F426634

General Info

Members Datasets Scaffolds Average Seq Length
374 218 748 268

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100203501|Ga0070699_1002035011
Length 324
Sequence LRFNSEPCRGDACPACILSTPRLKLIRLNPSVTRDYTGLNLLRLDTEGCWQQSEPMINGKRIGVVLPAYNAEQTLEQTVRELPDLVDIRILVDDCSTDRTLQVAQRLGLHTFAHDRNYGYGRNQQTCYREALSAGADVIIMVHPDYQYTPLLVTAMASMVAYGVYDVVLGSRILGGSALRGGMPRYKYISNRCLTLVQNWFLGAKLSEYHTGYRAFSRRVLSELPLLENSDDFVFDNQILAQCVYFGFNIGEVSCPTKYFPEASSINFRRSVKYGLGVLATSLQFGLQKAGLGRFRVFNPAGRKLETSGNKYYARSAGHSLSAT

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 1.07
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 16.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100203501 3300005518 Bacteria 1761
2 LJNas_1000113 3300000546 Bacteria 12625
3 LJQas_1008214 3300000549 Bacteria 1273
4 Ga0070690_100016126 3300005330 Bacteria 4470
5 Ga0070666_10000590 3300005335 Bacteria 21907
6 Ga0070682_100562979 3300005337 Unclassified 894
7 Ga0068868_100023018 3300005338 Bacteria 4711
8 Ga0070687_100107778 3300005343 Unclassified 1571
9 Ga0070688_100012527 3300005365 Bacteria 4753
10 Ga0070667_100015106 3300005367 Bacteria 6378
11 Ga0070709_10031176 3300005434 Bacteria 3206
12 Ga0070709_10066245 3300005434 Bacteria 2316
13 Ga0070714_100011197 3300005435 Bacteria 7111
14 Ga0070714_100024147 3300005435 Bacteria 5000
15 Ga0070713_100012487 3300005436 Bacteria 6232
16 Ga0070713_100033994 3300005436 Bacteria 4090
17 Ga0070711_100029969 3300005439 Bacteria 3597
18 Ga0070711_100112260 3300005439 Bacteria 2002
19 Ga0070711_100202176 3300005439 Bacteria 1534
20 Ga0070705_100365560 3300005440 Unclassified 1057
21 Ga0070708_100028930 3300005445 Bacteria 4773
22 Ga0070678_100586804 3300005456 Bacteria 993
23 Ga0070681_10077737 3300005458 Bacteria 3276
24 Ga0070681_10326822 3300005458 Bacteria 1443
25 Ga0068867_100396439 3300005459 Bacteria 1163
26 Ga0070706_100327348 3300005467 Unclassified 1429
27 Ga0070707_100000123 3300005468 Bacteria 72844
28 Ga0070707_100134966 3300005468 Bacteria 2400
29 Ga0070698_100001677 3300005471 Bacteria 24715
30 Ga0070698_100078550 3300005471 Bacteria 3299
31 Ga0070698_100120786 3300005471 Unclassified 2581
32 Ga0070699_100216745 3300005518 Bacteria 1705
33 Ga0070679_100254881 3300005530 Bacteria 1710
34 Ga0070679_100312526 3300005530 Bacteria 1521
35 Ga0070697_100000015 3300005536 Bacteria 143397
36 Ga0070697_100119467 3300005536 Unclassified 2203
37 Ga0070697_100307370 3300005536 Bacteria 1364
38 Ga0068853_100216094 3300005539 Bacteria 1749
39 Ga0070693_100006929 3300005547 Bacteria 5512
40 Ga0070665_100332397 3300005548 Bacteria 1524
41 Ga0070665_100393488 3300005548 Bacteria 1394
42 Ga0070704_100193872 3300005549 Unclassified 1635
43 Ga0068855_100033361 3300005563 Bacteria 6144
44 Ga0068854_100012445 3300005578 Bacteria 5572
45 Ga0068854_100397238 3300005578 Bacteria 1140
46 Ga0068856_100085972 3300005614 Bacteria 3124
47 Ga0068856_100582454 3300005614 Bacteria 1140
48 Ga0068852_100005455 3300005616 Bacteria 9098
49 Ga0068852_100068134 3300005616 Bacteria 3113
50 Ga0068852_100130467 3300005616 Unclassified 2314
51 Ga0068859_100071704 3300005617 Bacteria 3500
52 Ga0068866_10028902 3300005718 Bacteria 2645
53 Ga0068861_100548648 3300005719 Bacteria 1053
54 Ga0068863_100010837 3300005841 Bacteria 8840
55 Ga0068858_100001314 3300005842 Bacteria 25673
56 Ga0068858_100407186 3300005842 Bacteria 1307
57 Ga0068860_100020264 3300005843 Bacteria 6442
58 Ga0068860_100124747 3300005843 Bacteria 2468
59 Ga0081540_1024050 3300005983 Bacteria 3544
60 Ga0070717_10001290 3300006028 Bacteria 17132
61 Ga0070717_10125760 3300006028 Bacteria 2201
62 Ga0070717_10225017 3300006028 Unclassified 1650
63 Ga0070717_10283683 3300006028 Unclassified 1469
64 Ga0070716_100011925 3300006173 Bacteria 4390
65 Ga0070716_100030535 3300006173 Unclassified 2924
66 Ga0070716_100119696 3300006173 Bacteria 1646
67 Ga0070712_100107258 3300006175 Bacteria 2078
68 Ga0097621_100000704 3300006237 Bacteria 23453
69 Ga0097621_100000808 3300006237 Bacteria 22062
70 Ga0097621_100517876 3300006237 Unclassified 1082
71 Ga0068871_100000910 3300006358 Bacteria 19702
72 Ga0068871_100001100 3300006358 Bacteria 18149
73 Ga0068871_100753073 3300006358 Unclassified 895
74 Ga0075428_100387814 3300006844 Bacteria 1497
75 Ga0075428_100712220 3300006844 Bacteria 1069
76 Ga0075433_10068210 3300006852 Bacteria 3122
77 Ga0075433_10180063 3300006852 Bacteria 1881
78 Ga0075434_100054598 3300006871 Bacteria 3969
79 Ga0075436_100071767 3300006914 Bacteria 2394
80 Ga0075436_100097862 3300006914 Bacteria 2041
81 Ga0097620_100071704 3300006931 Bacteria 3500
82 Ga0075435_100001845 3300007076 Bacteria 13750
83 Ga0099794_10040461 3300007265 Unclassified 2216
84 Ga0099794_10059169 3300007265 Bacteria 1858
85 Ga0099794_10118792 3300007265 Bacteria 1329
86 Ga0105240_10012325 3300009093 Bacteria 11808
87 Ga0105240_10035551 3300009093 Bacteria 6418
88 Ga0105240_10058846 3300009093 Bacteria 4797
89 Ga0105240_10139119 3300009093 Bacteria 2904
90 Ga0105240_10147808 3300009093 Bacteria 2802
91 Ga0105240_10445442 3300009093 Bacteria 1450
92 Ga0111539_10266484 3300009094 Bacteria 1994
93 Ga0105245_10001876 3300009098 Bacteria 19071
94 Ga0105245_10003617 3300009098 Bacteria 13791
95 Ga0105247_10053502 3300009101 Bacteria 2491
96 Ga0114129_10223632 3300009147 Bacteria 2538
97 Ga0114129_10308250 3300009147 Bacteria 2108
98 Ga0105243_10025204 3300009148 Bacteria 4542
99 Ga0105241_10696539 3300009174 Unclassified 927
100 Ga0105242_10005900 3300009176 Bacteria 9444
101 Ga0105248_10003207 3300009177 Bacteria 18139
102 Ga0105237_10200577 3300009545 Bacteria 1995
103 Ga0105238_10032955 3300009551 Bacteria 5273
104 Ga0105238_10096376 3300009551 Bacteria 2944
105 Ga0105238_10157972 3300009551 Bacteria 2243
106 Ga0105238_10479566 3300009551 Unclassified 1243
107 Ga0105249_10134216 3300009553 Bacteria 2367
108 Ga0099796_10011591 3300010159 Bacteria 2463
109 Ga0099796_10097301 3300010159 Unclassified 1102
110 Ga0105239_10001291 3300010375 Bacteria 33746
111 Ga0105239_10075200 3300010375 Bacteria 3713
112 Ga0105239_10231261 3300010375 Unclassified 2074
113 Ga0105239_10408862 3300010375 Bacteria 1536
114 Ga0157370_10003925 3300013104 Bacteria 17313
115 Ga0157370_10015091 3300013104 Bacteria 7871
116 Ga0157370_10091754 3300013104 Bacteria 2851
117 Ga0157369_10009435 3300013105 Bacteria 11155
118 Ga0157369_10019513 3300013105 Bacteria 7587
119 Ga0157369_10027211 3300013105 Bacteria 6341
120 Ga0157369_10060678 3300013105 Bacteria 4078
121 Ga0157374_10005045 3300013296 Bacteria 11074
122 Ga0157374_10042987 3300013296 Bacteria 4172
123 Ga0157374_10254951 3300013296 Bacteria 1727
124 Ga0157374_10877448 3300013296 Bacteria 914
125 Ga0157378_10000031 3300013297 Bacteria 124224
126 Ga0157378_10000507 3300013297 Bacteria 37013
127 Ga0157378_10007538 3300013297 Bacteria 9499
128 Ga0157378_10033616 3300013297 Bacteria 4534
129 Ga0163162_10006564 3300013306 Bacteria 11271
130 Ga0163162_10082531 3300013306 Bacteria 3286
131 Ga0157372_10002223 3300013307 Bacteria 21051
132 Ga0157372_10006979 3300013307 Bacteria 12028
133 Ga0157372_10009563 3300013307 Bacteria 10305
134 Ga0157375_10002033 3300013308 Bacteria 17447
135 Ga0163163_10015301 3300014325 Bacteria 7089
136 Ga0163163_10065452 3300014325 Unclassified 3608
137 Ga0182008_10026341 3300014497 Unclassified 2949
138 Ga0157379_10645853 3300014968 Unclassified 990
139 Ga0157376_10004228 3300014969 Bacteria 9963
140 Ga0157376_10009864 3300014969 Bacteria 6962
141 Ga0157376_10141069 3300014969 Unclassified 2162
142 Ga0157376_10231458 3300014969 Bacteria 1717
143 Ga0182006_1044216 3300015261 Bacteria 1738
144 Ga0213872_10035511 3300021361 Bacteria 2280
145 Ga0213875_10004728 3300021388 Bacteria 7411
146 Ga0213875_10142117 3300021388 Bacteria 1124
147 Ga0224572_1000586 3300024225 Bacteria 4509
148 Ga0207692_10022197 3300025898 Bacteria 2917
149 Ga0207692_10047293 3300025898 Bacteria 2159
150 Ga0207642_10077715 3300025899 Bacteria 1602
151 Ga0207680_10005790 3300025903 Bacteria 5932
152 Ga0207680_10010614 3300025903 Bacteria 4615
153 Ga0207699_10028971 3300025906 Bacteria 3083
154 Ga0207699_10045610 3300025906 Bacteria 2560
155 Ga0207684_10059358 3300025910 Bacteria 3248
156 Ga0207684_10257311 3300025910 Unclassified 1506
157 Ga0207707_10042503 3300025912 Bacteria 3966
158 Ga0207695_10001534 3300025913 Bacteria 38140
159 Ga0207695_10001696 3300025913 Bacteria 35355
160 Ga0207695_10058367 3300025913 Bacteria 4006
161 Ga0207695_10203831 3300025913 Bacteria 1891
162 Ga0207671_10282151 3300025914 Unclassified 1310
163 Ga0207671_10467306 3300025914 Bacteria 1005
164 Ga0207663_10111536 3300025916 Bacteria 1856
165 Ga0207663_10397874 3300025916 Bacteria 1053
166 Ga0207657_10005753 3300025919 Bacteria 12933
167 Ga0207657_10327293 3300025919 Bacteria 1211
168 Ga0207652_10327695 3300025921 Unclassified 1383
169 Ga0207646_10000042 3300025922 Bacteria 186121
170 Ga0207646_10476792 3300025922 Unclassified 1125
171 Ga0207694_10023537 3300025924 Bacteria 4675
172 Ga0207687_10003482 3300025927 Bacteria 10596
173 Ga0207687_10161652 3300025927 Unclassified 1719
174 Ga0207700_10227375 3300025928 Bacteria 1584
175 Ga0207700_10358589 3300025928 Unclassified 1271
176 Ga0207664_10010335 3300025929 Bacteria 6592
177 Ga0207664_10088944 3300025929 Unclassified 2528
178 Ga0207686_10247127 3300025934 Unclassified 1301
179 Ga0207709_10196289 3300025935 Unclassified 1438
180 Ga0207669_10255402 3300025937 Bacteria 1308
181 Ga0207665_10005192 3300025939 Bacteria 8695
182 Ga0207665_10115806 3300025939 Bacteria 1889
183 Ga0207711_10021010 3300025941 Bacteria 5451
184 Ga0207711_10122547 3300025941 Unclassified 2322
185 Ga0207689_10228343 3300025942 Bacteria 1538
186 Ga0207667_10003184 3300025949 Bacteria 20276
187 Ga0207651_10484077 3300025960 Bacteria 1067
188 Ga0207640_10042558 3300025981 Bacteria 2897
189 Ga0207658_10028428 3300025986 Bacteria 3937
190 Ga0207677_10030379 3300026023 Bacteria 3447
191 Ga0207703_10007624 3300026035 Bacteria 8580
192 Ga0207639_10260767 3300026041 Bacteria 1516
193 Ga0207639_10367408 3300026041 Bacteria 1289
194 Ga0207678_10332604 3300026067 Bacteria 1308
195 Ga0207702_10032340 3300026078 Bacteria 4365
196 Ga0207702_10189523 3300026078 Bacteria 1899
197 Ga0207702_10539924 3300026078 Bacteria 1140
198 Ga0207641_10019488 3300026088 Bacteria 5570
199 Ga0207648_10554937 3300026089 Bacteria 1055
200 Ga0207674_10057302 3300026116 Bacteria 3950
201 Ga0207698_10002588 3300026142 Bacteria 10756
202 Ga0207698_10006074 3300026142 Bacteria 7514
203 Ga0207698_10043961 3300026142 Bacteria 3352
204 Ga0209179_1009697 3300027512 Bacteria 1659
205 Ga0268266_10010615 3300028379 Bacteria 8025
206 Ga0268266_10435717 3300028379 Bacteria 1244
207 Ga0268264_10001104 3300028381 Bacteria 26660
208 Ga0265318_10067605 3300028577 Bacteria 1326
209 Ga0265338_10027940 3300028800 Bacteria 5645
210 Ga0265330_10005087 3300031235 Bacteria 6591
211 Ga0265332_10003409 3300031238 Bacteria 7684
212 Ga0265328_10018142 3300031239 Bacteria 2718
213 Ga0265325_10000399 3300031241 Bacteria 30785
214 Ga0265325_10000887 3300031241 Bacteria 21594
215 Ga0265329_10030216 3300031242 Bacteria 1767
216 Ga0265340_10002477 3300031247 Bacteria 10492
217 Ga0265340_10021151 3300031247 Bacteria 3337
218 Ga0265340_10064348 3300031247 Bacteria 1748
219 Ga0265339_10000891 3300031249 Bacteria 22927
220 Ga0265339_10028594 3300031249 Bacteria 3169
221 Ga0265339_10172129 3300031249 Bacteria 1083
222 Ga0265331_10000509 3300031250 Bacteria 36395
223 Ga0265331_10005860 3300031250 Bacteria 7357
224 Ga0265316_10047127 3300031344 Bacteria 3411
225 Ga0265316_10051473 3300031344 Bacteria 3235
226 Ga0265313_10001003 3300031595 Bacteria 27689
227 Ga0265313_10058346 3300031595 Bacteria 1819
228 Ga0265314_10000444 3300031711 Bacteria 55347
229 Ga0265314_10009468 3300031711 Bacteria 8216
230 Ga0265314_10051041 3300031711 Bacteria 2883
231 Ga0265342_10001670 3300031712 Bacteria 20374
232 Ga0265342_10013816 3300031712 Bacteria 5391
233 Ga0265342_10032834 3300031712 Bacteria 3198
234 Ga0307411_10199588 3300032005 Bacteria 1535
235 Ga0373926_0026548 3300035083 Unclassified 2027
236 Ga0373934_0111706 3300035086 Unclassified 1108
237 Ga0373923_0042958 3300035111 Unclassified 1869
238 Ga0373923_0049492 3300035111 Bacteria 1758
239 Ga0373923_0062615 3300035111 Bacteria 1583
240 Ga0373936_0011111 3300035113 Bacteria 3403
241 Ga0373945_0012705 3300035116 Bacteria 2801
242 Ga0373956_0032953 3300035119 Unclassified 2276
243 Ga0373957_0009711 3300035120 Unclassified 3154
244 Ga0373955_0015293 3300035172 Bacteria 3753
245 Ga0373955_0183464 3300035172 Bacteria 1242
246 Ga0373924_0006994 3300035410 Bacteria 4061
247 Ga0373924_0010255 3300035410 Bacteria 3449
248 Ga0373924_0067271 3300035410 Unclassified 1507
249 Ga0373935_0012869 3300035692 Bacteria 5040
250 Ga0373927_0101036 3300035695 Bacteria 1876
251 Ga0373933_0005733 3300035724 Bacteria 6756
252 Ga0373933_0029380 3300035724 Bacteria 3178
253 Ga0373937_0235195 3300036401 Bacteria 1725
254 Ga0373937_0347617 3300036401 Unclassified 1404
255 Ga0373925_0094987 3300037068 Bacteria 2283
256 Ga0373925_0137393 3300037068 Bacteria 1911
257 Ga0436364_0186621 3300037853 Bacteria 1833
258 Ga0436364_0387004 3300037853 Unclassified 1067
259 Ga0436364_0867073 3300037853 Bacteria 44959
260 Ga0436361_0285708 3300039447 Bacteria 6676
261 Ga0436363_0202593 3300039450 Bacteria 4687
262 Ga0436362_0604986 3300039453 Bacteria 9454
263 Ga0451577_0118246 3300042876 Unclassified 2374
264 Ga0453683_0370512 3300044673 Unclassified 921
265 Ga0453684_0012555 3300044712 Bacteria 13945
266 Ga0453684_0088714 3300044712 Unclassified 3828
267 Ga0453684_0090312 3300044712 Bacteria 3785
268 Ga0451576_0223818 3300045051 Unclassified 1965
269 Ga0495592_0202353 3300046454 Unclassified 1339
270 Ga0495651_0035504 3300046462 Bacteria 3880
271 Ga0495651_0038282 3300046462 Bacteria 3734
272 Ga0495653_0010253 3300046463 Bacteria 7666
273 Ga0495653_0147149 3300046463 Unclassified 1649
274 Ga0495664_0004488 3300046477 Bacteria 7639
275 Ga0495664_0323049 3300046477 Unclassified 930
276 Ga0495608_0017327 3300046511 Bacteria 4983
277 Ga0495608_0076645 3300046511 Bacteria 2177
278 Ga0495618_0028782 3300046514 Bacteria 3464
279 Ga0495618_0392873 3300046514 Unclassified 849
280 Ga0495628_0229352 3300046516 Unclassified 1392
281 Ga0495630_0028058 3300046517 Bacteria 4182
282 Ga0495630_0191867 3300046517 Bacteria 1559
283 Ga0495637_0112786 3300046520 Bacteria 1052
284 Ga0495652_0115865 3300046529 Bacteria 2146
285 Ga0495652_0154492 3300046529 Unclassified 1788
286 Ga0495665_0164025 3300046531 Bacteria 1158
287 Ga0495640_0095998 3300046533 Unclassified 1951
288 Ga0495640_0109235 3300046533 Bacteria 1809
289 Ga0495587_0011838 3300046536 Bacteria 5514
290 Ga0495587_0015349 3300046536 Bacteria 4785
291 Ga0495587_0059154 3300046536 Bacteria 2250
292 Ga0495645_0023812 3300046543 Bacteria 4437
293 Ga0495667_0033461 3300046559 Bacteria 3440
294 Ga0495634_0015182 3300046642 Bacteria 5537
295 Ga0495634_0030457 3300046642 Bacteria 3726
296 Ga0495635_0091646 3300046663 Bacteria 2078
297 Ga0495635_0105273 3300046663 Unclassified 1927
298 Ga0495635_0241898 3300046663 Unclassified 1217
299 Ga0495657_0011726 3300046675 Bacteria 6538
300 Ga0495657_0025039 3300046675 Bacteria 4240
301 Ga0495657_0028103 3300046675 Bacteria 3961
302 Ga0495599_0061217 3300046678 Bacteria 2352
303 Ga0495623_0029875 3300046679 Bacteria 3507
304 Ga0495623_0077318 3300046679 Bacteria 2064
305 Ga0495646_0013759 3300046680 Bacteria 5144
306 Ga0495613_0020255 3300046689 Bacteria 4959
307 Ga0495600_0003021 3300046809 Bacteria 9821
308 Ga0495600_0021970 3300046809 Bacteria 4093
309 Ga0495600_0092151 3300046809 Unclassified 1976
310 Ga0495581_0097873 3300047315 Bacteria 1704
311 Ga0495604_0011914 3300047317 Bacteria 6915
312 Ga0495674_0167794 3300047319 Unclassified 1833
313 Ga0495674_0279351 3300047319 Bacteria 1368
314 Ga0495680_0129158 3300047322 Bacteria 1858
315 Ga0495675_0080929 3300047444 Bacteria 2045
316 Ga0495675_0210253 3300047444 Bacteria 1181
317 Ga0495684_0050067 3300047471 Bacteria 3190
318 Ga0495684_0051561 3300047471 Bacteria 3140
319 Ga0495684_0133012 3300047471 Bacteria 1867
320 Ga0495602_0021272 3300048088 Bacteria 6391
321 Ga0495602_0038084 3300048088 Bacteria 4452
322 Ga0496102_0077505 3300048905 Bacteria 3059
323 Ga0496102_0145161 3300048905 Unclassified 2227
324 Ga0496102_0744082 3300048905 Bacteria 903
325 Ga0496115_0000487 3300048918 Bacteria 31378
326 Ga0496120_0045650 3300048923 Bacteria 2537
327 Ga0496124_0143333 3300048927 Bacteria 1883
328 Ga0496126_0000553 3300048929 Bacteria 72027
329 Ga0501032_0003792 3300049569 Bacteria 11471
330 Ga0501032_0160338 3300049569 Bacteria 1477
331 Ga0501034_0008148 3300049571 Bacteria 11109
332 Ga0501034_0015871 3300049571 Bacteria 7733
333 Ga0501034_0016406 3300049571 Bacteria 7603
334 Ga0501036_0003167 3300049572 Bacteria 13134
335 Ga0501036_0113947 3300049572 Unclassified 2285
336 Ga0501038_0041678 3300049574 Bacteria 4003
337 Ga0501038_0147471 3300049574 Bacteria 1920
338 Ga0501039_0003657 3300049575 Bacteria 11529
339 Ga0501039_0023116 3300049575 Unclassified 4769
340 Ga0501046_0008976 3300049580 Bacteria 8680
341 Ga0501047_0001879 3300049581 Bacteria 20219
342 Ga0501047_0005064 3300049581 Bacteria 12368
343 Ga0501068_0010684 3300049584 Bacteria 5164
344 Ga0501068_0026531 3300049584 Bacteria 3414
345 Ga0501070_0069786 3300049586 Unclassified 2910
346 Ga0501072_0135261 3300049588 Bacteria 1965
347 Ga0501073_0003281 3300049589 Bacteria 12149
348 Ga0501073_0004368 3300049589 Bacteria 10617
349 Ga0501076_0167589 3300049592 Bacteria 1790
350 Ga0501080_0000852 3300049742 Bacteria 24933
351 Ga0501080_0031679 3300049742 Unclassified 4927
352 Ga0501083_0060599 3300049744 Bacteria 2528
353 Ga0501035_0008428 3300049822 Bacteria 9599
354 Ga0501044_0007896 3300049823 Bacteria 11700
355 Ga0501044_0452000 3300049823 Bacteria 1191
356 nmdc:mga05p37_134030_c1 3300050507 Bacteria 3039
357 nmdc:mga05p37_158549_c1 3300050507 Bacteria 2764
358 nmdc:mga05p37_504781_c1 3300050507 Bacteria 1387
359 nmdc:mga0n895_220378_c1 3300050512 Bacteria 1926
360 nmdc:mga0rr50_12830_c1 3300050513 Bacteria 5431
361 nmdc:mga0rr50_165170_c2 3300050513 Bacteria 1337
362 nmdc:mga08x19_182528_c1 3300050514 Bacteria 1433
363 nmdc:mga08x19_87671_c1 3300050514 Bacteria 2051
364 nmdc:mga08x19_9760_c1 3300050514 Bacteria 5752
365 nmdc:mga0a205_102620_c1 3300050515 Bacteria 2759
366 nmdc:mga0a205_259575_c1 3300050515 Bacteria 1615
367 Ga0495601_0072614 3300053077 Bacteria 2198
368 Ga0495595_0024932 3300053084 Bacteria 2645
369 Ga0495619_0072866 3300053085 Bacteria 2301
370 Ga0500618_012986 3300053125 Unclassified 2167
371 Ga0500624_000340 3300053157 Bacteria 15646
372 Ga0500636_0001940 3300053177 Bacteria 11370
373 Ga0501082_0013725 3300060353 Bacteria 6963
374 Ga0501082_0027078 3300060353 Unclassified 4940
375 Ga0070699_100203501
376 LJNas_1000113
377 LJQas_1008214
378 Ga0070690_100016126
379 Ga0070666_10000590
380 Ga0070682_100562979
381 Ga0068868_100023018
382 Ga0070687_100107778
383 Ga0070688_100012527
384 Ga0070667_100015106
385 Ga0070709_10031176
386 Ga0070709_10066245
387 Ga0070714_100011197
388 Ga0070714_100024147
389 Ga0070713_100012487
390 Ga0070713_100033994
391 Ga0070711_100029969
392 Ga0070711_100112260
393 Ga0070711_100202176
394 Ga0070705_100365560
395 Ga0070708_100028930
396 Ga0070678_100586804
397 Ga0070681_10077737
398 Ga0070681_10326822
399 Ga0068867_100396439
400 Ga0070706_100327348
401 Ga0070707_100000123
402 Ga0070707_100134966
403 Ga0070698_100001677
404 Ga0070698_100078550
405 Ga0070698_100120786
406 Ga0070699_100216745
407 Ga0070679_100254881
408 Ga0070679_100312526
409 Ga0070697_100000015
410 Ga0070697_100119467
411 Ga0070697_100307370
412 Ga0068853_100216094
413 Ga0070693_100006929
414 Ga0070665_100332397
415 Ga0070665_100393488
416 Ga0070704_100193872
417 Ga0068855_100033361
418 Ga0068854_100012445
419 Ga0068854_100397238
420 Ga0068856_100085972
421 Ga0068856_100582454
422 Ga0068852_100005455
423 Ga0068852_100068134
424 Ga0068852_100130467
425 Ga0068859_100071704
426 Ga0068866_10028902
427 Ga0068861_100548648
428 Ga0068863_100010837
429 Ga0068858_100001314
430 Ga0068858_100407186
431 Ga0068860_100020264
432 Ga0068860_100124747
433 Ga0081540_1024050
434 Ga0070717_10001290
435 Ga0070717_10125760
436 Ga0070717_10225017
437 Ga0070717_10283683
438 Ga0070716_100011925
439 Ga0070716_100030535
440 Ga0070716_100119696
441 Ga0070712_100107258
442 Ga0097621_100000704
443 Ga0097621_100000808
444 Ga0097621_100517876
445 Ga0068871_100000910
446 Ga0068871_100001100
447 Ga0068871_100753073
448 Ga0075428_100387814
449 Ga0075428_100712220
450 Ga0075433_10068210
451 Ga0075433_10180063
452 Ga0075434_100054598
453 Ga0075436_100071767
454 Ga0075436_100097862
455 Ga0097620_100071704
456 Ga0075435_100001845
457 Ga0099794_10040461
458 Ga0099794_10059169
459 Ga0099794_10118792
460 Ga0105240_10012325
461 Ga0105240_10035551
462 Ga0105240_10058846
463 Ga0105240_10139119
464 Ga0105240_10147808
465 Ga0105240_10445442
466 Ga0111539_10266484
467 Ga0105245_10001876
468 Ga0105245_10003617
469 Ga0105247_10053502
470 Ga0114129_10223632
471 Ga0114129_10308250
472 Ga0105243_10025204
473 Ga0105241_10696539
474 Ga0105242_10005900
475 Ga0105248_10003207
476 Ga0105237_10200577
477 Ga0105238_10032955
478 Ga0105238_10096376
479 Ga0105238_10157972
480 Ga0105238_10479566
481 Ga0105249_10134216
482 Ga0099796_10011591
483 Ga0099796_10097301
484 Ga0105239_10001291
485 Ga0105239_10075200
486 Ga0105239_10231261
487 Ga0105239_10408862
488 Ga0157370_10003925
489 Ga0157370_10015091
490 Ga0157370_10091754
491 Ga0157369_10009435
492 Ga0157369_10019513
493 Ga0157369_10027211
494 Ga0157369_10060678
495 Ga0157374_10005045
496 Ga0157374_10042987
497 Ga0157374_10254951
498 Ga0157374_10877448
499 Ga0157378_10000031
500 Ga0157378_10000507
501 Ga0157378_10007538
502 Ga0157378_10033616
503 Ga0163162_10006564
504 Ga0163162_10082531
505 Ga0157372_10002223
506 Ga0157372_10006979
507 Ga0157372_10009563
508 Ga0157375_10002033
509 Ga0163163_10015301
510 Ga0163163_10065452
511 Ga0182008_10026341
512 Ga0157379_10645853
513 Ga0157376_10004228
514 Ga0157376_10009864
515 Ga0157376_10141069
516 Ga0157376_10231458
517 Ga0182006_1044216
518 Ga0213872_10035511
519 Ga0213875_10004728
520 Ga0213875_10142117
521 Ga0224572_1000586
522 Ga0207692_10022197
523 Ga0207692_10047293
524 Ga0207642_10077715
525 Ga0207680_10005790
526 Ga0207680_10010614
527 Ga0207699_10028971
528 Ga0207699_10045610
529 Ga0207684_10059358
530 Ga0207684_10257311
531 Ga0207707_10042503
532 Ga0207695_10001534
533 Ga0207695_10001696
534 Ga0207695_10058367
535 Ga0207695_10203831
536 Ga0207671_10282151
537 Ga0207671_10467306
538 Ga0207663_10111536
539 Ga0207663_10397874
540 Ga0207657_10005753
541 Ga0207657_10327293
542 Ga0207652_10327695
543 Ga0207646_10000042
544 Ga0207646_10476792
545 Ga0207694_10023537
546 Ga0207687_10003482
547 Ga0207687_10161652
548 Ga0207700_10227375
549 Ga0207700_10358589
550 Ga0207664_10010335
551 Ga0207664_10088944
552 Ga0207686_10247127
553 Ga0207709_10196289
554 Ga0207669_10255402
555 Ga0207665_10005192
556 Ga0207665_10115806
557 Ga0207711_10021010
558 Ga0207711_10122547
559 Ga0207689_10228343
560 Ga0207667_10003184
561 Ga0207651_10484077
562 Ga0207640_10042558
563 Ga0207658_10028428
564 Ga0207677_10030379
565 Ga0207703_10007624
566 Ga0207639_10260767
567 Ga0207639_10367408
568 Ga0207678_10332604
569 Ga0207702_10032340
570 Ga0207702_10189523
571 Ga0207702_10539924
572 Ga0207641_10019488
573 Ga0207648_10554937
574 Ga0207674_10057302
575 Ga0207698_10002588
576 Ga0207698_10006074
577 Ga0207698_10043961
578 Ga0209179_1009697
579 Ga0268266_10010615
580 Ga0268266_10435717
581 Ga0268264_10001104
582 Ga0265318_10067605
583 Ga0265338_10027940
584 Ga0265330_10005087
585 Ga0265332_10003409
586 Ga0265328_10018142
587 Ga0265325_10000399
588 Ga0265325_10000887
589 Ga0265329_10030216
590 Ga0265340_10002477
591 Ga0265340_10021151
592 Ga0265340_10064348
593 Ga0265339_10000891
594 Ga0265339_10028594
595 Ga0265339_10172129
596 Ga0265331_10000509
597 Ga0265331_10005860
598 Ga0265316_10047127
599 Ga0265316_10051473
600 Ga0265313_10001003
601 Ga0265313_10058346
602 Ga0265314_10000444
603 Ga0265314_10009468
604 Ga0265314_10051041
605 Ga0265342_10001670
606 Ga0265342_10013816
607 Ga0265342_10032834
608 Ga0307411_10199588
609 Ga0373926_0026548
610 Ga0373934_0111706
611 Ga0373923_0042958
612 Ga0373923_0049492
613 Ga0373923_0062615
614 Ga0373936_0011111
615 Ga0373945_0012705
616 Ga0373956_0032953
617 Ga0373957_0009711
618 Ga0373955_0015293
619 Ga0373955_0183464
620 Ga0373924_0006994
621 Ga0373924_0010255
622 Ga0373924_0067271
623 Ga0373935_0012869
624 Ga0373927_0101036
625 Ga0373933_0005733
626 Ga0373933_0029380
627 Ga0373937_0235195
628 Ga0373937_0347617
629 Ga0373925_0094987
630 Ga0373925_0137393
631 Ga0436364_0186621
632 Ga0436364_0387004
633 Ga0436364_0867073
634 Ga0436361_0285708
635 Ga0436363_0202593
636 Ga0436362_0604986
637 Ga0451577_0118246
638 Ga0453683_0370512
639 Ga0453684_0012555
640 Ga0453684_0088714
641 Ga0453684_0090312
642 Ga0451576_0223818
643 Ga0495592_0202353
644 Ga0495651_0035504
645 Ga0495651_0038282
646 Ga0495653_0010253
647 Ga0495653_0147149
648 Ga0495664_0004488
649 Ga0495664_0323049
650 Ga0495608_0017327
651 Ga0495608_0076645
652 Ga0495618_0028782
653 Ga0495618_0392873
654 Ga0495628_0229352
655 Ga0495630_0028058
656 Ga0495630_0191867
657 Ga0495637_0112786
658 Ga0495652_0115865
659 Ga0495652_0154492
660 Ga0495665_0164025
661 Ga0495640_0095998
662 Ga0495640_0109235
663 Ga0495587_0011838
664 Ga0495587_0015349
665 Ga0495587_0059154
666 Ga0495645_0023812
667 Ga0495667_0033461
668 Ga0495634_0015182
669 Ga0495634_0030457
670 Ga0495635_0091646
671 Ga0495635_0105273
672 Ga0495635_0241898
673 Ga0495657_0011726
674 Ga0495657_0025039
675 Ga0495657_0028103
676 Ga0495599_0061217
677 Ga0495623_0029875
678 Ga0495623_0077318
679 Ga0495646_0013759
680 Ga0495613_0020255
681 Ga0495600_0003021
682 Ga0495600_0021970
683 Ga0495600_0092151
684 Ga0495581_0097873
685 Ga0495604_0011914
686 Ga0495674_0167794
687 Ga0495674_0279351
688 Ga0495680_0129158
689 Ga0495675_0080929
690 Ga0495675_0210253
691 Ga0495684_0050067
692 Ga0495684_0051561
693 Ga0495684_0133012
694 Ga0495602_0021272
695 Ga0495602_0038084
696 Ga0496102_0077505
697 Ga0496102_0145161
698 Ga0496102_0744082
699 Ga0496115_0000487
700 Ga0496120_0045650
701 Ga0496124_0143333
702 Ga0496126_0000553
703 Ga0501032_0003792
704 Ga0501032_0160338
705 Ga0501034_0008148
706 Ga0501034_0015871
707 Ga0501034_0016406
708 Ga0501036_0003167
709 Ga0501036_0113947
710 Ga0501038_0041678
711 Ga0501038_0147471
712 Ga0501039_0003657
713 Ga0501039_0023116
714 Ga0501046_0008976
715 Ga0501047_0001879
716 Ga0501047_0005064
717 Ga0501068_0010684
718 Ga0501068_0026531
719 Ga0501070_0069786
720 Ga0501072_0135261
721 Ga0501073_0003281
722 Ga0501073_0004368
723 Ga0501076_0167589
724 Ga0501080_0000852
725 Ga0501080_0031679
726 Ga0501083_0060599
727 Ga0501035_0008428
728 Ga0501044_0007896
729 Ga0501044_0452000
730 nmdc:mga05p37_134030_c1
731 nmdc:mga05p37_158549_c1
732 nmdc:mga05p37_504781_c1
733 nmdc:mga0n895_220378_c1
734 nmdc:mga0rr50_12830_c1
735 nmdc:mga0rr50_165170_c2
736 nmdc:mga08x19_182528_c1
737 nmdc:mga08x19_87671_c1
738 nmdc:mga08x19_9760_c1
739 nmdc:mga0a205_102620_c1
740 nmdc:mga0a205_259575_c1
741 Ga0495601_0072614
742 Ga0495595_0024932
743 Ga0495619_0072866
744 Ga0500618_012986
745 Ga0500624_000340
746 Ga0500636_0001940
747 Ga0501082_0013725
748 Ga0501082_0027078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

63

225

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e26-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.7828 4 232
7pd5-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with 4-aminobenzoic acid 0.7787 4 232
7msk-assembly1.cif.gz_B thus glycosin s-glycosyltransferase 0.762 5 117
7pe4-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose 0.7595 4 232
7p8g-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 - apo form 0.7557 4 232
ID Description Score Start End Superfamily
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8676 7 223 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8666 7 223 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.844 7 223 3.90.550.10
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8353 5 233 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8341 1 241 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D1F6Q9-F1-model_v4 Glycosyl transferase family 2 0.9896 1 110 GO:0016757
AF-A0A3D1F6Q9-F1-model_v4 Glycosyl transferase family 2 0.972 1 110 GO:0016757
AF-A0A1V5YLC6-F1-model_v4 Undecaprenyl-phosphate mannosyltransferase (EC 2.4.1.54) 0.9665 5 245 GO:0047267
AF-A0A6N8JIB5-F1-model_v4 Glycosyltransferase 0.9655 1 244 GO:0016740
AF-A0A2J0KR74-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9643 5 244 GO:0005737
GO:0005975
GO:0016791

Map