F426618

General Info

Members Datasets Scaffolds Average Seq Length
374 217 748 99

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100694200|Ga0070711_1006942001
Length 115
Sequence MTGFSVDTLIPWYIGTMVPTPERLTIERVQTGVRMEKRLLKVLKAFADYHDLTLGDLLEGIVLHAFDGKCPFSQDSLRRIRELKKFYGLDLDASASHKLTEGNAAGGRPAKRKAK

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 5.35
Rhizosphere 88.5
Stem 0
Stem Tuber 0
Unclassified 38.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100694200 3300005439 Bacteria 856
2 MBSR1b_contig_2673538 2162886012 Unclassified 930
3 JGI25406J46586_10036198 3300003203 Bacteria 1794
4 Ga0065712_10324525 3300005290 Bacteria 823
5 Ga0065715_10121218 3300005293 Unclassified 2236
6 Ga0065715_10186174 3300005293 Bacteria 1378
7 Ga0070658_10210791 3300005327 Bacteria 1641
8 Ga0070683_100576814 3300005329 Unclassified 1076
9 Ga0070683_101043685 3300005329 Bacteria 785
10 Ga0070670_100846099 3300005331 Unclassified 828
11 Ga0068869_100126762 3300005334 Unclassified 1958
12 Ga0068869_100402805 3300005334 Bacteria 1126
13 Ga0068869_101034043 3300005334 Unclassified 716
14 Ga0070680_100019980 3300005336 Bacteria 5310
15 Ga0070680_100714680 3300005336 Unclassified 862
16 Ga0070682_100039464 3300005337 Bacteria 2901
17 Ga0068868_100087514 3300005338 Bacteria 2505
18 Ga0068868_100110788 3300005338 Bacteria 2230
19 Ga0070660_100095542 3300005339 Unclassified 2349
20 Ga0070661_100086817 3300005344 Unclassified 2313
21 Ga0070671_100032263 3300005355 Bacteria 4331
22 Ga0070673_100745842 3300005364 Unclassified 901
23 Ga0070709_10022512 3300005434 Bacteria 3688
24 Ga0070709_10237803 3300005434 Bacteria 1306
25 Ga0070709_10526574 3300005434 Bacteria 901
26 Ga0070714_100217477 3300005435 Bacteria 1754
27 Ga0070714_100312466 3300005435 Bacteria 1468
28 Ga0070714_100391816 3300005435 Bacteria 1311
29 Ga0070714_101712315 3300005435 Unclassified 614
30 Ga0070714_101783850 3300005435 Unclassified 601
31 Ga0070713_100213133 3300005436 Bacteria 1749
32 Ga0070713_100430147 3300005436 Bacteria 1237
33 Ga0070713_100848042 3300005436 Bacteria 877
34 Ga0070713_101931091 3300005436 Bacteria 573
35 Ga0070710_10364647 3300005437 Unclassified 960
36 Ga0070710_10656495 3300005437 Unclassified 736
37 Ga0070710_11182195 3300005437 Unclassified 565
38 Ga0070711_100004113 3300005439 Bacteria 8552
39 Ga0070711_100013110 3300005439 Bacteria 5198
40 Ga0070711_100399147 3300005439 Unclassified 1116
41 Ga0070711_100666015 3300005439 Unclassified 874
42 Ga0070705_101138022 3300005440 Bacteria 640
43 Ga0070694_100413239 3300005444 Bacteria 1059
44 Ga0070694_101443005 3300005444 Unclassified 581
45 Ga0070708_100000914 3300005445 Bacteria 22363
46 Ga0070663_100130452 3300005455 Bacteria 1908
47 Ga0070678_101428513 3300005456 Unclassified 646
48 Ga0070662_100246015 3300005457 Unclassified 1436
49 Ga0070662_101928526 3300005457 Unclassified 510
50 Ga0070662_101988136 3300005457 Unclassified 502
51 Ga0070681_10108614 3300005458 Bacteria 2714
52 Ga0070681_10108620 3300005458 Bacteria 2714
53 Ga0070681_11587170 3300005458 Unclassified 580
54 Ga0068867_102262489 3300005459 Unclassified 516
55 Ga0070706_100007857 3300005467 Bacteria 9969
56 Ga0070706_100961523 3300005467 Unclassified 788
57 Ga0070698_100008763 3300005471 Bacteria 10892
58 Ga0070698_100515328 3300005471 Unclassified 1134
59 Ga0070699_100684544 3300005518 Bacteria 937
60 Ga0070679_100082230 3300005530 Bacteria 3210
61 Ga0070679_101574564 3300005530 Unclassified 604
62 Ga0070684_100934542 3300005535 Unclassified 813
63 Ga0070697_100183651 3300005536 Unclassified 1773
64 Ga0070697_100280545 3300005536 Bacteria 1429
65 Ga0070697_100513591 3300005536 Bacteria 1048
66 Ga0068853_101466349 3300005539 Unclassified 660
67 Ga0068853_101884661 3300005539 Unclassified 580
68 Ga0070686_101258717 3300005544 Unclassified 616
69 Ga0070695_100088205 3300005545 Bacteria 2065
70 Ga0070695_100733757 3300005545 Bacteria 786
71 Ga0070696_100430916 3300005546 Unclassified 1037
72 Ga0070696_100836307 3300005546 Unclassified 760
73 Ga0070693_100202824 3300005547 Bacteria 1289
74 Ga0070665_102313050 3300005548 Unclassified 540
75 Ga0070704_100539962 3300005549 Unclassified 1017
76 Ga0068855_100726598 3300005563 Bacteria 1061
77 Ga0070664_100041836 3300005564 Bacteria 3867
78 Ga0070664_101458337 3300005564 Bacteria 647
79 Ga0070664_101545581 3300005564 Bacteria 628
80 Ga0068857_101811031 3300005577 Unclassified 598
81 Ga0068854_100028261 3300005578 Bacteria 3874
82 Ga0068854_101108273 3300005578 Unclassified 705
83 Ga0068856_100006136 3300005614 Bacteria 11796
84 Ga0068856_100461782 3300005614 Unclassified 1290
85 Ga0068856_100996048 3300005614 Unclassified 856
86 Ga0068859_101050579 3300005617 Unclassified 895
87 Ga0068864_100148528 3300005618 Unclassified 2121
88 Ga0068866_10085811 3300005718 Unclassified 1702
89 Ga0068861_100956400 3300005719 Unclassified 815
90 Ga0068851_10040982 3300005834 Unclassified 2328
91 Ga0068863_100946901 3300005841 Unclassified 862
92 Ga0068858_100158169 3300005842 Bacteria 2133
93 Ga0068860_100008070 3300005843 Bacteria 10492
94 Ga0068862_102105122 3300005844 Unclassified 575
95 Ga0081539_10005186 3300005985 Bacteria 13534
96 Ga0081539_10007554 3300005985 Bacteria 9843
97 Ga0070717_10006957 3300006028 Bacteria 8361
98 Ga0070717_10259897 3300006028 Bacteria 1536
99 Ga0070717_10407484 3300006028 Bacteria 1222
100 Ga0070717_10619862 3300006028 Bacteria 981
101 Ga0070717_11261971 3300006028 Unclassified 672
102 Ga0070715_10033992 3300006163 Bacteria 2087
103 Ga0070715_10462071 3300006163 Unclassified 719
104 Ga0070716_100000945 3300006173 Bacteria 12577
105 Ga0070716_100033701 3300006173 Bacteria 2803
106 Ga0070712_100003837 3300006175 Bacteria 9253
107 Ga0070712_100033437 3300006175 Bacteria 3480
108 Ga0070712_100163740 3300006175 Bacteria 1720
109 Ga0070712_100246556 3300006175 Unclassified 1425
110 Ga0075367_10052323 3300006178 Bacteria 2416
111 Ga0075367_10157850 3300006178 Bacteria 1410
112 Ga0075367_10196256 3300006178 Bacteria 1260
113 Ga0075366_10021416 3300006195 Bacteria 3757
114 Ga0075366_10082864 3300006195 Unclassified 1916
115 Ga0075370_10119698 3300006353 Bacteria 1532
116 Ga0068871_100006830 3300006358 Bacteria 8118
117 Ga0068871_100286084 3300006358 Unclassified 1443
118 Ga0068871_101235610 3300006358 Unclassified 701
119 Ga0068871_101639532 3300006358 Unclassified 609
120 Ga0075428_100308532 3300006844 Unclassified 1701
121 Ga0075431_100003442 3300006847 Bacteria 15353
122 Ga0075433_10000213 3300006852 Bacteria 32853
123 Ga0075433_10032207 3300006852 Bacteria 4489
124 Ga0075433_10164896 3300006852 Bacteria 1972
125 Ga0075434_100000122 3300006871 Bacteria 45781
126 Ga0075434_100007540 3300006871 Bacteria 10077
127 Ga0075434_100061864 3300006871 Bacteria 3725
128 Ga0075434_100336185 3300006871 Bacteria 1531
129 Ga0075434_100596990 3300006871 Bacteria 1123
130 Ga0068865_101219247 3300006881 Unclassified 666
131 Ga0075436_100036373 3300006914 Unclassified 3398
132 Ga0075436_100048612 3300006914 Bacteria 2927
133 Ga0075436_100748073 3300006914 Unclassified 726
134 Ga0097620_101050602 3300006931 Unclassified 895
135 Ga0075435_100000038 3300007076 Bacteria 67821
136 Ga0075435_100001122 3300007076 Bacteria 17057
137 Ga0075435_101093373 3300007076 Unclassified 697
138 Ga0099794_10717763 3300007265 Bacteria 533
139 Ga0105240_10337728 3300009093 Bacteria 1712
140 Ga0105240_12473831 3300009093 Unclassified 537
141 Ga0105245_10002796 3300009098 Bacteria 15694
142 Ga0105245_10119889 3300009098 Bacteria 2456
143 Ga0114129_10220796 3300009147 Bacteria 2557
144 Ga0114129_10300633 3300009147 Bacteria 2139
145 Ga0105241_10011165 3300009174 Bacteria 6586
146 Ga0105241_10203331 3300009174 Unclassified 1656
147 Ga0105242_10551799 3300009176 Bacteria 1105
148 Ga0105248_10079808 3300009177 Bacteria 3678
149 Ga0105248_11050841 3300009177 Unclassified 920
150 Ga0105237_10054290 3300009545 Bacteria 4015
151 Ga0105237_10532901 3300009545 Unclassified 1181
152 Ga0105237_11797681 3300009545 Unclassified 620
153 Ga0105238_10448115 3300009551 Bacteria 1288
154 Ga0105249_10528510 3300009553 Bacteria 1228
155 Ga0105239_10045731 3300010375 Bacteria 4797
156 Ga0105239_10744093 3300010375 Bacteria 1122
157 Ga0105239_11305491 3300010375 Unclassified 837
158 Ga0105246_10358459 3300011119 Bacteria 1197
159 Ga0105246_11293253 3300011119 Unclassified 675
160 Ga0157373_10004228 3300013100 Bacteria 10836
161 Ga0157373_10024768 3300013100 Unclassified 4344
162 Ga0157370_10069033 3300013104 Bacteria 3339
163 Ga0157370_10256193 3300013104 Unclassified 1618
164 Ga0157369_10011085 3300013105 Bacteria 10256
165 Ga0157369_10085490 3300013105 Bacteria 3370
166 Ga0157369_10887634 3300013105 Bacteria 914
167 Ga0157374_10013318 3300013296 Bacteria 7177
168 Ga0157374_10227654 3300013296 Bacteria 1831
169 Ga0157378_10000364 3300013297 Bacteria 44780
170 Ga0157378_10001529 3300013297 Bacteria 20915
171 Ga0157378_10406788 3300013297 Bacteria 1342
172 Ga0157378_10569100 3300013297 Unclassified 1141
173 Ga0163162_10125167 3300013306 Bacteria 2676
174 Ga0163162_10169763 3300013306 Bacteria 2306
175 Ga0163162_10425669 3300013306 Unclassified 1460
176 Ga0157372_10093403 3300013307 Bacteria 3424
177 Ga0157372_10362526 3300013307 Bacteria 1689
178 Ga0157372_11573682 3300013307 Bacteria 757
179 Ga0157372_12276453 3300013307 Unclassified 622
180 Ga0157375_11962741 3300013308 Unclassified 695
181 Ga0163163_10612796 3300014325 Unclassified 1152
182 Ga0182008_10037709 3300014497 Bacteria 2418
183 Ga0182008_10304246 3300014497 Unclassified 835
184 Ga0182008_10495344 3300014497 Unclassified 671
185 Ga0157377_10352908 3300014745 Bacteria 987
186 Ga0157379_10434955 3300014968 Unclassified 1209
187 Ga0157376_10024607 3300014969 Bacteria 4731
188 Ga0157376_10179663 3300014969 Bacteria 1933
189 Ga0182006_1025136 3300015261 Unclassified 2449
190 Ga0182007_10012391 3300015262 Unclassified 3280
191 Ga0182005_1028749 3300015265 Bacteria 1516
192 Ga0213872_10011977 3300021361 Unclassified 4092
193 Ga0213874_10004587 3300021377 Bacteria 3169
194 Ga0213876_10023173 3300021384 Bacteria 3280
195 Ga0213875_10054531 3300021388 Unclassified 1872
196 Ga0213875_10673681 3300021388 Unclassified 502
197 Ga0213871_10021661 3300021441 Bacteria 1604
198 Ga0207656_10072597 3300025321 Bacteria 1532
199 Ga0207692_10406731 3300025898 Unclassified 850
200 Ga0207692_10746805 3300025898 Bacteria 637
201 Ga0207680_10738154 3300025903 Unclassified 706
202 Ga0207685_10018739 3300025905 Bacteria 2266
203 Ga0207699_10000172 3300025906 Bacteria 39369
204 Ga0207699_10040002 3300025906 Bacteria 2698
205 Ga0207699_10128436 3300025906 Bacteria 1650
206 Ga0207705_11354319 3300025909 Unclassified 542
207 Ga0207684_10533755 3300025910 Unclassified 1004
208 Ga0207684_10654536 3300025910 Bacteria 895
209 Ga0207684_10968914 3300025910 Bacteria 713
210 Ga0207684_11013926 3300025910 Unclassified 694
211 Ga0207654_10129056 3300025911 Bacteria 1598
212 Ga0207654_10587111 3300025911 Unclassified 794
213 Ga0207707_10114157 3300025912 Bacteria 2361
214 Ga0207695_10566013 3300025913 Unclassified 1018
215 Ga0207671_10105283 3300025914 Bacteria 2140
216 Ga0207671_10174456 3300025914 Unclassified 1670
217 Ga0207693_10022174 3300025915 Bacteria 5048
218 Ga0207693_10037071 3300025915 Bacteria 3842
219 Ga0207693_10553588 3300025915 Unclassified 897
220 Ga0207663_10007112 3300025916 Bacteria 5781
221 Ga0207663_10016988 3300025916 Bacteria 4045
222 Ga0207652_10521968 3300025921 Unclassified 1068
223 Ga0207646_10013531 3300025922 Bacteria 7794
224 Ga0207681_10537415 3300025923 Bacteria 961
225 Ga0207650_10757744 3300025925 Unclassified 822
226 Ga0207650_11200987 3300025925 Bacteria 646
227 Ga0207687_10071735 3300025927 Bacteria 2475
228 Ga0207700_10027688 3300025928 Bacteria 3973
229 Ga0207700_10083276 3300025928 Bacteria 2504
230 Ga0207700_10709115 3300025928 Bacteria 898
231 Ga0207700_11517832 3300025928 Unclassified 594
232 Ga0207664_10408443 3300025929 Bacteria 1208
233 Ga0207664_10415798 3300025929 Bacteria 1197
234 Ga0207664_10684217 3300025929 Bacteria 922
235 Ga0207644_10338902 3300025931 Bacteria 1219
236 Ga0207690_10024143 3300025932 Bacteria 3804
237 Ga0207706_10029228 3300025933 Unclassified 4921
238 Ga0207706_11728691 3300025933 Unclassified 503
239 Ga0207686_11314740 3300025934 Unclassified 594
240 Ga0207665_10003932 3300025939 Bacteria 9949
241 Ga0207665_10127526 3300025939 Bacteria 1803
242 Ga0207711_10333573 3300025941 Unclassified 1403
243 Ga0207689_10238344 3300025942 Unclassified 1504
244 Ga0207689_10413001 3300025942 Bacteria 1126
245 Ga0207679_10026198 3300025945 Unclassified 4019
246 Ga0207667_10101077 3300025949 Bacteria 2974
247 Ga0207667_12194559 3300025949 Unclassified 509
248 Ga0207640_10089012 3300025981 Bacteria 2133
249 Ga0207640_11201460 3300025981 Unclassified 674
250 Ga0207658_10057104 3300025986 Bacteria 2899
251 Ga0207658_10208363 3300025986 Unclassified 1637
252 Ga0207677_10087954 3300026023 Bacteria 2251
253 Ga0207677_10274262 3300026023 Bacteria 1381
254 Ga0207677_11199418 3300026023 Unclassified 695
255 Ga0207677_11937530 3300026023 Unclassified 548
256 Ga0207703_10123361 3300026035 Bacteria 2227
257 Ga0207703_10140034 3300026035 Unclassified 2099
258 Ga0207702_10021102 3300026078 Bacteria 5390
259 Ga0207702_10089957 3300026078 Unclassified 2685
260 Ga0207702_10956055 3300026078 Bacteria 849
261 Ga0207702_11688339 3300026078 Unclassified 626
262 Ga0207648_11449307 3300026089 Unclassified 645
263 Ga0207676_10994674 3300026095 Bacteria 826
264 Ga0207674_11187057 3300026116 Bacteria 733
265 Ga0207683_11560589 3300026121 Unclassified 609
266 Ga0207698_11966211 3300026142 Unclassified 599
267 Ga0209588_1012853 3300027671 Bacteria 2547
268 Ga0207428_10000020 3300027907 Bacteria 276713
269 Ga0265356_1036447 3300028017 Unclassified 539
270 Ga0268266_11358355 3300028379 Unclassified 686
271 Ga0268264_10023404 3300028381 Bacteria 5041
272 Ga0265320_10135176 3300031240 Bacteria 1119
273 Ga0265342_10036806 3300031712 Bacteria 2988
274 Ga0373926_0127383 3300035083 Unclassified 963
275 Ga0373934_0272596 3300035086 Unclassified 700
276 Ga0373944_0306532 3300035089 Unclassified 597
277 Ga0373941_0469085 3300035115 Unclassified 531
278 Ga0373953_0208362 3300035117 Unclassified 846
279 Ga0373960_0163407 3300035121 Unclassified 768
280 Ga0373961_0077285 3300035241 Bacteria 1041
281 Ga0373961_0292977 3300035241 Bacteria 600
282 Ga0373931_0257470 3300035691 Bacteria 1063
283 Ga0373935_0200615 3300035692 Unclassified 1378
284 Ga0373927_0835955 3300035695 Bacteria 608
285 Ga0373947_0073777 3300035725 Bacteria 2098
286 Ga0373937_0168502 3300036401 Bacteria 2054
287 Ga0373937_1329396 3300036401 Unclassified 667
288 Ga0373925_0006326 3300037068 Bacteria 8723
289 Ga0373925_0216293 3300037068 Unclassified 1528
290 Ga0373925_1558966 3300037068 Unclassified 540
291 Ga0395905_1521567 3300037471 Unclassified 574
292 Ga0436364_0321322 3300037853 Bacteria 13844
293 Ga0436364_0992459 3300037853 Unclassified 2000
294 Ga0436364_1355818 3300037853 Bacteria 1010
295 Ga0395901_1618008 3300038443 Unclassified 601
296 Ga0436365_0490008 3300039437 Bacteria 3738
297 Ga0436365_1281898 3300039437 Bacteria 8855
298 Ga0436360_0847980 3300039438 Bacteria 888
299 Ga0436361_0235554 3300039447 Bacteria 7842
300 Ga0436363_0941782 3300039450 Bacteria 817
301 Ga0436363_1378056 3300039450 Bacteria 5401
302 Ga0436362_0145501 3300039453 Unclassified 926
303 Ga0436362_0161223 3300039453 Bacteria 843
304 Ga0436362_1122346 3300039453 Unclassified 597
305 Ga0439434_0251191 3300042435 Unclassified 605
306 Ga0439464_0144046 3300042439 Bacteria 743
307 Ga0453684_0217910 3300044712 Unclassified 2213
308 Ga0495592_0943808 3300046454 Unclassified 505
309 Ga0495603_0513105 3300046455 Bacteria 686
310 Ga0495651_0112081 3300046462 Unclassified 2016
311 Ga0495580_0005430 3300046472 Bacteria 10532
312 Ga0495580_0006152 3300046472 Bacteria 9811
313 Ga0495580_0017502 3300046472 Bacteria 5358
314 Ga0495580_0037783 3300046472 Bacteria 3462
315 Ga0495580_0317629 3300046472 Bacteria 1059
316 Ga0495580_0512575 3300046472 Unclassified 800
317 Ga0495664_0374499 3300046477 Unclassified 856
318 Ga0495594_0027035 3300046499 Bacteria 3091
319 Ga0495666_0237684 3300046526 Bacteria 832
320 Ga0495665_0343342 3300046531 Bacteria 761
321 Ga0495645_0003360 3300046543 Bacteria 10843
322 Ga0495669_0129896 3300046684 Bacteria 1185
323 Ga0495669_0340658 3300046684 Bacteria 724
324 Ga0495636_0138475 3300047318 Bacteria 1086
325 Ga0495674_0028816 3300047319 Bacteria 5059
326 Ga0496101_0471377 3300048904 Unclassified 991
327 Ga0496102_0028465 3300048905 Bacteria 4991
328 Ga0496102_0398308 3300048905 Unclassified 1294
329 Ga0496103_0567206 3300048906 Unclassified 724
330 Ga0496104_0326146 3300048907 Bacteria 1448
331 Ga0496105_0232671 3300048908 Bacteria 1497
332 Ga0496105_0919590 3300048908 Unclassified 658
333 Ga0496106_0025698 3300048909 Bacteria 4384
334 Ga0496106_0099593 3300048909 Bacteria 2253
335 Ga0496108_0063288 3300048911 Bacteria 3115
336 Ga0496108_0445869 3300048911 Bacteria 1131
337 Ga0496110_0089698 3300048913 Bacteria 2748
338 Ga0496111_0100901 3300048914 Bacteria 2120
339 Ga0496112_0032286 3300048915 Bacteria 5083
340 Ga0496112_0081038 3300048915 Bacteria 3209
341 Ga0496112_0185171 3300048915 Bacteria 2046
342 Ga0496114_0000007 3300048917 Bacteria 463098
343 Ga0496115_0436375 3300048918 Bacteria 1059
344 Ga0496115_0945002 3300048918 Unclassified 662
345 Ga0496115_1042746 3300048918 Unclassified 623
346 Ga0501074_0984703 3300049590 Bacteria 593
347 Ga0501076_0619336 3300049592 Bacteria 893
348 Ga0501081_0772197 3300049743 Unclassified 723
349 nmdc:mga0k408_59303_c1 3300050493 Bacteria 2223
350 nmdc:mga06z11_418325_c1 3300050494 Bacteria 808
351 nmdc:mga04h51_288990_c1 3300050495 Unclassified 665
352 nmdc:mga07m45_214230_c1 3300050496 Bacteria 1120
353 nmdc:mga07m45_462069_c1 3300050496 Bacteria 736
354 nmdc:mga05p37_2017_c1 3300050507 Bacteria 23693
355 nmdc:mga05p37_301851_c1 3300050507 Bacteria 1902
356 nmdc:mga05p37_695043_c1 3300050507 Bacteria 1131
357 nmdc:mga0qj67_35450_c1 3300050509 Bacteria 3901
358 nmdc:mga06r32_111925_c1 3300050510 Bacteria 2686
359 nmdc:mga06r32_89235_c1 3300050510 Bacteria 3010
360 nmdc:mga08y16_20_c1 3300050511 Bacteria 276739
361 nmdc:mga0n895_102_c1 3300050512 Bacteria 50003
362 nmdc:mga0n895_222290_c1 3300050512 Unclassified 1563
363 nmdc:mga0n895_413880_c1 3300050512 Unclassified 1363
364 nmdc:mga0n895_709_c1 3300050512 Bacteria 23417
365 nmdc:mga0rr50_1038434_c1 3300050513 Unclassified 698
366 nmdc:mga0rr50_110_c1 3300050513 Bacteria 20297
367 nmdc:mga0rr50_133573_c1 3300050513 Bacteria 1990
368 nmdc:mga08x19_2079_c1 3300050514 Bacteria 12247
369 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
370 nmdc:mga0a205_16662_c1 3300050515 Bacteria 6883
371 nmdc:mga0a205_4080_c1 3300050515 Bacteria 13060
372 Ga0495601_0002815 3300053077 Bacteria 9872
373 Ga0500645_007563 3300053730 Bacteria 3772
374 Ga0501084_1327084 3300054114 Bacteria 603
375 Ga0070711_100694200
376 MBSR1b_contig_2673538
377 JGI25406J46586_10036198
378 Ga0065712_10324525
379 Ga0065715_10121218
380 Ga0065715_10186174
381 Ga0070658_10210791
382 Ga0070683_100576814
383 Ga0070683_101043685
384 Ga0070670_100846099
385 Ga0068869_100126762
386 Ga0068869_100402805
387 Ga0068869_101034043
388 Ga0070680_100019980
389 Ga0070680_100714680
390 Ga0070682_100039464
391 Ga0068868_100087514
392 Ga0068868_100110788
393 Ga0070660_100095542
394 Ga0070661_100086817
395 Ga0070671_100032263
396 Ga0070673_100745842
397 Ga0070709_10022512
398 Ga0070709_10237803
399 Ga0070709_10526574
400 Ga0070714_100217477
401 Ga0070714_100312466
402 Ga0070714_100391816
403 Ga0070714_101712315
404 Ga0070714_101783850
405 Ga0070713_100213133
406 Ga0070713_100430147
407 Ga0070713_100848042
408 Ga0070713_101931091
409 Ga0070710_10364647
410 Ga0070710_10656495
411 Ga0070710_11182195
412 Ga0070711_100004113
413 Ga0070711_100013110
414 Ga0070711_100399147
415 Ga0070711_100666015
416 Ga0070705_101138022
417 Ga0070694_100413239
418 Ga0070694_101443005
419 Ga0070708_100000914
420 Ga0070663_100130452
421 Ga0070678_101428513
422 Ga0070662_100246015
423 Ga0070662_101928526
424 Ga0070662_101988136
425 Ga0070681_10108614
426 Ga0070681_10108620
427 Ga0070681_11587170
428 Ga0068867_102262489
429 Ga0070706_100007857
430 Ga0070706_100961523
431 Ga0070698_100008763
432 Ga0070698_100515328
433 Ga0070699_100684544
434 Ga0070679_100082230
435 Ga0070679_101574564
436 Ga0070684_100934542
437 Ga0070697_100183651
438 Ga0070697_100280545
439 Ga0070697_100513591
440 Ga0068853_101466349
441 Ga0068853_101884661
442 Ga0070686_101258717
443 Ga0070695_100088205
444 Ga0070695_100733757
445 Ga0070696_100430916
446 Ga0070696_100836307
447 Ga0070693_100202824
448 Ga0070665_102313050
449 Ga0070704_100539962
450 Ga0068855_100726598
451 Ga0070664_100041836
452 Ga0070664_101458337
453 Ga0070664_101545581
454 Ga0068857_101811031
455 Ga0068854_100028261
456 Ga0068854_101108273
457 Ga0068856_100006136
458 Ga0068856_100461782
459 Ga0068856_100996048
460 Ga0068859_101050579
461 Ga0068864_100148528
462 Ga0068866_10085811
463 Ga0068861_100956400
464 Ga0068851_10040982
465 Ga0068863_100946901
466 Ga0068858_100158169
467 Ga0068860_100008070
468 Ga0068862_102105122
469 Ga0081539_10005186
470 Ga0081539_10007554
471 Ga0070717_10006957
472 Ga0070717_10259897
473 Ga0070717_10407484
474 Ga0070717_10619862
475 Ga0070717_11261971
476 Ga0070715_10033992
477 Ga0070715_10462071
478 Ga0070716_100000945
479 Ga0070716_100033701
480 Ga0070712_100003837
481 Ga0070712_100033437
482 Ga0070712_100163740
483 Ga0070712_100246556
484 Ga0075367_10052323
485 Ga0075367_10157850
486 Ga0075367_10196256
487 Ga0075366_10021416
488 Ga0075366_10082864
489 Ga0075370_10119698
490 Ga0068871_100006830
491 Ga0068871_100286084
492 Ga0068871_101235610
493 Ga0068871_101639532
494 Ga0075428_100308532
495 Ga0075431_100003442
496 Ga0075433_10000213
497 Ga0075433_10032207
498 Ga0075433_10164896
499 Ga0075434_100000122
500 Ga0075434_100007540
501 Ga0075434_100061864
502 Ga0075434_100336185
503 Ga0075434_100596990
504 Ga0068865_101219247
505 Ga0075436_100036373
506 Ga0075436_100048612
507 Ga0075436_100748073
508 Ga0097620_101050602
509 Ga0075435_100000038
510 Ga0075435_100001122
511 Ga0075435_101093373
512 Ga0099794_10717763
513 Ga0105240_10337728
514 Ga0105240_12473831
515 Ga0105245_10002796
516 Ga0105245_10119889
517 Ga0114129_10220796
518 Ga0114129_10300633
519 Ga0105241_10011165
520 Ga0105241_10203331
521 Ga0105242_10551799
522 Ga0105248_10079808
523 Ga0105248_11050841
524 Ga0105237_10054290
525 Ga0105237_10532901
526 Ga0105237_11797681
527 Ga0105238_10448115
528 Ga0105249_10528510
529 Ga0105239_10045731
530 Ga0105239_10744093
531 Ga0105239_11305491
532 Ga0105246_10358459
533 Ga0105246_11293253
534 Ga0157373_10004228
535 Ga0157373_10024768
536 Ga0157370_10069033
537 Ga0157370_10256193
538 Ga0157369_10011085
539 Ga0157369_10085490
540 Ga0157369_10887634
541 Ga0157374_10013318
542 Ga0157374_10227654
543 Ga0157378_10000364
544 Ga0157378_10001529
545 Ga0157378_10406788
546 Ga0157378_10569100
547 Ga0163162_10125167
548 Ga0163162_10169763
549 Ga0163162_10425669
550 Ga0157372_10093403
551 Ga0157372_10362526
552 Ga0157372_11573682
553 Ga0157372_12276453
554 Ga0157375_11962741
555 Ga0163163_10612796
556 Ga0182008_10037709
557 Ga0182008_10304246
558 Ga0182008_10495344
559 Ga0157377_10352908
560 Ga0157379_10434955
561 Ga0157376_10024607
562 Ga0157376_10179663
563 Ga0182006_1025136
564 Ga0182007_10012391
565 Ga0182005_1028749
566 Ga0213872_10011977
567 Ga0213874_10004587
568 Ga0213876_10023173
569 Ga0213875_10054531
570 Ga0213875_10673681
571 Ga0213871_10021661
572 Ga0207656_10072597
573 Ga0207692_10406731
574 Ga0207692_10746805
575 Ga0207680_10738154
576 Ga0207685_10018739
577 Ga0207699_10000172
578 Ga0207699_10040002
579 Ga0207699_10128436
580 Ga0207705_11354319
581 Ga0207684_10533755
582 Ga0207684_10654536
583 Ga0207684_10968914
584 Ga0207684_11013926
585 Ga0207654_10129056
586 Ga0207654_10587111
587 Ga0207707_10114157
588 Ga0207695_10566013
589 Ga0207671_10105283
590 Ga0207671_10174456
591 Ga0207693_10022174
592 Ga0207693_10037071
593 Ga0207693_10553588
594 Ga0207663_10007112
595 Ga0207663_10016988
596 Ga0207652_10521968
597 Ga0207646_10013531
598 Ga0207681_10537415
599 Ga0207650_10757744
600 Ga0207650_11200987
601 Ga0207687_10071735
602 Ga0207700_10027688
603 Ga0207700_10083276
604 Ga0207700_10709115
605 Ga0207700_11517832
606 Ga0207664_10408443
607 Ga0207664_10415798
608 Ga0207664_10684217
609 Ga0207644_10338902
610 Ga0207690_10024143
611 Ga0207706_10029228
612 Ga0207706_11728691
613 Ga0207686_11314740
614 Ga0207665_10003932
615 Ga0207665_10127526
616 Ga0207711_10333573
617 Ga0207689_10238344
618 Ga0207689_10413001
619 Ga0207679_10026198
620 Ga0207667_10101077
621 Ga0207667_12194559
622 Ga0207640_10089012
623 Ga0207640_11201460
624 Ga0207658_10057104
625 Ga0207658_10208363
626 Ga0207677_10087954
627 Ga0207677_10274262
628 Ga0207677_11199418
629 Ga0207677_11937530
630 Ga0207703_10123361
631 Ga0207703_10140034
632 Ga0207702_10021102
633 Ga0207702_10089957
634 Ga0207702_10956055
635 Ga0207702_11688339
636 Ga0207648_11449307
637 Ga0207676_10994674
638 Ga0207674_11187057
639 Ga0207683_11560589
640 Ga0207698_11966211
641 Ga0209588_1012853
642 Ga0207428_10000020
643 Ga0265356_1036447
644 Ga0268266_11358355
645 Ga0268264_10023404
646 Ga0265320_10135176
647 Ga0265342_10036806
648 Ga0373926_0127383
649 Ga0373934_0272596
650 Ga0373944_0306532
651 Ga0373941_0469085
652 Ga0373953_0208362
653 Ga0373960_0163407
654 Ga0373961_0077285
655 Ga0373961_0292977
656 Ga0373931_0257470
657 Ga0373935_0200615
658 Ga0373927_0835955
659 Ga0373947_0073777
660 Ga0373937_0168502
661 Ga0373937_1329396
662 Ga0373925_0006326
663 Ga0373925_0216293
664 Ga0373925_1558966
665 Ga0395905_1521567
666 Ga0436364_0321322
667 Ga0436364_0992459
668 Ga0436364_1355818
669 Ga0395901_1618008
670 Ga0436365_0490008
671 Ga0436365_1281898
672 Ga0436360_0847980
673 Ga0436361_0235554
674 Ga0436363_0941782
675 Ga0436363_1378056
676 Ga0436362_0145501
677 Ga0436362_0161223
678 Ga0436362_1122346
679 Ga0439434_0251191
680 Ga0439464_0144046
681 Ga0453684_0217910
682 Ga0495592_0943808
683 Ga0495603_0513105
684 Ga0495651_0112081
685 Ga0495580_0005430
686 Ga0495580_0006152
687 Ga0495580_0017502
688 Ga0495580_0037783
689 Ga0495580_0317629
690 Ga0495580_0512575
691 Ga0495664_0374499
692 Ga0495594_0027035
693 Ga0495666_0237684
694 Ga0495665_0343342
695 Ga0495645_0003360
696 Ga0495669_0129896
697 Ga0495669_0340658
698 Ga0495636_0138475
699 Ga0495674_0028816
700 Ga0496101_0471377
701 Ga0496102_0028465
702 Ga0496102_0398308
703 Ga0496103_0567206
704 Ga0496104_0326146
705 Ga0496105_0232671
706 Ga0496105_0919590
707 Ga0496106_0025698
708 Ga0496106_0099593
709 Ga0496108_0063288
710 Ga0496108_0445869
711 Ga0496110_0089698
712 Ga0496111_0100901
713 Ga0496112_0032286
714 Ga0496112_0081038
715 Ga0496112_0185171
716 Ga0496114_0000007
717 Ga0496115_0436375
718 Ga0496115_0945002
719 Ga0496115_1042746
720 Ga0501074_0984703
721 Ga0501076_0619336
722 Ga0501081_0772197
723 nmdc:mga0k408_59303_c1
724 nmdc:mga06z11_418325_c1
725 nmdc:mga04h51_288990_c1
726 nmdc:mga07m45_214230_c1
727 nmdc:mga07m45_462069_c1
728 nmdc:mga05p37_2017_c1
729 nmdc:mga05p37_301851_c1
730 nmdc:mga05p37_695043_c1
731 nmdc:mga0qj67_35450_c1
732 nmdc:mga06r32_111925_c1
733 nmdc:mga06r32_89235_c1
734 nmdc:mga08y16_20_c1
735 nmdc:mga0n895_102_c1
736 nmdc:mga0n895_222290_c1
737 nmdc:mga0n895_413880_c1
738 nmdc:mga0n895_709_c1
739 nmdc:mga0rr50_1038434_c1
740 nmdc:mga0rr50_110_c1
741 nmdc:mga0rr50_133573_c1
742 nmdc:mga08x19_2079_c1
743 nmdc:mga0a205_131_c1
744 nmdc:mga0a205_16662_c1
745 nmdc:mga0a205_4080_c1
746 Ga0495601_0002815
747 Ga0500645_007563
748 Ga0501084_1327084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jxh-assembly1.cif.gz_A solution structure of dna binding domain of proline utilization a (puta) for psuedomonas putida 0.6867 24 52
2a1a-assembly1.cif.gz_A pkr kinase domain-eif2alpha complex 0.5465 14 73
1q46-assembly1.cif.gz_A crystal structure of the eif2 alpha subunit from saccharomyces cerevisia 0.5382 14 73
2jxh-assembly1.cif.gz_A solution structure of dna binding domain of proline utilization a (puta) for psuedomonas putida 0.4862 24 52
8aa9-assembly1.cif.gz_B crystal structure of the rpa1 arod-ob-1 domains 0.4823 25 76
ID Description Score Start End Superfamily
2jxiB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7225 21 52 1.10.1220.10
2jxhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7152 21 52 1.10.1220.10
af_I1LMU3_92_196_1.10.150.190 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Translation initiation factor 2; subunit 1; domain 2 0.6984 14 53 1.10.150.190
2jxiB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6651 21 52 1.10.1220.10
2jxhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6591 21 52 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A346SKQ1-F1-model_v4 XRE family transcriptional regulator 0.9494 21 83
AF-A0A7C1SE13-F1-model_v4 Uncharacterized protein 0.946 22 81
AF-A0A0F9C3F8-F1-model_v4 Uncharacterized protein 0.9457 21 81
AF-A0A7G6YGP4-F1-model_v4 Uncharacterized protein 0.9358 21 83
AF-A0A1M4EBU4-F1-model_v4 Uncharacterized protein 0.8935 19 85

Map