F426608

General Info

Members Datasets Scaffolds Average Seq Length
374 271 371 132

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100282016|Ga0070689_1002820163
Length 125
Sequence MDVDLPDVVTEVTAAFNRYEKALITNDVAVLDETFRVDAAFRAARSAIGLNRTTSKTVITTYGRQFAVASTLFHRATMPGKVGRQMQTWVKFPDGWHVVAAHVSVIDEKGCLEADMSSESLRGKT

Samples

Sample ID Description Type Environment
1 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
2 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
271 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 0
Rhizoplane 10.16
Rhizosphere 79.14
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002810 3300001976 Bacteria 2313
2 JGI24743J22301_10002164 3300001991 Bacteria 2907
3 JGI24750J21931_1039237 3300002070 Bacteria 715
4 JGI24738J21930_10055609 3300002075 Bacteria 809
5 JGI24744J21845_10004559 3300002077 Bacteria 2865
6 JGI24034J26672_10029006 3300002239 Bacteria 895
7 Ga0070676_10333600 3300005328 Bacteria 1038
8 Ga0070683_100054615 3300005329 Bacteria 3704
9 Ga0070690_100026046 3300005330 Bacteria 3605
10 Ga0070670_100458088 3300005331 Bacteria 1131
11 Ga0070682_101062063 3300005337 Bacteria 676
12 Ga0070660_100960499 3300005339 Bacteria 721
13 Ga0070689_100039729 3300005340 Bacteria 3604
14 Ga0070689_100282016 3300005340 Bacteria 1378
15 Ga0070687_100032468 3300005343 Bacteria 2569
16 Ga0070668_100009976 3300005347 Bacteria 7035
17 Ga0070669_100383566 3300005353 Bacteria 1146
18 Ga0070675_100004542 3300005354 Bacteria 10595
19 Ga0070671_100032273 3300005355 Bacteria 4331
20 Ga0070674_100003069 3300005356 Bacteria 9291
21 Ga0070674_100005764 3300005356 Bacteria 7187
22 Ga0070673_100148936 3300005364 Bacteria 1980
23 Ga0070673_100364818 3300005364 Bacteria 1285
24 Ga0070659_100036367 3300005366 Bacteria 3839
25 Ga0070667_100238868 3300005367 Bacteria 1622
26 Ga0070667_100549236 3300005367 Bacteria 1062
27 Ga0070703_10356143 3300005406 Bacteria 626
28 Ga0070714_100369603 3300005435 Bacteria 1350
29 Ga0070713_100010045 3300005436 Bacteria 6822
30 Ga0070713_100321636 3300005436 Bacteria 1429
31 Ga0070710_10271008 3300005437 Bacteria 1098
32 Ga0070701_10012870 3300005438 Bacteria 3788
33 Ga0070701_10509371 3300005438 Bacteria 783
34 Ga0070711_100160108 3300005439 Bacteria 1706
35 Ga0070700_100001397 3300005441 Bacteria 12002
36 Ga0070708_100839053 3300005445 Bacteria 863
37 Ga0070663_100002471 3300005455 Bacteria 10427
38 Ga0070662_100077133 3300005457 Bacteria 2472
39 Ga0068867_100009678 3300005459 Bacteria 6794
40 Ga0070685_10017670 3300005466 Bacteria 3821
41 Ga0070706_102132072 3300005467 Bacteria 506
42 Ga0070707_100502409 3300005468 Bacteria 1174
43 Ga0070698_100323306 3300005471 Bacteria 1473
44 Ga0070699_100317152 3300005518 Bacteria 1400
45 Ga0070679_101500804 3300005530 Bacteria 621
46 Ga0070684_100182029 3300005535 Bacteria 1911
47 Ga0070697_100384152 3300005536 Bacteria 1216
48 Ga0070686_100007362 3300005544 Bacteria 6136
49 Ga0070686_100886471 3300005544 Bacteria 725
50 Ga0070695_100109925 3300005545 Bacteria 1869
51 Ga0070693_100106817 3300005547 Bacteria 1715
52 Ga0070665_100030975 3300005548 Bacteria 5383
53 Ga0070704_101037982 3300005549 Bacteria 743
54 Ga0068855_100135242 3300005563 Bacteria 2813
55 Ga0070664_100007681 3300005564 Bacteria 8708
56 Ga0068854_100008399 3300005578 Bacteria 6636
57 Ga0068856_100244887 3300005614 Bacteria 1808
58 Ga0068859_100005143 3300005617 Bacteria 13279
59 Ga0068864_100010485 3300005618 Bacteria 7657
60 Ga0068861_100070807 3300005719 Bacteria 2701
61 Ga0068870_10001282 3300005840 Bacteria 10108
62 Ga0068863_100018185 3300005841 Bacteria 6730
63 Ga0068858_100009054 3300005842 Bacteria 9519
64 Ga0068860_100031453 3300005843 Bacteria 5102
65 Ga0068862_100711784 3300005844 Bacteria 973
66 Ga0081455_10050178 3300005937 Bacteria 3591
67 Ga0081455_10145317 3300005937 Bacteria 1836
68 Ga0070717_10233311 3300006028 Bacteria 1621
69 Ga0070717_10692601 3300006028 Bacteria 926
70 Ga0070717_10997700 3300006028 Bacteria 762
71 Ga0075365_10048809 3300006038 Bacteria 2787
72 Ga0075365_10053547 3300006038 Bacteria 2673
73 Ga0075365_10058312 3300006038 Bacteria 2570
74 Ga0075368_10002767 3300006042 Bacteria 5789
75 Ga0075363_100078620 3300006048 Bacteria 1801
76 Ga0075363_100526348 3300006048 Bacteria 704
77 Ga0075363_100600091 3300006048 Bacteria 660
78 Ga0075364_10036642 3300006051 Bacteria 3171
79 Ga0070715_10732038 3300006163 Bacteria 594
80 Ga0070716_100253304 3300006173 Unclassified 1201
81 Ga0070712_100074922 3300006175 Bacteria 2433
82 Ga0070712_100309328 3300006175 Bacteria 1281
83 Ga0075367_10256345 3300006178 Bacteria 1097
84 Ga0075369_10031667 3300006186 Bacteria 2234
85 Ga0075369_10255550 3300006186 Bacteria 814
86 Ga0068871_100021753 3300006358 Bacteria 4935
87 Ga0075428_100042533 3300006844 Bacteria 4996
88 Ga0075431_100092498 3300006847 Bacteria 3122
89 Ga0075433_10190294 3300006852 Bacteria 1825
90 Ga0075433_11641852 3300006852 Bacteria 554
91 Ga0075434_100061085 3300006871 Bacteria 3748
92 Ga0075429_100962259 3300006880 Bacteria 747
93 Ga0068865_100201715 3300006881 Bacteria 1544
94 Ga0075436_101089572 3300006914 Bacteria 601
95 Ga0097620_100005143 3300006931 Bacteria 13279
96 Ga0075435_101091632 3300007076 Bacteria 697
97 Ga0075435_101224574 3300007076 Bacteria 657
98 Ga0075435_101358252 3300007076 Bacteria 623
99 Ga0099794_10035182 3300007265 Bacteria 2363
100 Ga0099794_10097390 3300007265 Bacteria 1465
101 Ga0099795_10223053 3300007788 Bacteria 803
102 Ga0105240_11095037 3300009093 Bacteria 848
103 Ga0111539_10326974 3300009094 Bacteria 1785
104 Ga0105245_10004899 3300009098 Bacteria 11771
105 Ga0105245_11126956 3300009098 Bacteria 831
106 Ga0105247_11633864 3300009101 Bacteria 530
107 Ga0114129_10659219 3300009147 Bacteria 1350
108 Ga0114129_10674156 3300009147 Bacteria 1332
109 Ga0114129_11021581 3300009147 Bacteria 1040
110 Ga0105241_10647645 3300009174 Bacteria 959
111 Ga0105242_10202173 3300009176 Bacteria 1765
112 Ga0105248_10060325 3300009177 Bacteria 4258
113 Ga0105248_10224150 3300009177 Bacteria 2116
114 Ga0105237_12613460 3300009545 Bacteria 516
115 Ga0105249_10132794 3300009553 Bacteria 2378
116 Ga0105249_13166649 3300009553 Bacteria 529
117 Ga0105239_10411806 3300010375 Bacteria 1531
118 Ga0157374_10017965 3300013296 Bacteria 6235
119 Ga0157378_11441022 3300013297 Bacteria 732
120 Ga0157378_12836366 3300013297 Bacteria 537
121 Ga0163162_10388047 3300013306 Bacteria 1529
122 Ga0163162_10746308 3300013306 Bacteria 1098
123 Ga0157375_10022915 3300013308 Bacteria 5754
124 Ga0157375_10548327 3300013308 Bacteria 1318
125 Ga0157375_13039856 3300013308 Bacteria 560
126 Ga0163163_10014635 3300014325 Bacteria 7214
127 Ga0157380_10008635 3300014326 Bacteria 7282
128 Ga0157380_11133212 3300014326 Bacteria 823
129 Ga0157377_10005112 3300014745 Bacteria 6130
130 Ga0157379_10015494 3300014968 Bacteria 6691
131 Ga0157376_10005241 3300014969 Bacteria 9053
132 Ga0157376_11114523 3300014969 Bacteria 815
133 Ga0163161_10008900 3300017792 Bacteria 6942
134 Ga0207697_10228560 3300025315 Bacteria 821
135 Ga0207710_10004968 3300025900 Bacteria 5762
136 Ga0207688_10001018 3300025901 Bacteria 14321
137 Ga0207647_10014311 3300025904 Bacteria 5471
138 Ga0207699_10350604 3300025906 Bacteria 1042
139 Ga0207645_10049416 3300025907 Bacteria 2685
140 Ga0207643_10002115 3300025908 Bacteria 10934
141 Ga0207684_10003003 3300025910 Bacteria 16721
142 Ga0207695_10780904 3300025913 Bacteria 835
143 Ga0207693_10038734 3300025915 Bacteria 3753
144 Ga0207693_10229203 3300025915 Bacteria 1459
145 Ga0207663_10016439 3300025916 Bacteria 4103
146 Ga0207662_10002530 3300025918 Bacteria 9207
147 Ga0207657_10614902 3300025919 Bacteria 847
148 Ga0207646_11209540 3300025922 Bacteria 662
149 Ga0207650_10055032 3300025925 Bacteria 2952
150 Ga0207659_10072951 3300025926 Bacteria 2511
151 Ga0207687_10044730 3300025927 Bacteria 3057
152 Ga0207700_10151218 3300025928 Bacteria 1918
153 Ga0207700_10263010 3300025928 Bacteria 1478
154 Ga0207700_10344845 3300025928 Bacteria 1296
155 Ga0207664_10394122 3300025929 Bacteria 1231
156 Ga0207644_10042321 3300025931 Bacteria 3227
157 Ga0207690_10006019 3300025932 Bacteria 7188
158 Ga0207706_10007301 3300025933 Bacteria 10216
159 Ga0207686_10013146 3300025934 Bacteria 4573
160 Ga0207709_10067951 3300025935 Bacteria 2251
161 Ga0207670_10017786 3300025936 Bacteria 4305
162 Ga0207669_10040422 3300025937 Bacteria 2705
163 Ga0207669_10229931 3300025937 Bacteria 1367
164 Ga0207704_10013884 3300025938 Bacteria 4050
165 Ga0207665_10201375 3300025939 Bacteria 1451
166 Ga0207665_10403587 3300025939 Bacteria 1041
167 Ga0207691_10013884 3300025940 Bacteria 7686
168 Ga0207711_10017765 3300025941 Bacteria 5910
169 Ga0207661_10083026 3300025944 Bacteria 2650
170 Ga0207661_10961513 3300025944 Bacteria 787
171 Ga0207679_10041638 3300025945 Bacteria 3295
172 Ga0207651_10008222 3300025960 Bacteria 5622
173 Ga0207668_10234044 3300025972 Bacteria 1483
174 Ga0207668_10245337 3300025972 Bacteria 1451
175 Ga0207668_10844067 3300025972 Bacteria 813
176 Ga0207640_10009536 3300025981 Bacteria 5438
177 Ga0207658_10449932 3300025986 Bacteria 1140
178 Ga0207677_10023873 3300026023 Bacteria 3786
179 Ga0207703_10010409 3300026035 Bacteria 7276
180 Ga0207639_10752262 3300026041 Bacteria 906
181 Ga0207678_10014457 3300026067 Bacteria 6939
182 Ga0207708_10003151 3300026075 Bacteria 12142
183 Ga0207702_10128654 3300026078 Bacteria 2276
184 Ga0207641_10037259 3300026088 Bacteria 4060
185 Ga0207648_10015553 3300026089 Bacteria 6993
186 Ga0207676_10016641 3300026095 Bacteria 5326
187 Ga0207675_100007420 3300026118 Bacteria 10361
188 Ga0207675_100740233 3300026118 Bacteria 994
189 Ga0207683_10036492 3300026121 Bacteria 4281
190 Ga0207683_10120857 3300026121 Bacteria 2351
191 Ga0207683_10291852 3300026121 Bacteria 1491
192 Ga0207698_10004999 3300026142 Bacteria 8133
193 Ga0209588_1015562 3300027671 Bacteria 2340
194 Ga0209813_10018196 3300027866 Bacteria 1938
195 Ga0209813_10082370 3300027866 Bacteria 1066
196 Ga0268266_10136643 3300028379 Bacteria 2196
197 Ga0268266_12003300 3300028379 Bacteria 552
198 Ga0268264_10054601 3300028381 Bacteria 3336
199 Ga0265318_10006822 3300028577 Bacteria 5221
200 Ga0265338_10039517 3300028800 Bacteria 4448
201 Ga0265338_10340043 3300028800 Bacteria 1082
202 Ga0265325_10001622 3300031241 Bacteria 15674
203 Ga0265325_10066263 3300031241 Bacteria 1821
204 Ga0265340_10175410 3300031247 Bacteria 970
205 Ga0265339_10000900 3300031249 Bacteria 22829
206 Ga0265331_10083473 3300031250 Bacteria 1481
207 Ga0265313_10000171 3300031595 Bacteria 68612
208 Ga0265313_10121288 3300031595 Bacteria 1140
209 Ga0316579_10014265 3300031691 Bacteria 3432
210 Ga0265314_10152503 3300031711 Bacteria 1415
211 Ga0265342_10163799 3300031712 Bacteria 1228
212 Ga0265342_10321250 3300031712 Bacteria 811
213 Ga0307412_11150199 3300031911 Bacteria 693
214 Ga0373934_0059779 3300035086 Bacteria 1517
215 Ga0373944_0303894 3300035089 Bacteria 599
216 Ga0373923_0000573 3300035111 Bacteria 9075
217 Ga0373923_0373353 3300035111 Bacteria 683
218 Ga0373936_0000350 3300035113 Bacteria 15643
219 Ga0373945_0002515 3300035116 Bacteria 5730
220 Ga0373953_0000112 3300035117 Bacteria 19685
221 Ga0373953_0251908 3300035117 Bacteria 767
222 Ga0373954_0004744 3300035118 Bacteria 5860
223 Ga0373954_0271840 3300035118 Bacteria 835
224 Ga0373956_0100344 3300035119 Bacteria 1342
225 Ga0373943_0029253 3300035170 Bacteria 2602
226 Ga0373955_0003357 3300035172 Bacteria 7034
227 Ga0373955_0004039 3300035172 Bacteria 6477
228 Ga0373955_0817954 3300035172 Bacteria 573
229 Ga0316574_0983830 3300035398 Bacteria 508
230 Ga0373924_0103835 3300035410 Bacteria 1224
231 Ga0373935_0001098 3300035692 Bacteria 14767
232 Ga0373927_0009022 3300035695 Bacteria 6697
233 Ga0373927_0091404 3300035695 Bacteria 1976
234 Ga0373927_0121667 3300035695 Bacteria 1703
235 Ga0373933_0001117 3300035724 Bacteria 15975
236 Ga0373937_0000003 3300036401 Bacteria 235408
237 Ga0373937_0005720 3300036401 Bacteria 10677
238 Ga0316584_0961635 3300036712 Bacteria 572
239 Ga0373925_0000052 3300037068 Bacteria 127490
240 Ga0373925_0370585 3300037068 Bacteria 1165
241 Ga0373925_1484591 3300037068 Bacteria 555
242 Ga0436364_0458577 3300037853 Bacteria 2013
243 Ga0436365_0567267 3300039437 Bacteria 678
244 Ga0436361_0470171 3300039447 Bacteria 799
245 Ga0436363_1575571 3300039450 Bacteria 530
246 Ga0451847_0752386 3300041503 Bacteria 563
247 Ga0495627_199660 3300046453 Bacteria 551
248 Ga0495592_0000051 3300046454 Bacteria 111216
249 Ga0495592_0223884 3300046454 Bacteria 1256
250 Ga0495629_0017344 3300046459 Bacteria 5161
251 Ga0495629_0310044 3300046459 Bacteria 1080
252 Ga0495653_0000039 3300046463 Bacteria 119840
253 Ga0495662_0001044 3300046476 Bacteria 13601
254 Ga0495664_0000015 3300046477 Bacteria 192569
255 Ga0495664_0558792 3300046477 Bacteria 682
256 Ga0495608_0000025 3300046511 Bacteria 158132
257 Ga0495618_0000022 3300046514 Bacteria 127582
258 Ga0495620_0223330 3300046515 Bacteria 721
259 Ga0495628_0000011 3300046516 Bacteria 225267
260 Ga0495628_0360264 3300046516 Bacteria 1068
261 Ga0495630_0000372 3300046517 Bacteria 35516
262 Ga0495630_0463698 3300046517 Bacteria 971
263 Ga0495652_0000014 3300046529 Bacteria 225484
264 Ga0495665_0104757 3300046531 Bacteria 1484
265 Ga0495640_0000008 3300046533 Bacteria 220320
266 Ga0495586_0086584 3300046535 Bacteria 1727
267 Ga0495587_0000015 3300046536 Bacteria 187415
268 Ga0495645_0000020 3300046543 Bacteria 143867
269 Ga0495667_0000013 3300046559 Bacteria 220294
270 Ga0495667_0747528 3300046559 Bacteria 605
271 Ga0495634_0108313 3300046642 Bacteria 1789
272 Ga0495635_0000012 3300046663 Bacteria 225271
273 Ga0495657_0000048 3300046675 Bacteria 104278
274 Ga0495599_0000008 3300046678 Bacteria 225534
275 Ga0495623_0000002 3300046679 Bacteria 166669
276 Ga0495646_0000004 3300046680 Bacteria 268993
277 Ga0495658_0096715 3300046683 Bacteria 1757
278 Ga0495613_0011168 3300046689 Bacteria 6668
279 Ga0495624_0006290 3300046690 Bacteria 8446
280 Ga0495600_0000024 3300046809 Bacteria 92414
281 Ga0495604_0000001 3300047317 Bacteria 708627
282 Ga0495674_0000023 3300047319 Bacteria 157443
283 Ga0495676_0167860 3300047321 Bacteria 1547
284 Ga0495680_0000233 3300047322 Bacteria 60821
285 Ga0495680_0775806 3300047322 Bacteria 628
286 Ga0495675_0000392 3300047444 Bacteria 30250
287 Ga0495677_0380001 3300047445 Bacteria 558
288 Ga0495684_0000007 3300047471 Bacteria 225614
289 Ga0495593_0000722 3300047673 Bacteria 19167
290 Ga0495602_0000045 3300048088 Bacteria 118132
291 Ga0495602_0307953 3300048088 Bacteria 1157
292 Ga0496100_0044838 3300048903 Bacteria 2834
293 Ga0496100_1307258 3300048903 Bacteria 572
294 Ga0496101_0015330 3300048904 Bacteria 5163
295 Ga0496101_0177834 3300048904 Bacteria 1637
296 Ga0496102_0037269 3300048905 Bacteria 4385
297 Ga0496103_0002159 3300048906 Bacteria 12504
298 Ga0496103_0246340 3300048906 Bacteria 1150
299 Ga0496103_0867725 3300048906 Unclassified 567
300 Ga0496104_0047775 3300048907 Bacteria 4034
301 Ga0496104_0194824 3300048907 Bacteria 1938
302 Ga0496104_0565811 3300048907 Bacteria 1047
303 Ga0496105_0011645 3300048908 Bacteria 6959
304 Ga0496105_0808176 3300048908 Bacteria 712
305 Ga0496106_0007107 3300048909 Bacteria 8273
306 Ga0496107_0002626 3300048910 Bacteria 11751
307 Ga0496107_0300811 3300048910 Bacteria 1194
308 Ga0496108_0002206 3300048911 Bacteria 15586
309 Ga0496108_0252939 3300048911 Bacteria 1533
310 Ga0496109_0029403 3300048912 Bacteria 4920
311 Ga0496109_0089112 3300048912 Bacteria 2852
312 Ga0496109_0545221 3300048912 Bacteria 1094
313 Ga0496110_0003778 3300048913 Bacteria 11663
314 Ga0496110_0016700 3300048913 Bacteria 6130
315 Ga0496110_0806909 3300048913 Bacteria 843
316 Ga0496110_0943426 3300048913 Bacteria 769
317 Ga0496110_1382348 3300048913 Bacteria 613
318 Ga0496111_0004532 3300048914 Bacteria 8792
319 Ga0496111_0015891 3300048914 Bacteria 5176
320 Ga0496111_0903237 3300048914 Bacteria 636
321 Ga0496112_0008306 3300048915 Bacteria 9290
322 Ga0496112_0371852 3300048915 Bacteria 1371
323 Ga0496112_0625488 3300048915 Bacteria 1007
324 Ga0496112_1385088 3300048915 Bacteria 618
325 Ga0496113_0016274 3300048916 Bacteria 5133
326 Ga0496114_0029135 3300048917 Bacteria 4535
327 Ga0496114_0030922 3300048917 Bacteria 4404
328 Ga0496115_0058952 3300048918 Bacteria 3090
329 Ga0496115_1357419 3300048918 Unclassified 527
330 Ga0496121_0024228 3300048924 Bacteria 5813
331 Ga0496126_0018610 3300048929 Bacteria 6876
332 Ga0501038_0930033 3300049574 Bacteria 641
333 Ga0501081_1100892 3300049743 Bacteria 601
334 Ga0501045_1075087 3300049824 Bacteria 589
335 nmdc:mga03n38_44574_c1 3300050490 Bacteria 1949
336 nmdc:mga03n38_9755_c1 3300050490 Bacteria 3503
337 nmdc:mga0yw44_127487_c1 3300050492 Bacteria 1645
338 nmdc:mga0yw44_17858_c1 3300050492 Bacteria 3871
339 nmdc:mga0yw44_437499_c1 3300050492 Bacteria 886
340 nmdc:mga0k408_174260_c1 3300050493 Bacteria 1282
341 nmdc:mga06z11_216799_c1 3300050494 Bacteria 1117
342 nmdc:mga06z11_703740_c1 3300050494 Bacteria 615
343 nmdc:mga06z11_7888_c1 3300050494 Bacteria 4408
344 nmdc:mga04h51_121443_c1 3300050495 Bacteria 973
345 nmdc:mga05p37_205925_c1 3300050507 Bacteria 2380
346 nmdc:mga05p37_573253_c1 3300050507 Bacteria 1280
347 nmdc:mga06r32_118462_c1 3300050510 Bacteria 2610
348 nmdc:mga06r32_1493522_c1 3300050510 Bacteria 616
349 nmdc:mga06r32_699634_c1 3300050510 Bacteria 979
350 nmdc:mga06r32_711154_c1 3300050510 Bacteria 970
351 nmdc:mga08y16_120972_c2 3300050511 Bacteria 1724
352 nmdc:mga0n895_160471_c1 3300050512 Bacteria 2280
353 nmdc:mga08x19_419033_c1 3300050514 Bacteria 940
354 nmdc:mga08x19_657456_c1 3300050514 Bacteria 743
355 nmdc:mga0a205_1013291_c1 3300050515 Bacteria 677
356 nmdc:mga0sz30_180513_c1 3300050516 Bacteria 937
357 nmdc:mga0sz30_274123_c1 3300050516 Bacteria 751
358 nmdc:mga0sz30_364397_c1 3300050516 Bacteria 646
359 Ga0495601_0000014 3300053077 Bacteria 220318
360 Ga0495612_0000014 3300053078 Bacteria 187444
361 Ga0495595_0000038 3300053084 Bacteria 70955
362 Ga0495595_0034864 3300053084 Bacteria 2278
363 Ga0495619_0000006 3300053085 Bacteria 384835
364 Ga0495619_0053250 3300053085 Bacteria 2676
365 Ga0495619_0137376 3300053085 Bacteria 1682
366 Ga0500643_004518 3300053087 Bacteria 6255
367 Ga0500641_0006250 3300053096 Bacteria 4226
368 Ga0500555_067476 3300053103 Bacteria 950
369 Ga0500595_000002 3300053119 Bacteria 1074388
370 Ga0500642_0038911 3300053130 Bacteria 2042
371 Ga0500639_194861 3300053163 Bacteria 878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10333600 Ga0070676_103336002 112
2 3300005356 Ga0070674_100003069 Ga0070674_1000030693 112
3 3300005364 Ga0070673_100364818 Ga0070673_1003648182 112
4 3300009098 Ga0105245_11126956 Ga0105245_111269562 112
5 3300009553 Ga0105249_13166649 Ga0105249_131666491 112
6 3300025937 Ga0207669_10229931 Ga0207669_102299312 112
7 3300005340 Ga0070689_100282016 Ga0070689_1002820163 115
8 3300005367 Ga0070667_100238868 Ga0070667_1002388684 115
9 3300005438 Ga0070701_10509371 Ga0070701_105093712 115
10 3300005544 Ga0070686_100886471 Ga0070686_1008864711 115
11 3300009101 Ga0105247_11633864 Ga0105247_116338641 115
12 3300013297 Ga0157378_11441022 Ga0157378_114410222 115
13 3300013306 Ga0163162_10388047 Ga0163162_103880472 115
14 3300013308 Ga0157375_10548327 Ga0157375_105483272 115
15 3300025972 Ga0207668_10234044 Ga0207668_102340442 115
16 3300026118 Ga0207675_100740233 Ga0207675_1007402331 115
17 3300026121 Ga0207683_10120857 Ga0207683_101208572 115
18 iso_pu_bacteria 2919450847 2919453891 124
19 iso_pu_bacteria 8001845381 8001848993 124
20 3300009177 Ga0105248_10224150 Ga0105248_102241502 125
21 3300025315 Ga0207697_10228560 Ga0207697_102285602 125
22 3300013308 Ga0157375_13039856 Ga0157375_130398561 126
23 3300007265 Ga0099794_10097390 Ga0099794_100973902 127
24 3300007788 Ga0099795_10223053 Ga0099795_102230532 127
25 3300028800 Ga0265338_10039517 Ga0265338_100395172 127
26 3300031241 Ga0265325_10001622 Ga0265325_1000162214 127
27 3300031249 Ga0265339_10000900 Ga0265339_1000090023 127
28 3300031595 Ga0265313_10000171 Ga0265313_1000017123 127
29 3300031712 Ga0265342_10321250 Ga0265342_103212502 127
30 3300035172 Ga0373955_0817954 Ga0373955_0817954_81_464 127
31 3300035695 Ga0373927_0091404 Ga0373927_0091404_1346_1729 127
32 3300035695 Ga0373927_0121667 Ga0373927_0121667_216_599 127
33 3300037068 Ga0373925_0370585 Ga0373925_0370585_682_1065 127
34 3300046477 Ga0495664_0558792 Ga0495664_0558792_92_475 127
35 3300046517 Ga0495630_0463698 Ga0495630_0463698_209_592 127
36 3300046642 Ga0495634_0108313 Ga0495634_0108313_730_1113 127
37 3300047321 Ga0495676_0167860 Ga0495676_0167860_62_445 127
38 3300048903 Ga0496100_1307258 Ga0496100_1307258_12_395 127
39 3300048907 Ga0496104_0194824 Ga0496104_0194824_176_559 127
40 3300048908 Ga0496105_0808176 Ga0496105_0808176_121_504 127
41 3300048913 Ga0496110_0806909 Ga0496110_0806909_375_758 127
42 3300048914 Ga0496111_0903237 Ga0496111_0903237_151_534 127
43 3300050494 nmdc:mga06z11_703740_c1 nmdc:mga06z11_703740_c1_139_522 127
44 3300053085 Ga0495619_0137376 Ga0495619_0137376_755_1138 127
45 3300053103 Ga0500555_067476 Ga0500555_067476_439_822 127
46 3300006028 Ga0070717_10692601 Ga0070717_106926012 128
47 3300006038 Ga0075365_10048809 Ga0075365_100488092 128
48 3300006042 Ga0075368_10002767 Ga0075368_100027672 128
49 3300006048 Ga0075363_100078620 Ga0075363_1000786202 128
50 3300006051 Ga0075364_10036642 Ga0075364_100366422 128
51 3300006186 Ga0075369_10031667 Ga0075369_100316672 128
52 3300006186 Ga0075369_10255550 Ga0075369_102555502 128
53 3300006871 Ga0075434_100061085 Ga0075434_1000610854 128
54 3300006880 Ga0075429_100962259 Ga0075429_1009622592 128
55 3300007076 Ga0075435_101358252 Ga0075435_1013582521 128
56 3300025906 Ga0207699_10350604 Ga0207699_103506042 128
57 3300025928 Ga0207700_10263010 Ga0207700_102630101 128
58 3300027866 Ga0209813_10018196 Ga0209813_100181962 128
59 3300028577 Ga0265318_10006822 Ga0265318_100068224 128
60 3300031247 Ga0265340_10175410 Ga0265340_101754102 128
61 3300031250 Ga0265331_10083473 Ga0265331_100834732 128
62 3300031711 Ga0265314_10152503 Ga0265314_101525032 128
63 3300031712 Ga0265342_10163799 Ga0265342_101637992 128
64 3300035086 Ga0373934_0059779 Ga0373934_0059779_160_546 128
65 3300035117 Ga0373953_0251908 Ga0373953_0251908_89_475 128
66 3300035118 Ga0373954_0271840 Ga0373954_0271840_208_594 128
67 3300035119 Ga0373956_0100344 Ga0373956_0100344_468_854 128
68 3300035172 Ga0373955_0003357 Ga0373955_0003357_3398_3784 128
69 3300035410 Ga0373924_0103835 Ga0373924_0103835_319_705 128
70 3300036401 Ga0373937_0005720 Ga0373937_0005720_277_663 128
71 3300037068 Ga0373925_1484591 Ga0373925_1484591_35_421 128
72 3300039450 Ga0436363_1575571 Ga0436363_1575571_55_441 128
73 3300046454 Ga0495592_0223884 Ga0495592_0223884_140_526 128
74 3300046516 Ga0495628_0360264 Ga0495628_0360264_232_618 128
75 3300046683 Ga0495658_0096715 Ga0495658_0096715_991_1377 128
76 3300047322 Ga0495680_0775806 Ga0495680_0775806_116_502 128
77 3300049824 Ga0501045_1075087 Ga0501045_1075087_145_531 128
78 3300050490 nmdc:mga03n38_44574_c1 nmdc:mga03n38_44574_c1_1454_1840 128
79 3300050492 nmdc:mga0yw44_127487_c1 nmdc:mga0yw44_127487_c1_459_845 128
80 3300050494 nmdc:mga06z11_7888_c1 nmdc:mga06z11_7888_c1_3222_3608 128
81 3300050512 nmdc:mga0n895_160471_c1 nmdc:mga0n895_160471_c1_431_817 128
82 3300050514 nmdc:mga08x19_657456_c1 nmdc:mga08x19_657456_c1_88_474 128
83 3300050516 nmdc:mga0sz30_180513_c1 nmdc:mga0sz30_180513_c1_512_898 128
84 3300053087 Ga0500643_004518 Ga0500643_004518_781_1167 128
85 3300053096 Ga0500641_0006250 Ga0500641_0006250_906_1292 128
86 3300053119 Ga0500595_000002 Ga0500595_000002_727736_728122 128
87 3300053130 Ga0500642_0038911 Ga0500642_0038911_1095_1481 128
88 3300005530 Ga0070679_101500804 Ga0070679_1015008042 129
89 3300006844 Ga0075428_100042533 Ga0075428_1000425332 129
90 3300014326 Ga0157380_11133212 Ga0157380_111332122 129
91 3300014969 Ga0157376_11114523 Ga0157376_111145232 129
92 3300025972 Ga0207668_10844067 Ga0207668_108440672 129
93 3300039437 Ga0436365_0567267 Ga0436365_0567267_142_531 129
94 3300046459 Ga0495629_0310044 Ga0495629_0310044_404_793 129
95 3300046559 Ga0495667_0747528 Ga0495667_0747528_126_515 129
96 3300048088 Ga0495602_0307953 Ga0495602_0307953_711_1100 129
97 3300048904 Ga0496101_0177834 Ga0496101_0177834_213_602 129
98 3300048906 Ga0496103_0246340 Ga0496103_0246340_564_956 129
99 3300048907 Ga0496104_0565811 Ga0496104_0565811_174_563 129
100 3300048910 Ga0496107_0300811 Ga0496107_0300811_601_990 129
101 3300048911 Ga0496108_0252939 Ga0496108_0252939_570_959 129
102 3300048912 Ga0496109_0089112 Ga0496109_0089112_331_723 129
103 3300048917 Ga0496114_0029135 Ga0496114_0029135_2543_2932 129
104 3300048918 Ga0496115_1357419 Ga0496115_1357419_76_465 129
105 3300049574 Ga0501038_0930033 Ga0501038_0930033_219_608 129
106 3300050507 nmdc:mga05p37_573253_c1 nmdc:mga05p37_573253_c1_694_1083 129
107 3300050510 nmdc:mga06r32_1493522_c1 nmdc:mga06r32_1493522_c1_59_448 129
108 3300050510 nmdc:mga06r32_699634_c1 nmdc:mga06r32_699634_c1_73_462 129
109 3300050510 nmdc:mga06r32_711154_c1 nmdc:mga06r32_711154_c1_406_795 129
110 3300053084 Ga0495595_0034864 Ga0495595_0034864_1879_2268 129
111 3300053085 Ga0495619_0053250 Ga0495619_0053250_60_449 129
112 iso_pu_bacteria 2828305725 2828309565 129
113 3300005337 Ga0070682_101062063 Ga0070682_1010620631 130
114 3300005406 Ga0070703_10356143 Ga0070703_103561431 130
115 3300005435 Ga0070714_100369603 Ga0070714_1003696031 130
116 3300005436 Ga0070713_100010045 Ga0070713_1000100451 130
117 3300005437 Ga0070710_10271008 Ga0070710_102710081 130
118 3300005445 Ga0070708_100839053 Ga0070708_1008390532 130
119 3300005467 Ga0070706_102132072 Ga0070706_1021320721 130
120 3300005468 Ga0070707_100502409 Ga0070707_1005024092 130
121 3300005471 Ga0070698_100323306 Ga0070698_1003233061 130
122 3300005518 Ga0070699_100317152 Ga0070699_1003171523 130
123 3300005536 Ga0070697_100384152 Ga0070697_1003841522 130
124 3300005549 Ga0070704_101037982 Ga0070704_1010379821 130
125 3300005937 Ga0081455_10145317 Ga0081455_101453172 130
126 3300006028 Ga0070717_10997700 Ga0070717_109977002 130
127 3300006163 Ga0070715_10732038 Ga0070715_107320381 130
128 3300006173 Ga0070716_100253304 Ga0070716_1002533042 130
129 3300006175 Ga0070712_100309328 Ga0070712_1003093283 130
130 3300006847 Ga0075431_100092498 Ga0075431_1000924983 130
131 3300006852 Ga0075433_10190294 Ga0075433_101902944 130
132 3300006914 Ga0075436_101089572 Ga0075436_1010895722 130
133 3300007076 Ga0075435_101091632 Ga0075435_1010916322 130
134 3300007265 Ga0099794_10035182 Ga0099794_100351822 130
135 3300009147 Ga0114129_10659219 Ga0114129_106592191 130
136 3300009147 Ga0114129_10674156 Ga0114129_106741562 130
137 3300009147 Ga0114129_11021581 Ga0114129_110215812 130
138 3300025910 Ga0207684_10003003 Ga0207684_100030038 130
139 3300025915 Ga0207693_10038734 Ga0207693_100387344 130
140 3300025922 Ga0207646_11209540 Ga0207646_112095402 130
141 3300025928 Ga0207700_10151218 Ga0207700_101512182 130
142 3300025929 Ga0207664_10394122 Ga0207664_103941221 130
143 3300025939 Ga0207665_10403587 Ga0207665_104035872 130
144 3300027671 Ga0209588_1015562 Ga0209588_10155622 130
145 3300039447 Ga0436361_0470171 Ga0436361_0470171_167_559 130
146 3300048912 Ga0496109_0545221 Ga0496109_0545221_593_988 130
147 3300048913 Ga0496110_0003778 Ga0496110_0003778_10004_10399 130
148 3300048914 Ga0496111_0015891 Ga0496111_0015891_4001_4396 130
149 3300048915 Ga0496112_0371852 Ga0496112_0371852_895_1290 130
150 3300050507 nmdc:mga05p37_205925_c1 nmdc:mga05p37_205925_c1_805_1197 130
151 3300050510 nmdc:mga06r32_118462_c1 nmdc:mga06r32_118462_c1_2060_2452 130
152 3300050514 nmdc:mga08x19_419033_c1 nmdc:mga08x19_419033_c1_413_808 130
153 3300050515 nmdc:mga0a205_1013291_c1 nmdc:mga0a205_1013291_c1_110_505 130
154 3300053163 Ga0500639_194861 Ga0500639_194861_421_813 130
155 3300006852 Ga0075433_11641852 Ga0075433_116418521 131
156 3300025915 Ga0207693_10229203 Ga0207693_102292032 131
157 3300025939 Ga0207665_10201375 Ga0207665_102013751 131
158 3300035089 Ga0373944_0303894 Ga0373944_0303894_142_537 131
159 3300035111 Ga0373923_0000573 Ga0373923_0000573_5551_5946 131
160 3300035113 Ga0373936_0000350 Ga0373936_0000350_5327_5722 131
161 3300035116 Ga0373945_0002515 Ga0373945_0002515_1556_1951 131
162 3300035117 Ga0373953_0000112 Ga0373953_0000112_11507_11902 131
163 3300035118 Ga0373954_0004744 Ga0373954_0004744_2195_2590 131
164 3300035170 Ga0373943_0029253 Ga0373943_0029253_1179_1574 131
165 3300035172 Ga0373955_0004039 Ga0373955_0004039_5813_6208 131
166 3300035692 Ga0373935_0001098 Ga0373935_0001098_13057_13452 131
167 3300035695 Ga0373927_0009022 Ga0373927_0009022_336_731 131
168 3300035724 Ga0373933_0001117 Ga0373933_0001117_3385_3780 131
169 3300036401 Ga0373937_0000003 Ga0373937_0000003_109341_109736 131
170 3300037068 Ga0373925_0000052 Ga0373925_0000052_1423_1818 131
171 3300046454 Ga0495592_0000051 Ga0495592_0000051_24512_24907 131
172 3300046459 Ga0495629_0017344 Ga0495629_0017344_3521_3916 131
173 3300046463 Ga0495653_0000039 Ga0495653_0000039_94250_94645 131
174 3300046476 Ga0495662_0001044 Ga0495662_0001044_11825_12220 131
175 3300046477 Ga0495664_0000015 Ga0495664_0000015_92926_93321 131
176 3300046511 Ga0495608_0000025 Ga0495608_0000025_86451_86846 131
177 3300046514 Ga0495618_0000022 Ga0495618_0000022_1539_1934 131
178 3300046516 Ga0495628_0000011 Ga0495628_0000011_125673_126068 131
179 3300046517 Ga0495630_0000372 Ga0495630_0000372_9322_9717 131
180 3300046529 Ga0495652_0000014 Ga0495652_0000014_99417_99812 131
181 3300046531 Ga0495665_0104757 Ga0495665_0104757_206_601 131
182 3300046533 Ga0495640_0000008 Ga0495640_0000008_125673_126068 131
183 3300046535 Ga0495586_0086584 Ga0495586_0086584_1061_1456 131
184 3300046536 Ga0495587_0000015 Ga0495587_0000015_94223_94618 131
185 3300046543 Ga0495645_0000020 Ga0495645_0000020_86325_86720 131
186 3300046559 Ga0495667_0000013 Ga0495667_0000013_125659_126054 131
187 3300046663 Ga0495635_0000012 Ga0495635_0000012_99204_99599 131
188 3300046675 Ga0495657_0000048 Ga0495657_0000048_99746_100141 131
189 3300046678 Ga0495599_0000008 Ga0495599_0000008_99467_99862 131
190 3300046679 Ga0495623_0000002 Ga0495623_0000002_99857_100252 131
191 3300046680 Ga0495646_0000004 Ga0495646_0000004_174327_174722 131
192 3300046689 Ga0495613_0011168 Ga0495613_0011168_3182_3577 131
193 3300046690 Ga0495624_0006290 Ga0495624_0006290_6686_7081 131
194 3300046809 Ga0495600_0000024 Ga0495600_0000024_55355_55750 131
195 3300047317 Ga0495604_0000001 Ga0495604_0000001_410266_410661 131
196 3300047319 Ga0495674_0000023 Ga0495674_0000023_62715_63110 131
197 3300047322 Ga0495680_0000233 Ga0495680_0000233_12702_13097 131
198 3300047444 Ga0495675_0000392 Ga0495675_0000392_28654_29049 131
199 3300047471 Ga0495684_0000007 Ga0495684_0000007_99277_99672 131
200 3300047673 Ga0495593_0000722 Ga0495593_0000722_6600_6995 131
201 3300048088 Ga0495602_0000045 Ga0495602_0000045_86334_86729 131
202 3300048924 Ga0496121_0024228 Ga0496121_0024228_1385_1780 131
203 3300048929 Ga0496126_0018610 Ga0496126_0018610_3777_4172 131
204 3300053077 Ga0495601_0000014 Ga0495601_0000014_94251_94646 131
205 3300053078 Ga0495612_0000014 Ga0495612_0000014_94229_94624 131
206 3300053084 Ga0495595_0000038 Ga0495595_0000038_25572_25967 131
207 3300053085 Ga0495619_0000006 Ga0495619_0000006_125673_126068 131
208 3300005937 Ga0081455_10050178 Ga0081455_100501783 132
209 3300007076 Ga0075435_101224574 Ga0075435_1012245741 132
210 3300028800 Ga0265338_10340043 Ga0265338_103400432 132
211 3300031241 Ga0265325_10066263 Ga0265325_100662632 132
212 3300031595 Ga0265313_10121288 Ga0265313_101212882 132
213 3300031691 Ga0316579_10014265 Ga0316579_100142657 132
214 3300049743 Ga0501081_1100892 Ga0501081_1100892_173_571 132
215 3300050516 nmdc:mga0sz30_274123_c1 nmdc:mga0sz30_274123_c1_343_741 132
216 3300005354 Ga0070675_100004542 Ga0070675_1000045422 133
217 3300005441 Ga0070700_100001397 Ga0070700_1000013974 133
218 3300005719 Ga0068861_100070807 Ga0068861_1000708073 133
219 3300006038 Ga0075365_10053547 Ga0075365_100535473 133
220 3300026041 Ga0207639_10752262 Ga0207639_107522622 133
221 3300035398 Ga0316574_0983830 Ga0316574_0983830_32_436 133
222 3300036712 Ga0316584_0961635 Ga0316584_0961635_123_527 133
223 3300037853 Ga0436364_0458577 Ga0436364_0458577_1173_1631 133
224 3300050516 nmdc:mga0sz30_364397_c1 nmdc:mga0sz30_364397_c1_11_412 133
225 3300009545 Ga0105237_12613460 Ga0105237_126134601 134
226 3300013306 Ga0163162_10746308 Ga0163162_107463082 134
227 3300025944 Ga0207661_10961513 Ga0207661_109615131 134
228 3300031911 Ga0307412_11150199 Ga0307412_111501992 135
229 3300048915 Ga0496112_1385088 Ga0496112_1385088_162_578 135
230 3300001976 JGI24752J21851_1002810 JGI24752J21851_10028103 137
231 3300001991 JGI24743J22301_10002164 JGI24743J22301_100021643 137
232 3300002070 JGI24750J21931_1039237 JGI24750J21931_10392372 137
233 3300002075 JGI24738J21930_10055609 JGI24738J21930_100556091 137
234 3300002077 JGI24744J21845_10004559 JGI24744J21845_100045594 137
235 3300002239 JGI24034J26672_10029006 JGI24034J26672_100290062 137
236 3300005329 Ga0070683_100054615 Ga0070683_1000546153 137
237 3300005330 Ga0070690_100026046 Ga0070690_1000260462 137
238 3300005331 Ga0070670_100458088 Ga0070670_1004580882 137
239 3300005339 Ga0070660_100960499 Ga0070660_1009604991 137
240 3300005340 Ga0070689_100039729 Ga0070689_1000397293 137
241 3300005343 Ga0070687_100032468 Ga0070687_1000324682 137
242 3300005347 Ga0070668_100009976 Ga0070668_1000099764 137
243 3300005353 Ga0070669_100383566 Ga0070669_1003835661 137
244 3300005355 Ga0070671_100032273 Ga0070671_1000322732 137
245 3300005356 Ga0070674_100005764 Ga0070674_1000057646 137
246 3300005364 Ga0070673_100148936 Ga0070673_1001489362 137
247 3300005366 Ga0070659_100036367 Ga0070659_1000363673 137
248 3300005367 Ga0070667_100549236 Ga0070667_1005492362 137
249 3300005436 Ga0070713_100321636 Ga0070713_1003216362 137
250 3300005438 Ga0070701_10012870 Ga0070701_100128704 137
251 3300005439 Ga0070711_100160108 Ga0070711_1001601082 137
252 3300005455 Ga0070663_100002471 Ga0070663_1000024714 137
253 3300005457 Ga0070662_100077133 Ga0070662_1000771333 137
254 3300005459 Ga0068867_100009678 Ga0068867_1000096784 137
255 3300005466 Ga0070685_10017670 Ga0070685_100176703 137
256 3300005535 Ga0070684_100182029 Ga0070684_1001820292 137
257 3300005544 Ga0070686_100007362 Ga0070686_1000073625 137
258 3300005545 Ga0070695_100109925 Ga0070695_1001099252 137
259 3300005547 Ga0070693_100106817 Ga0070693_1001068172 137
260 3300005548 Ga0070665_100030975 Ga0070665_1000309754 137
261 3300005563 Ga0068855_100135242 Ga0068855_1001352422 137
262 3300005564 Ga0070664_100007681 Ga0070664_1000076814 137
263 3300005578 Ga0068854_100008399 Ga0068854_1000083992 137
264 3300005614 Ga0068856_100244887 Ga0068856_1002448872 137
265 3300005617 Ga0068859_100005143 Ga0068859_1000051438 137
266 3300005618 Ga0068864_100010485 Ga0068864_1000104854 137
267 3300005840 Ga0068870_10001282 Ga0068870_100012829 137
268 3300005841 Ga0068863_100018185 Ga0068863_1000181853 137
269 3300005842 Ga0068858_100009054 Ga0068858_1000090544 137
270 3300005843 Ga0068860_100031453 Ga0068860_1000314533 137
271 3300005844 Ga0068862_100711784 Ga0068862_1007117842 137
272 3300006028 Ga0070717_10233311 Ga0070717_102333112 137
273 3300006038 Ga0075365_10058312 Ga0075365_100583122 137
274 3300006048 Ga0075363_100526348 Ga0075363_1005263481 137
275 3300006048 Ga0075363_100600091 Ga0075363_1006000912 137
276 3300006175 Ga0070712_100074922 Ga0070712_1000749222 137
277 3300006178 Ga0075367_10256345 Ga0075367_102563452 137
278 3300006358 Ga0068871_100021753 Ga0068871_1000217532 137
279 3300006881 Ga0068865_100201715 Ga0068865_1002017152 137
280 3300006931 Ga0097620_100005143 Ga0097620_1000051437 137
281 3300009093 Ga0105240_11095037 Ga0105240_110950372 137
282 3300009094 Ga0111539_10326974 Ga0111539_103269742 137
283 3300009098 Ga0105245_10004899 Ga0105245_1000489911 137
284 3300009174 Ga0105241_10647645 Ga0105241_106476452 137
285 3300009176 Ga0105242_10202173 Ga0105242_102021732 137
286 3300009177 Ga0105248_10060325 Ga0105248_100603252 137
287 3300009553 Ga0105249_10132794 Ga0105249_101327943 137
288 3300010375 Ga0105239_10411806 Ga0105239_104118062 137
289 3300013296 Ga0157374_10017965 Ga0157374_100179654 137
290 3300013297 Ga0157378_12836366 Ga0157378_128363662 137
291 3300013308 Ga0157375_10022915 Ga0157375_100229153 137
292 3300014325 Ga0163163_10014635 Ga0163163_100146355 137
293 3300014326 Ga0157380_10008635 Ga0157380_100086357 137
294 3300014745 Ga0157377_10005112 Ga0157377_100051123 137
295 3300014968 Ga0157379_10015494 Ga0157379_100154943 137
296 3300014969 Ga0157376_10005241 Ga0157376_100052415 137
297 3300017792 Ga0163161_10008900 Ga0163161_100089003 137
298 3300025900 Ga0207710_10004968 Ga0207710_100049682 137
299 3300025901 Ga0207688_10001018 Ga0207688_1000101810 137
300 3300025904 Ga0207647_10014311 Ga0207647_100143112 137
301 3300025907 Ga0207645_10049416 Ga0207645_100494163 137
302 3300025908 Ga0207643_10002115 Ga0207643_100021155 137
303 3300025913 Ga0207695_10780904 Ga0207695_107809042 137
304 3300025916 Ga0207663_10016439 Ga0207663_100164394 137
305 3300025918 Ga0207662_10002530 Ga0207662_100025302 137
306 3300025919 Ga0207657_10614902 Ga0207657_106149022 137
307 3300025925 Ga0207650_10055032 Ga0207650_100550322 137
308 3300025926 Ga0207659_10072951 Ga0207659_100729513 137
309 3300025927 Ga0207687_10044730 Ga0207687_100447303 137
310 3300025928 Ga0207700_10344845 Ga0207700_103448451 137
311 3300025931 Ga0207644_10042321 Ga0207644_100423212 137
312 3300025932 Ga0207690_10006019 Ga0207690_100060195 137
313 3300025933 Ga0207706_10007301 Ga0207706_100073014 137
314 3300025934 Ga0207686_10013146 Ga0207686_100131463 137
315 3300025935 Ga0207709_10067951 Ga0207709_100679512 137
316 3300025936 Ga0207670_10017786 Ga0207670_100177863 137
317 3300025937 Ga0207669_10040422 Ga0207669_100404223 137
318 3300025938 Ga0207704_10013884 Ga0207704_100138843 137
319 3300025940 Ga0207691_10013884 Ga0207691_100138842 137
320 3300025941 Ga0207711_10017765 Ga0207711_100177653 137
321 3300025944 Ga0207661_10083026 Ga0207661_100830263 137
322 3300025945 Ga0207679_10041638 Ga0207679_100416383 137
323 3300025960 Ga0207651_10008222 Ga0207651_100082224 137
324 3300025972 Ga0207668_10245337 Ga0207668_102453372 137
325 3300025981 Ga0207640_10009536 Ga0207640_100095363 137
326 3300025986 Ga0207658_10449932 Ga0207658_104499322 137
327 3300026023 Ga0207677_10023873 Ga0207677_100238732 137
328 3300026035 Ga0207703_10010409 Ga0207703_100104093 137
329 3300026067 Ga0207678_10014457 Ga0207678_100144574 137
330 3300026075 Ga0207708_10003151 Ga0207708_100031514 137
331 3300026078 Ga0207702_10128654 Ga0207702_101286542 137
332 3300026088 Ga0207641_10037259 Ga0207641_100372592 137
333 3300026089 Ga0207648_10015553 Ga0207648_100155533 137
334 3300026095 Ga0207676_10016641 Ga0207676_100166414 137
335 3300026118 Ga0207675_100007420 Ga0207675_1000074204 137
336 3300026121 Ga0207683_10036492 Ga0207683_100364924 137
337 3300026121 Ga0207683_10291852 Ga0207683_102918522 137
338 3300026142 Ga0207698_10004999 Ga0207698_100049994 137
339 3300027866 Ga0209813_10082370 Ga0209813_100823702 137
340 3300028379 Ga0268266_10136643 Ga0268266_101366432 137
341 3300028379 Ga0268266_12003300 Ga0268266_120033001 137
342 3300028381 Ga0268264_10054601 Ga0268264_100546012 137
343 3300035111 Ga0373923_0373353 Ga0373923_0373353_36_452 137
344 3300041503 Ga0451847_0752386 Ga0451847_0752386_25_438 137
345 3300046453 Ga0495627_199660 Ga0495627_199660_23_436 137
346 3300046515 Ga0495620_0223330 Ga0495620_0223330_142_555 137
347 3300047445 Ga0495677_0380001 Ga0495677_0380001_104_517 137
348 3300048903 Ga0496100_0044838 Ga0496100_0044838_2017_2430 137
349 3300048904 Ga0496101_0015330 Ga0496101_0015330_366_779 137
350 3300048905 Ga0496102_0037269 Ga0496102_0037269_1956_2369 137
351 3300048906 Ga0496103_0002159 Ga0496103_0002159_7884_8297 137
352 3300048906 Ga0496103_0867725 Ga0496103_0867725_46_459 137
353 3300048907 Ga0496104_0047775 Ga0496104_0047775_1605_2018 137
354 3300048908 Ga0496105_0011645 Ga0496105_0011645_4564_4977 137
355 3300048909 Ga0496106_0007107 Ga0496106_0007107_5030_5443 137
356 3300048910 Ga0496107_0002626 Ga0496107_0002626_3455_3868 137
357 3300048911 Ga0496108_0002206 Ga0496108_0002206_7654_8067 137
358 3300048912 Ga0496109_0029403 Ga0496109_0029403_1895_2308 137
359 3300048913 Ga0496110_0016700 Ga0496110_0016700_2263_2676 137
360 3300048913 Ga0496110_0943426 Ga0496110_0943426_110_526 137
361 3300048913 Ga0496110_1382348 Ga0496110_1382348_13_426 137
362 3300048914 Ga0496111_0004532 Ga0496111_0004532_4394_4807 137
363 3300048915 Ga0496112_0008306 Ga0496112_0008306_3848_4261 137
364 3300048915 Ga0496112_0625488 Ga0496112_0625488_106_522 137
365 3300048916 Ga0496113_0016274 Ga0496113_0016274_2833_3246 137
366 3300048917 Ga0496114_0030922 Ga0496114_0030922_1270_1683 137
367 3300048918 Ga0496115_0058952 Ga0496115_0058952_2145_2558 137
368 3300050490 nmdc:mga03n38_9755_c1 nmdc:mga03n38_9755_c1_2083_2496 137
369 3300050492 nmdc:mga0yw44_17858_c1 nmdc:mga0yw44_17858_c1_3136_3549 137
370 3300050492 nmdc:mga0yw44_437499_c1 nmdc:mga0yw44_437499_c1_184_600 137
371 3300050493 nmdc:mga0k408_174260_c1 nmdc:mga0k408_174260_c1_636_1049 137
372 3300050494 nmdc:mga06z11_216799_c1 nmdc:mga06z11_216799_c1_234_647 137
373 3300050495 nmdc:mga04h51_121443_c1 nmdc:mga04h51_121443_c1_448_861 137
374 3300050511 nmdc:mga08y16_120972_c2 nmdc:mga08y16_120972_c2_928_1341 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11533

AtzH-like

AtzH-like

38

109

0.97

PF11533

AtzH-like

AtzH-like

1

40

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bjt-assembly1.cif.gz_B the structure of atzh: a little known member of the atrazine breakdown pathway 0.9875 7 130
6bju-assembly2.cif.gz_C the structure of atzh: a little known member of the atrazine breakdown pathway 0.9869 6 130
6bju-assembly1.cif.gz_A the structure of atzh: a little known member of the atrazine breakdown pathway 0.9869 7 130
2rcd-assembly2.cif.gz_C crystal structure of a protein with unknown function from duf3225 family (eca3500) from pectobacterium atrosepticum scri1043 at 2.32 a resolution 0.9865 6 129
6d63-assembly1.cif.gz_A the structure of atzh: a little known member of the atrazine breakdown pathway 0.9849 5 130
ID Description Score Start End Superfamily
6bjtB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9875 7 130 3.10.450.50
6d63G00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9676 5 130 3.10.450.50
6d63G00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9594 5 130 3.10.450.50
2owpB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9543 6 130 3.10.450.50
2owpB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9395 6 130 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A509EFP3-F1-model_v4 DUF4440 domain-containing protein 0.9988 5 130
AF-A0A0Q6K7F9-F1-model_v4 Oxalurate catabolism protein HpxZ 0.9944 5 130
AF-A0A258CYD1-F1-model_v4 DUF4440 domain-containing protein 0.9931 5 130
AF-A0A833H5S7-F1-model_v4 Oxalurate catabolism protein HpxZ 0.9922 5 130
AF-A0A1N6S9A6-F1-model_v4 DUF4440 domain-containing protein 0.9914 5 130

Feature Viewer

pLDDT pTM Quality
93.79 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map