4605
180 Ga0207650_10036446 3300025925 Bacteria 3579
181 Ga0207650_10041804 3300025925 Bacteria 3361
182 Ga0207659_10002490 3300025926 Bacteria 10981
183 Ga0207659_10044605 3300025926 Bacteria 3120
184 Ga0207659_10185148 3300025926 Bacteria 1653
185 Ga0207687_10018213 3300025927 Bacteria 4632
186 Ga0207700_10021119 3300025928 Bacteria 4438
187 Ga0207644_10032344 3300025931 Bacteria 3649
188 Ga0207644_10110057 3300025931 Bacteria 2082
189 Ga0207706_10127682 3300025933 Bacteria 2236
190 Ga0207686_10012492 3300025934 Bacteria 4669
191 Ga0207686_10057024 3300025934 Bacteria 2458
192 Ga0207686_10102050 3300025934 Bacteria 1917
193 Ga0207709_10027050 3300025935 Bacteria 3300
194 Ga0207670_10129957 3300025936 Bacteria 1844
195 Ga0207669_10057988 3300025937 Bacteria 2361
196 Ga0207669_10065594 3300025937 Bacteria 2253
197 Ga0207691_10004760 3300025940 Bacteria 13124
198 Ga0207691_10006545 3300025940 Bacteria 11247
199 Ga0207691_10011217 3300025940 Bacteria 8600
200 Ga0207711_10023397 3300025941 Bacteria 5173
201 Ga0207711_10105350 3300025941 Bacteria 2501
202 Ga0207711_10247942 3300025941 Bacteria 1634
203 Ga0207689_10038563 3300025942 Bacteria 3956
204 Ga0207689_10039147 3300025942 Bacteria 3925
205 Ga0207679_10176106 3300025945 Bacteria 1766
206 Ga0207651_10031173 3300025960 Bacteria 3404
207 Ga0207651_10244524 3300025960 Bacteria 1464
208 Ga0207712_10031135 3300025961 Bacteria 3591
209 Ga0207712_10072826 3300025961 Bacteria 2476
210 Ga0207712_10212156 3300025961 Bacteria 1543
211 Ga0207668_10106788 3300025972 Bacteria 2092
212 Ga0207640_10009976 3300025981 Bacteria 5335
213 Ga0207658_10041127 3300025986 Bacteria 3346
214 Ga0207677_10128563 3300026023 Bacteria 1919
215 Ga0207703_10039946 3300026035 Bacteria 3752
216 Ga0207703_10098441 3300026035 Bacteria 2473
217 Ga0207708_10000984 3300026075 Bacteria 21320
218 Ga0207708_10028885 3300026075 Bacteria 4199
219 Ga0207708_10087981 3300026075 Bacteria 2393
220 Ga0207641_10000334 3300026088 Bacteria 57516
221 Ga0207641_10022385 3300026088 Bacteria 5203
222 Ga0207641_10022747 3300026088 Bacteria 5161
223 Ga0207641_10080962 3300026088 Bacteria 2819
224 Ga0207648_10001967 3300026089 Bacteria 22450
225 Ga0207648_10025073 3300026089 Bacteria 5316
226 Ga0207648_10033554 3300026089 Bacteria 4527
227 Ga0207648_10117000 3300026089 Bacteria 2343
228 Ga0207676_10021861 3300026095 Bacteria 4698
229 Ga0207676_10042997 3300026095 Bacteria 3476
230 Ga0207676_10171058 3300026095 Bacteria 1893
231 Ga0207676_10197948 3300026095 Bacteria 1773
232 Ga0207674_10092874 3300026116 Bacteria 3007
233 Ga0207675_100002149 3300026118 Bacteria 19583
234 Ga0207675_100105837 3300026118 Bacteria 2652
235 Ga0207683_10104382 3300026121 Bacteria 2533
236 Ga0207428_10009744 3300027907 Bacteria 8610
237 Ga0207428_10010632 3300027907 Bacteria 8210
238 Ga0207428_10011464 3300027907 Bacteria 7835
239 Ga0207428_10048117 3300027907 Bacteria 3422
240 Ga0268266_10039178 3300028379 Bacteria 4035
241 Ga0268265_10030138 3300028380 Bacteria 3903
242 Ga0268265_10087895 3300028380 Bacteria 2474
243 Ga0268264_10133269 3300028381 Bacteria 2206
244 Ga0307405_10023908 3300031731 Bacteria 3482
245 Ga0307410_10030082 3300031852 Bacteria 3466
246 Ga0307407_10066955 3300031903 Bacteria 2120
247 Ga0307409_100002509 3300031995 Bacteria 9615
248 Ga0307416_100041650 3300032002 Bacteria 3579
249 Ga0307416_100083469 3300032002 Bacteria 2711
250 Ga0307416_100126864 3300032002 Bacteria 2287
251 Ga0307414_10048381 3300032004 Bacteria 2933
252 Ga0307411_10015884 3300032005 Bacteria 4244
253 Ga0373958_0001511 3300034819 Bacteria 3130
254 Ga0373928_0008746 3300035084 Bacteria 1970
255 Ga0373929_0000499 3300035085 Bacteria 7486
256 Ga0373940_0001200 3300035088 Bacteria 4568
257 Ga0373949_0000556 3300035090 Bacteria 12277
258 Ga0373952_0000278 3300035092 Bacteria 8436
259 Ga0373939_0001159 3300035114 Bacteria 6460
260 Ga0373941_0000101 3300035115 Bacteria 14297
261 Ga0373941_0010876 3300035115 Bacteria 2339
262 Ga0373945_0059687 3300035116 Bacteria 1421
263 Ga0373960_0008353 3300035121 Bacteria 2479
264 Ga0373955_0022912 3300035172 Bacteria 3175
265 Ga0373942_0001633 3300035207 Bacteria 5717
266 Ga0373961_0002102 3300035241 Bacteria 5297
267 Ga0373962_0005054 3300035242 Bacteria 3187
268 Ga0373931_0040462 3300035691 Bacteria 2446
269 Ga0373947_0071225 3300035725 Bacteria 2132
270 Ga0373937_0000467 3300036401 Bacteria 37384
271 Ga0373937_0013465 3300036401 Bacteria 7205
272 Ga0373925_0001019 3300037068 Bacteria 25348
273 Ga0373925_0040722 3300037068 Bacteria 3441
274 Ga0395905_0270058 3300037471 Bacteria 1587
275 Ga0439446_0007667 3300042156 Bacteria 2844
276 Ga0439435_0011205 3300042436 Bacteria 2147
277 Ga0439464_0037636 3300042439 Bacteria 1372
278 Ga0451576_0151608 3300045051 Bacteria 2417
279 Ga0495629_0102187 3300046459 Bacteria 2000
280 Ga0495638_0005714 3300046460 Bacteria 9163
281 Ga0495580_0128743 3300046472 Unclassified 1756
282 Ga0495586_0049331 3300046535 Bacteria 2276
283 Ga0495645_0009533 3300046543 Bacteria 6788
284 Ga0495600_0091118 3300046809 Bacteria 1989
285 Ga0495674_0258661 3300047319 Unclassified 1431
286 Ga0495675_0132037 3300047444 Bacteria 1552
287 Ga0496102_0056533 3300048905 Bacteria 3580
288 Ga0496104_0125658 3300048907 Bacteria 2463
289 Ga0496106_0098732 3300048909 Bacteria 2263
290 Ga0496109_0116093 3300048912 Bacteria 2491
291 Ga0496109_0123197 3300048912 Bacteria 2416
292 Ga0496110_0143892 3300048913 Bacteria 2156
293 Ga0496112_0024277 3300048915 Bacteria 5803
294 Ga0496112_0135000 3300048915 Bacteria 2438
295 Ga0496113_0080937 3300048916 Bacteria 2489
296 Ga0496114_0027487 3300048917 Bacteria 4661
297 Ga0501291_006114 3300049514 Bacteria 1596
298 Ga0501292_010840 3300049515 Bacteria 1371
299 Ga0501031_0054629 3300049568 Bacteria 2602
300 Ga0501031_0069141 3300049568 Bacteria 2300
301 Ga0501036_0011183 3300049572 Bacteria 7427
302 Ga0501038_0135488 3300049574 Bacteria 2018
303 Ga0501039_0022874 3300049575 Bacteria 4795
304 Ga0501042_0039146 3300049578 Bacteria 3368
305 Ga0501048_0013175 3300049582 Bacteria 6137
306 Ga0501071_0118990 3300049587 Bacteria 1957
307 Ga0501072_0032228 3300049588 Bacteria 4105
308 Ga0501072_0084677 3300049588 Bacteria 2514
309 Ga0501075_0041861 3300049591 Bacteria 3433
310 Ga0501075_0042231 3300049591 Bacteria 3418
311 Ga0501076_0034543 3300049592 Bacteria 3953
312 Ga0501076_0145214 3300049592 Bacteria 1929
313 Ga0501217_007193 3300049661 Bacteria 2381
314 Ga0501081_0077146 3300049743 Bacteria 2328
315 Ga0501081_0128312 3300049743 Bacteria 1810
316 Ga0501045_0004302 3300049824 Bacteria 9823
317 nmdc:mga05p37_109340_c1 3300050507 Bacteria 3401
318 nmdc:mga05p37_1252_c1 3300050507 Bacteria 29465
319 nmdc:mga05p37_17597_c1 3300050507 Bacteria 8626
320 nmdc:mga05p37_19883_c1 3300050507 Bacteria 8122
321 nmdc:mga05p37_204186_c1 3300050507 Bacteria 2391
322 nmdc:mga05p37_255558_c1 3300050507 Bacteria 2100
323 nmdc:mga05p37_37447_c1 3300050507 Bacteria 5946
324 nmdc:mga05p37_60585_c1 3300050507 Bacteria 4660
325 nmdc:mga05p37_72196_c1 3300050507 Bacteria 4247
326 nmdc:mga09592_25526_c1 3300050508 Bacteria 4892
327 nmdc:mga06r32_57266_c1 3300050510 Bacteria 3744
328 nmdc:mga08y16_113988_c1 3300050511 Bacteria 2814
329 nmdc:mga08y16_140236_c1 3300050511 Bacteria 2513
330 nmdc:mga08y16_1747_c1 3300050511 Bacteria 22016
331 nmdc:mga08y16_33885_c1 3300050511 Bacteria 5365
332 nmdc:mga08y16_73481_c1 3300050511 Bacteria 3564
333 nmdc:mga08y16_8464_c1 3300050511 Bacteria 10772
334 nmdc:mga08y16_84810_c1 3300050511 Bacteria 3302
335 nmdc:mga0n895_107667_c1 3300050512 Bacteria 2801
336 nmdc:mga0n895_123697_c1 3300050512 Bacteria 2609
337 nmdc:mga0n895_12698_c1 3300050512 Bacteria 7563
338 nmdc:mga0n895_18847_c1 3300050512 Bacteria 6398
339 nmdc:mga0n895_54505_c1 3300050512 Bacteria 3934
340 nmdc:mga0rr50_111754_c1 3300050513 Bacteria 2163
341 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
342 nmdc:mga0rr50_3040_c1 3300050513 Bacteria 9597
343 nmdc:mga0rr50_42169_c1 3300050513 Bacteria 3331
344 nmdc:mga0rr50_48872_c1 3300050513 Bacteria 3129
345 nmdc:mga0rr50_5378_c1 3300050513 Bacteria 7631
346 nmdc:mga0rr50_60091_c1 3300050513 Bacteria 2858
347 nmdc:mga08x19_142141_c1 3300050514 Bacteria 1622
348 nmdc:mga08x19_2537_c1 3300050514 Bacteria 11101
349 nmdc:mga08x19_7725_c1 3300050514 Bacteria 6387
350 nmdc:mga0a205_22133_c1 3300050515 Bacteria 6016
351 nmdc:mga0a205_30011_c1 3300050515 Bacteria 5205
352 nmdc:mga0a205_37028_c1 3300050515 Bacteria 4691
353 Ga0495601_0043454 3300053077 Bacteria 2822
354 Ga0495601_0102369 3300053077 Unclassified 1851
355 Ga0495595_0009986 3300053084 Bacteria 3936
356 Ga0495619_0025758 3300053085 Bacteria 3780
357 Ga0495619_0059239 3300053085 Bacteria 2544
358 Ga0500555_000258 3300053103 Bacteria 23303
359 Ga0500592_006244 3300053116 Bacteria 1897
360 Ga0500628_014224 3300053129 Bacteria 1500
361 Ga0500616_0000489 3300053153 Bacteria 51122
362 Ga0500645_000060 3300053730 Bacteria 89018
363 Ga0501084_0251914 3300054114 Bacteria 1490
364 Ga0590071_000144 3300059421 Bacteria 20231
365 Ga0590071_002710 3300059421 Bacteria 4444
366 Ga0590074_000898 3300059423 Bacteria 4636
367 Ga0590075_000892 3300059424 Bacteria 7810
368 Ga0590075_001091 3300059424 Bacteria 7004
369 Ga0590075_009030 3300059424 Bacteria 2387
370 Ga0590077_000670 3300059426 Bacteria 9109
371 Ga0590077_000939 3300059426 Bacteria 7443
372 Ga0501082_0158589 3300060353 Bacteria 1966
373 Ga0530510_0036697 3300061734 Bacteria 3532
374 Ga0530510_0144541 3300061734 Bacteria 1754
375 Ga0070697_100026328
376 Ga0065712_10004925
377 Ga0065712_10071843
378 Ga0065712_10072379
379 Ga0070676_10001644
380 Ga0070676_10068072
381 Ga0070670_100002529
382 Ga0070666_10035053
383 Ga0070666_10049536
384 Ga0070666_10070793
385 Ga0070680_100029545
386 Ga0070680_100238714
387 Ga0068868_100013865
388 Ga0070689_100099351
389 Ga0070687_100020173
390 Ga0070668_100134156
391 Ga0070668_100137420
392 Ga0070669_100061202
393 Ga0070675_100004573
394 Ga0070675_100009376
395 Ga0070675_100065065
396 Ga0070675_100247447
397 Ga0070671_100059528
398 Ga0070671_100075408
399 Ga0070674_100085351
400 Ga0070674_100274686
401 Ga0070673_100018639
402 Ga0070673_100131168
403 Ga0070673_100305398
404 Ga0070667_100003724
405 Ga0070667_100133593
406 Ga0070713_100139776
407 Ga0070701_10008715
408 Ga0070701_10058296
409 Ga0070700_100010701
410 Ga0070700_100031609
411 Ga0070694_100006130
412 Ga0070708_100075997
413 Ga0070663_100053846
414 Ga0070681_10038782
415 Ga0068867_100020875
416 Ga0068867_100054669
417 Ga0070698_100017397
418 Ga0070698_100069220
419 Ga0070698_100257459
420 Ga0070699_100004064
421 Ga0070679_100005983
422 Ga0070679_100019812
423 Ga0070672_100006192
424 Ga0070672_100093357
425 Ga0070686_100000289
426 Ga0070686_100042829
427 Ga0070686_100122094
428 Ga0070695_100018049
429 Ga0070696_100009482
430 Ga0070696_100034473
431 Ga0070693_100162399
432 Ga0070665_100019726
433 Ga0070665_100179690
434 Ga0070665_100320591
435 Ga0070704_100007160
436 Ga0068855_100007756
437 Ga0068855_100086501
438 Ga0068855_100170872
439 Ga0068854_100001842
440 Ga0068856_100066280
441 Ga0070702_100034201
442 Ga0070702_100105243
443 Ga0068859_100009585
444 Ga0068859_100046992
445 Ga0068859_100053560
446 Ga0068859_100122205
447 Ga0068864_100040257
448 Ga0068864_100043118
449 Ga0068864_100045934
450 Ga0068864_100196604
451 Ga0068866_10026875
452 Ga0068863_100027812
453 Ga0068860_100276667
454 Ga0068862_100009850
455 Ga0068862_100079628
456 Ga0068862_100116317
457 Ga0081455_10048277
458 Ga0081539_10015977
459 Ga0070717_10013422
460 Ga0075365_10005380
461 Ga0075362_10034611
462 Ga0075367_10047017
463 Ga0075367_10088590
464 Ga0097621_100009870
465 Ga0097621_100184476
466 Ga0068871_100097550
467 Ga0075428_100003688
468 Ga0075428_100009910
469 Ga0075428_100060950
470 Ga0075430_100002479
471 Ga0075430_100012440
472 Ga0075430_100136257
473 Ga0075433_10005009
474 Ga0075433_10109150
475 Ga0075434_100108335
476 Ga0075434_100362289
477 Ga0075429_100000904
478 Ga0075429_100083775
479 Ga0068865_100001375
480 Ga0068865_100007975
481 Ga0068865_100028253
482 Ga0075436_100057598
483 Ga0097620_100009585
484 Ga0097620_100046993
485 Ga0097620_100053563
486 Ga0097620_100122200
487 Ga0075435_100004472
488 Ga0075435_100006378
489 Ga0075435_100007942
490 Ga0075435_100008654
491 Ga0075435_100011200
492 Ga0105240_10213879
493 Ga0105240_10290293
494 Ga0111539_10001248
495 Ga0111539_10015154
496 Ga0111539_10025773
497 Ga0111539_10145271
498 Ga0105245_10025967
499 Ga0105245_10059219
500 Ga0105245_10155658
501 Ga0114129_10008132
502 Ga0114129_10015599
503 Ga0114129_10024275
504 Ga0114129_10034380
505 Ga0114129_10048941
506 Ga0114129_10078675
507 Ga0114129_10096477
508 Ga0114129_10299566
509 Ga0105243_10032318
510 Ga0105243_10041545
511 Ga0105241_10006557
512 Ga0105241_10158744
513 Ga0105242_10002905
514 Ga0105242_10007747
515 Ga0105242_10033780
516 Ga0105242_10062240
517 Ga0105242_10146763
518 Ga0105248_10005851
519 Ga0105248_10008645
520 Ga0105248_10018576
521 Ga0105248_10142687
522 Ga0105248_10202049
523 Ga0105237_10381286
524 Ga0105249_10086883
525 Ga0157370_10177958
526 Ga0157369_10181439
527 Ga0157378_10059176
528 Ga0163162_10010368
529 Ga0157372_10205391
530 Ga0163163_10026545
531 Ga0157380_10013183
532 Ga0157380_10023760
533 Ga0157377_10016857
534 Ga0157377_10039827
535 Ga0157377_10045273
536 Ga0157379_10010915
537 Ga0157379_10023650
538 Ga0157376_10072574
539 Ga0207697_10000133
540 Ga0207682_10023030
541 Ga0207642_10015403
542 Ga0207642_10078252
543 Ga0207688_10014426
544 Ga0207680_10037753
545 Ga0207645_10003615
546 Ga0207645_10005463
547 Ga0207643_10010808
548 Ga0207707_10133239
549 Ga0207662_10043825
550 Ga0207646_10083247
551 Ga0207681_10045133
552 Ga0207681_10091011
553 Ga0207650_10021073
554 Ga0207650_10036446
555 Ga0207650_10041804
556 Ga0207659_10002490
557 Ga0207659_10044605
558 Ga0207659_10185148
559 Ga0207687_10018213
560 Ga0207700_10021119
561 Ga0207644_10032344
562 Ga0207644_10110057
563 Ga0207706_10127682
564 Ga0207686_10012492
565 Ga0207686_10057024
566 Ga0207686_10102050
567 Ga0207709_10027050
568 Ga0207670_10129957
569 Ga0207669_10057988
570 Ga0207669_10065594
571 Ga0207691_10004760
572 Ga0207691_10006545
573 Ga0207691_10011217
574 Ga0207711_10023397
575 Ga0207711_10105350
576 Ga0207711_10247942
577 Ga0207689_10038563
578 Ga0207689_10039147
579 Ga0207679_10176106
580 Ga0207651_10031173
581 Ga0207651_10244524
582 Ga0207712_10031135
583 Ga0207712_10072826
584 Ga0207712_10212156
585 Ga0207668_10106788
586 Ga0207640_10009976
587 Ga0207658_10041127
588 Ga0207677_10128563
589 Ga0207703_10039946
590 Ga0207703_10098441
591 Ga0207708_10000984
592 Ga0207708_10028885
593 Ga0207708_10087981
594 Ga0207641_10000334
595 Ga0207641_10022385
596 Ga0207641_10022747
597 Ga0207641_10080962
598 Ga0207648_10001967
599 Ga0207648_10025073
600 Ga0207648_10033554
601 Ga0207648_10117000
602 Ga0207676_10021861
603 Ga0207676_10042997
604 Ga0207676_10171058
605 Ga0207676_10197948
606 Ga0207674_10092874
607 Ga0207675_100002149
608 Ga0207675_100105837
609 Ga0207683_10104382
610 Ga0207428_10009744
611 Ga0207428_10010632
612 Ga0207428_10011464
613 Ga0207428_10048117
614 Ga0268266_10039178
615 Ga0268265_10030138
616 Ga0268265_10087895
617 Ga0268264_10133269
618 Ga0307405_10023908
619 Ga0307410_10030082
620 Ga0307407_10066955
621 Ga0307409_100002509
622 Ga0307416_100041650
623 Ga0307416_100083469
624 Ga0307416_100126864
625 Ga0307414_10048381
626 Ga0307411_10015884
627 Ga0373958_0001511
628 Ga0373928_0008746
629 Ga0373929_0000499
630 Ga0373940_0001200
631 Ga0373949_0000556
632 Ga0373952_0000278
633 Ga0373939_0001159
634 Ga0373941_0000101
635 Ga0373941_0010876
636 Ga0373945_0059687
637 Ga0373960_0008353
638 Ga0373955_0022912
639 Ga0373942_0001633
640 Ga0373961_0002102
641 Ga0373962_0005054
642 Ga0373931_0040462
643 Ga0373947_0071225
644 Ga0373937_0000467
645 Ga0373937_0013465
646 Ga0373925_0001019
647 Ga0373925_0040722
648 Ga0395905_0270058
649 Ga0439446_0007667
650 Ga0439435_0011205
651 Ga0439464_0037636
652 Ga0451576_0151608
653 Ga0495629_0102187
654 Ga0495638_0005714
655 Ga0495580_0128743
656 Ga0495586_0049331
657 Ga0495645_0009533
658 Ga0495600_0091118
659 Ga0495674_0258661
660 Ga0495675_0132037
661 Ga0496102_0056533
662 Ga0496104_0125658
663 Ga0496106_0098732
664 Ga0496109_0116093
665 Ga0496109_0123197
666 Ga0496110_0143892
667 Ga0496112_0024277
668 Ga0496112_0135000
669 Ga0496113_0080937
670 Ga0496114_0027487
671 Ga0501291_006114
672 Ga0501292_010840
673 Ga0501031_0054629
674 Ga0501031_0069141
675 Ga0501036_0011183
676 Ga0501038_0135488
677 Ga0501039_0022874
678 Ga0501042_0039146
679 Ga0501048_0013175
680 Ga0501071_0118990
681 Ga0501072_0032228
682 Ga0501072_0084677
683 Ga0501075_0041861
684 Ga0501075_0042231
685 Ga0501076_0034543
686 Ga0501076_0145214
687 Ga0501217_007193
688 Ga0501081_0077146
689 Ga0501081_0128312
690 Ga0501045_0004302
691 nmdc:mga05p37_109340_c1
692 nmdc:mga05p37_1252_c1
693 nmdc:mga05p37_17597_c1
694 nmdc:mga05p37_19883_c1
695 nmdc:mga05p37_204186_c1
696 nmdc:mga05p37_255558_c1
697 nmdc:mga05p37_37447_c1
698 nmdc:mga05p37_60585_c1
699 nmdc:mga05p37_72196_c1
700 nmdc:mga09592_25526_c1
701 nmdc:mga06r32_57266_c1
702 nmdc:mga08y16_113988_c1
703 nmdc:mga08y16_140236_c1
704 nmdc:mga08y16_1747_c1
705 nmdc:mga08y16_33885_c1
706 nmdc:mga08y16_73481_c1
707 nmdc:mga08y16_8464_c1
708 nmdc:mga08y16_84810_c1
709 nmdc:mga0n895_107667_c1
710 nmdc:mga0n895_123697_c1
711 nmdc:mga0n895_12698_c1
712 nmdc:mga0n895_18847_c1
713 nmdc:mga0n895_54505_c1
714 nmdc:mga0rr50_111754_c1
715 nmdc:mga0rr50_20_c1
716 nmdc:mga0rr50_3040_c1
717 nmdc:mga0rr50_42169_c1
718 nmdc:mga0rr50_48872_c1
719 nmdc:mga0rr50_5378_c1
720 nmdc:mga0rr50_60091_c1
721 nmdc:mga08x19_142141_c1
722 nmdc:mga08x19_2537_c1
723 nmdc:mga08x19_7725_c1
724 nmdc:mga0a205_22133_c1
725 nmdc:mga0a205_30011_c1
726 nmdc:mga0a205_37028_c1
727 Ga0495601_0043454
728 Ga0495601_0102369
729 Ga0495595_0009986
730 Ga0495619_0025758
731 Ga0495619_0059239
732 Ga0500555_000258
733 Ga0500592_006244
734 Ga0500628_014224
735 Ga0500616_0000489
736 Ga0500645_000060
737 Ga0501084_0251914
738 Ga0590071_000144
739 Ga0590071_002710
740 Ga0590074_000898
741 Ga0590075_000892
742 Ga0590075_001091
743 Ga0590075_009030
744 Ga0590077_000670
745 Ga0590077_000939
746 Ga0501082_0158589
747 Ga0530510_0036697
748 Ga0530510_0144541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

277

398

0.95

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

170

497

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t1q-assembly1.cif.gz_B crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid 0.852 18 406
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.846 12 406
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8422 15 171
5xoy-assembly1.cif.gz_B-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.8384 12 406
7uoi-assembly1.cif.gz_A-2 crystallographic structure of dape from enterococcus faecium 0.8287 11 403
ID Description Score Start End Superfamily
af_P23908_180_301_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8892 189 316 3.30.70.360
af_P23908_15_171_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8556 26 173 3.40.630.10
af_P23908_180_301_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.855 189 316 3.30.70.360
1q7lC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8445 15 171 3.40.630.10
af_L7N684_5_212_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.844 25 157 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A529P5V8-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.954 195 408 GO:0016787
AF-A0A2V7V7M7-F1-model_v4 Succinyl-diaminopimelate desuccinylase 0.951 175 405 GO:0016787
AF-A0A354Q8A0-F1-model_v4 Succinyl-diaminopimelate desuccinylase 0.9476 117 407 GO:0016787
GO:0046872
AF-A0A3S1Z298-F1-model_v4 deleted 0.9392 12 293
AF-A0A2V7V7M7-F1-model_v4 Succinyl-diaminopimelate desuccinylase 0.9316 175 405 GO:0016787

Map