F426513

General Info

Members Datasets Scaffolds Average Seq Length
373 195 746 223

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0188284|Ga0501083_0188284_556_1296
Length 246
Sequence MGRRTGAGSGMIINSDLFMDFYLLDGGFIQRFIEWIIEYGGLYILLLVVLAETGLFVGFFFPGDSLLFAAGIYVDDLAKEFFGVHWSVIMMMVMVASILGNIVGYWFGRKTGPLLYERKETWLFRKKHLIRAKEFYDHYGKGTIFLAKFLPIVRTFAPIVAGMVKMDRSIFMFYNIIGSICWVAAMMLGGHFLEKWALNQFDFSLKDHIEGITIGIILVTTLPVLYKLFFAKKPVVPPPGDSNVKP

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
187 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
194 2818991444 Filimonas endophytica 3197 Isolate Unclassified
195 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 0.8
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 9.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0188284 3300049744 Bacteria 1347
2 JGI24736J21556_1007680 3300001904 Bacteria 1809
3 JGI24740J21852_10024371 3300001979 Bacteria 2054
4 JGI24742J22300_10013573 3300002244 Bacteria 1364
5 JGI24751J29686_10001227 3300002459 Bacteria 5428
6 rootH1_10001033 3300003316 Unclassified 2175
7 rootH2_10031819 3300003320 Bacteria 6370
8 rootL2_10181104 3300003322 Unclassified 3399
9 rootL2_10301676 3300003322 Bacteria 1270
10 rootH1_10068631 3300003323 Bacteria 13283
11 rootH1_10107669 3300003323 Bacteria 9258
12 Ga0065707_10153474 3300005295 Bacteria 1633
13 Ga0065707_10346118 3300005295 Bacteria 926
14 Ga0070676_10053496 3300005328 Bacteria 2378
15 Ga0070676_10294899 3300005328 Unclassified 1097
16 Ga0070683_100001537 3300005329 Bacteria 17862
17 Ga0070683_100003859 3300005329 Bacteria 12252
18 Ga0070683_100084050 3300005329 Bacteria 2982
19 Ga0070690_100158938 3300005330 Bacteria 1547
20 Ga0070690_100209690 3300005330 Bacteria 1360
21 Ga0070690_100400787 3300005330 Bacteria 1007
22 Ga0070670_100018940 3300005331 Bacteria 5903
23 Ga0070670_100056579 3300005331 Bacteria 3366
24 Ga0070670_100110802 3300005331 Bacteria 2365
25 Ga0070670_100598754 3300005331 Bacteria 986
26 Ga0070677_10086122 3300005333 Bacteria 1356
27 Ga0068869_100005537 3300005334 Bacteria 7950
28 Ga0068869_100011142 3300005334 Bacteria 5892
29 Ga0068869_100034568 3300005334 Bacteria 3576
30 Ga0068869_100046888 3300005334 Bacteria 3118
31 Ga0068869_100097226 3300005334 Unclassified 2223
32 Ga0068868_100125816 3300005338 Bacteria 2094
33 Ga0068868_100160143 3300005338 Bacteria 1858
34 Ga0068868_100249480 3300005338 Bacteria 1493
35 Ga0068868_100574834 3300005338 Bacteria 996
36 Ga0070660_100000634 3300005339 Bacteria 23376
37 Ga0070660_100592105 3300005339 Bacteria 927
38 Ga0070689_100064829 3300005340 Unclassified 2844
39 Ga0070689_100314481 3300005340 Bacteria 1306
40 Ga0070687_100564034 3300005343 Bacteria 777
41 Ga0070661_100004500 3300005344 Bacteria 9602
42 Ga0070661_100040725 3300005344 Bacteria 3390
43 Ga0070661_100118868 3300005344 Bacteria 1978
44 Ga0070661_100704154 3300005344 Unclassified 823
45 Ga0070668_100061899 3300005347 Bacteria 2900
46 Ga0070668_100094665 3300005347 Bacteria 2358
47 Ga0070669_100015966 3300005353 Bacteria 5357
48 Ga0070669_101037212 3300005353 Bacteria 705
49 Ga0070675_100016377 3300005354 Bacteria 5885
50 Ga0070675_100017220 3300005354 Bacteria 5741
51 Ga0070675_100025463 3300005354 Bacteria 4742
52 Ga0070675_100074864 3300005354 Bacteria 2814
53 Ga0070671_100076222 3300005355 Bacteria 2802
54 Ga0070674_100025313 3300005356 Bacteria 3862
55 Ga0070673_100009985 3300005364 Bacteria 6402
56 Ga0070673_100290922 3300005364 Bacteria 1435
57 Ga0070673_100371437 3300005364 Bacteria 1273
58 Ga0070673_100736986 3300005364 Unclassified 907
59 Ga0070688_100272675 3300005365 Bacteria 1213
60 Ga0070688_100889451 3300005365 Bacteria 702
61 Ga0070659_100140819 3300005366 Bacteria 1964
62 Ga0070667_100018403 3300005367 Bacteria 5794
63 Ga0070667_100293545 3300005367 Bacteria 1462
64 Ga0070667_100433991 3300005367 Unclassified 1199
65 Ga0070663_100122295 3300005455 Bacteria 1967
66 Ga0070678_100000605 3300005456 Bacteria 17659
67 Ga0070678_100227640 3300005456 Bacteria 1553
68 Ga0070678_100631268 3300005456 Bacteria 959
69 Ga0070662_100155295 3300005457 Bacteria 1786
70 Ga0068867_100264981 3300005459 Bacteria 1402
71 Ga0070685_10021315 3300005466 Bacteria 3521
72 Ga0070685_10173321 3300005466 Bacteria 1384
73 Ga0070679_100247269 3300005530 Bacteria 1740
74 Ga0070679_100625113 3300005530 Bacteria 1020
75 Ga0070684_100008209 3300005535 Bacteria 8157
76 Ga0070684_100042671 3300005535 Bacteria 3916
77 Ga0070684_100088334 3300005535 Bacteria 2754
78 Ga0070684_100333587 3300005535 Bacteria 1394
79 Ga0068853_100011576 3300005539 Bacteria 7173
80 Ga0068853_100014397 3300005539 Bacteria 6476
81 Ga0068853_100115131 3300005539 Bacteria 2392
82 Ga0068853_100586321 3300005539 Unclassified 1058
83 Ga0070672_100016222 3300005543 Bacteria 5328
84 Ga0070672_100062458 3300005543 Bacteria 2940
85 Ga0070672_100552648 3300005543 Bacteria 1000
86 Ga0070696_100220211 3300005546 Bacteria 1424
87 Ga0070693_100316244 3300005547 Bacteria 1057
88 Ga0070704_100282402 3300005549 Bacteria 1376
89 Ga0070664_100002506 3300005564 Bacteria 14800
90 Ga0070664_100007949 3300005564 Bacteria 8568
91 Ga0070664_100030846 3300005564 Bacteria 4474
92 Ga0070664_100068652 3300005564 Bacteria 3031
93 Ga0070664_100182738 3300005564 Bacteria 1865
94 Ga0068857_100000631 3300005577 Bacteria 25869
95 Ga0068857_100132344 3300005577 Bacteria 2250
96 Ga0068857_100152832 3300005577 Bacteria 2092
97 Ga0068857_100240115 3300005577 Bacteria 1659
98 Ga0068857_100346631 3300005577 Bacteria 1375
99 Ga0068854_100068828 3300005578 Bacteria 2582
100 Ga0068854_100260190 3300005578 Bacteria 1389
101 Ga0068852_100095753 3300005616 Bacteria 2666
102 Ga0068852_100187798 3300005616 Bacteria 1947
103 Ga0068852_100992534 3300005616 Bacteria 858
104 Ga0068859_100020700 3300005617 Bacteria 6601
105 Ga0068859_100045007 3300005617 Bacteria 4435
106 Ga0068859_100076009 3300005617 Bacteria 3399
107 Ga0068859_100125375 3300005617 Bacteria 2637
108 Ga0068859_100126275 3300005617 Bacteria 2627
109 Ga0068859_100133923 3300005617 Bacteria 2550
110 Ga0068859_100470464 3300005617 Bacteria 1352
111 Ga0068864_100027322 3300005618 Bacteria 4818
112 Ga0068866_10091427 3300005718 Bacteria 1658
113 Ga0068866_10362202 3300005718 Bacteria 925
114 Ga0068861_100013160 3300005719 Bacteria 5787
115 Ga0068851_10021563 3300005834 Bacteria 3128
116 Ga0068870_10042154 3300005840 Bacteria 2375
117 Ga0068863_100015639 3300005841 Bacteria 7288
118 Ga0068863_100101926 3300005841 Bacteria 2729
119 Ga0068863_100247538 3300005841 Bacteria 1721
120 Ga0068858_100308934 3300005842 Bacteria 1510
121 Ga0068860_100030725 3300005843 Bacteria 5165
122 Ga0068860_100093369 3300005843 Bacteria 2868
123 Ga0068860_100144752 3300005843 Bacteria 2286
124 Ga0068862_100069362 3300005844 Bacteria 3043
125 Ga0068862_100111541 3300005844 Bacteria 2401
126 Ga0097621_100120755 3300006237 Bacteria 2222
127 Ga0097621_100158510 3300006237 Bacteria 1944
128 Ga0068871_100050535 3300006358 Bacteria 3363
129 Ga0068871_100060448 3300006358 Bacteria 3091
130 Ga0068865_100003471 3300006881 Bacteria 9444
131 Ga0075436_100326138 3300006914 Bacteria 1103
132 Ga0097620_100020700 3300006931 Bacteria 6601
133 Ga0097620_100045010 3300006931 Bacteria 4435
134 Ga0097620_100076007 3300006931 Bacteria 3399
135 Ga0097620_100125370 3300006931 Bacteria 2637
136 Ga0097620_100126277 3300006931 Bacteria 2627
137 Ga0097620_100133927 3300006931 Bacteria 2550
138 Ga0097620_100470456 3300006931 Bacteria 1352
139 Ga0105240_10524407 3300009093 Bacteria 1314
140 Ga0105247_10026481 3300009101 Bacteria 3502
141 Ga0105242_10030655 3300009176 Bacteria 4294
142 Ga0105242_10054010 3300009176 Bacteria 3283
143 Ga0105242_10117183 3300009176 Bacteria 2280
144 Ga0105242_10142400 3300009176 Bacteria 2082
145 Ga0105248_10528124 3300009177 Bacteria 1331
146 Ga0105237_10045297 3300009545 Bacteria 4427
147 Ga0105249_10008092 3300009553 Bacteria 9167
148 Ga0105249_10015599 3300009553 Bacteria 6725
149 Ga0105249_10038682 3300009553 Bacteria 4329
150 Ga0105249_10072246 3300009553 Bacteria 3189
151 Ga0105249_10185811 3300009553 Bacteria 2025
152 Ga0105249_10698705 3300009553 Bacteria 1074
153 Ga0105239_10004433 3300010375 Bacteria 16787
154 Ga0157373_10030321 3300013100 Bacteria 3891
155 Ga0157371_10044253 3300013102 Bacteria 3170
156 Ga0157371_10069210 3300013102 Bacteria 2499
157 Ga0157371_10101997 3300013102 Bacteria 2036
158 Ga0157371_10106561 3300013102 Bacteria 1989
159 Ga0157369_10053744 3300013105 Bacteria 4351
160 Ga0157374_10006141 3300013296 Bacteria 10176
161 Ga0157374_10014348 3300013296 Bacteria 6934
162 Ga0157374_10090293 3300013296 Unclassified 2920
163 Ga0157378_10022162 3300013297 Bacteria 5590
164 Ga0163162_10023857 3300013306 Bacteria 6036
165 Ga0163162_10174908 3300013306 Unclassified 2272
166 Ga0163162_10178301 3300013306 Bacteria 2251
167 Ga0163162_10545951 3300013306 Bacteria 1287
168 Ga0157372_10037839 3300013307 Bacteria 5323
169 Ga0157372_10061936 3300013307 Bacteria 4190
170 Ga0157372_10222609 3300013307 Unclassified 2187
171 Ga0157372_10231920 3300013307 Bacteria 2140
172 Ga0157372_10319858 3300013307 Bacteria 1807
173 Ga0157372_10433179 3300013307 Bacteria 1533
174 Ga0157372_10470012 3300013307 Bacteria 1466
175 Ga0157372_10545614 3300013307 Bacteria 1351
176 Ga0157375_10037384 3300013308 Bacteria 4652
177 Ga0157375_10060041 3300013308 Bacteria 3769
178 Ga0157375_10083843 3300013308 Bacteria 3233
179 Ga0157375_10169217 3300013308 Unclassified 2332
180 Ga0157375_10169345 3300013308 Bacteria 2331
181 Ga0157375_10536398 3300013308 Bacteria 1333
182 Ga0163163_10000457 3300014325 Bacteria 37238
183 Ga0163163_10227349 3300014325 Bacteria 1915
184 Ga0157380_10037736 3300014326 Bacteria 3745
185 Ga0157380_10118146 3300014326 Bacteria 2241
186 Ga0157380_10347366 3300014326 Unclassified 1387
187 Ga0157380_10556538 3300014326 Bacteria 1126
188 Ga0157377_10008715 3300014745 Bacteria 4957
189 Ga0157379_10640047 3300014968 Bacteria 995
190 Ga0157376_10053369 3300014969 Bacteria 3365
191 Ga0163161_10025053 3300017792 Bacteria 4218
192 Ga0163161_10473895 3300017792 Unclassified 1015
193 Ga0207426_1000230 3300025302 Bacteria 128357
194 Ga0207656_10167779 3300025321 Bacteria 1048
195 Ga0207682_10098251 3300025893 Bacteria 1277
196 Ga0207642_10369798 3300025899 Bacteria 850
197 Ga0207710_10001364 3300025900 Bacteria 12272
198 Ga0207688_10057138 3300025901 Bacteria 2193
199 Ga0207680_10301848 3300025903 Bacteria 1116
200 Ga0207680_10343057 3300025903 Bacteria 1048
201 Ga0207647_10000279 3300025904 Bacteria 41622
202 Ga0207645_10000571 3300025907 Bacteria 30525
203 Ga0207645_10050334 3300025907 Bacteria 2660
204 Ga0207645_10202377 3300025907 Bacteria 1307
205 Ga0207671_10074060 3300025914 Bacteria 2545
206 Ga0207657_10000767 3300025919 Bacteria 34034
207 Ga0207657_10459755 3300025919 Bacteria 998
208 Ga0207649_10001702 3300025920 Bacteria 12677
209 Ga0207649_10090993 3300025920 Bacteria 1997
210 Ga0207649_10144757 3300025920 Bacteria 1630
211 Ga0207652_10566734 3300025921 Bacteria 1020
212 Ga0207681_10218210 3300025923 Bacteria 1474
213 Ga0207681_10474317 3300025923 Bacteria 1021
214 Ga0207650_10057642 3300025925 Bacteria 2889
215 Ga0207650_10141905 3300025925 Bacteria 1889
216 Ga0207659_10027089 3300025926 Bacteria 3876
217 Ga0207659_10172258 3300025926 Bacteria 1708
218 Ga0207644_10051489 3300025931 Bacteria 2956
219 Ga0207706_10003814 3300025933 Bacteria 14367
220 Ga0207686_10010589 3300025934 Bacteria 5025
221 Ga0207686_10073975 3300025934 Bacteria 2200
222 Ga0207670_10017181 3300025936 Bacteria 4368
223 Ga0207669_10215656 3300025937 Bacteria 1404
224 Ga0207704_10042766 3300025938 Bacteria 2669
225 Ga0207691_10018349 3300025940 Bacteria 6629
226 Ga0207691_10059667 3300025940 Bacteria 3468
227 Ga0207691_10326041 3300025940 Unclassified 1316
228 Ga0207691_10581038 3300025940 Bacteria 949
229 Ga0207689_10000939 3300025942 Bacteria 28012
230 Ga0207689_10002211 3300025942 Bacteria 18237
231 Ga0207689_10004612 3300025942 Bacteria 12462
232 Ga0207689_10065117 3300025942 Bacteria 2998
233 Ga0207689_10080057 3300025942 Unclassified 2685
234 Ga0207689_10354195 3300025942 Bacteria 1220
235 Ga0207661_10013438 3300025944 Bacteria 5980
236 Ga0207661_10094086 3300025944 Bacteria 2502
237 Ga0207679_10036816 3300025945 Bacteria 3474
238 Ga0207679_10071336 3300025945 Bacteria 2620
239 Ga0207679_10086514 3300025945 Bacteria 2411
240 Ga0207679_10483887 3300025945 Bacteria 1102
241 Ga0207651_10073403 3300025960 Bacteria 2433
242 Ga0207712_10013744 3300025961 Bacteria 5193
243 Ga0207712_10022325 3300025961 Bacteria 4165
244 Ga0207712_10039494 3300025961 Bacteria 3234
245 Ga0207712_10054734 3300025961 Bacteria 2803
246 Ga0207668_10159202 3300025972 Bacteria 1757
247 Ga0207640_10236468 3300025981 Bacteria 1409
248 Ga0207658_10252755 3300025986 Bacteria 1498
249 Ga0207677_10128437 3300026023 Bacteria 1920
250 Ga0207677_10332701 3300026023 Bacteria 1266
251 Ga0207677_10550999 3300026023 Unclassified 1005
252 Ga0207639_10107457 3300026041 Bacteria 2267
253 Ga0207639_10163186 3300026041 Bacteria 1880
254 Ga0207639_10275588 3300026041 Bacteria 1477
255 Ga0207641_10001344 3300026088 Bacteria 24357
256 Ga0207641_10063801 3300026088 Bacteria 3147
257 Ga0207641_10159426 3300026088 Bacteria 2050
258 Ga0207648_10002203 3300026089 Bacteria 21158
259 Ga0207648_10069680 3300026089 Bacteria 3064
260 Ga0207676_10011078 3300026095 Bacteria 6434
261 Ga0207674_10004512 3300026116 Bacteria 16733
262 Ga0207674_10116979 3300026116 Bacteria 2637
263 Ga0207674_10175835 3300026116 Bacteria 2093
264 Ga0207674_10189600 3300026116 Bacteria 2006
265 Ga0207674_10570637 3300026116 Unclassified 1093
266 Ga0207675_100008902 3300026118 Bacteria 9417
267 Ga0207675_100086472 3300026118 Bacteria 2944
268 Ga0207675_100304442 3300026118 Bacteria 1553
269 Ga0207675_100410502 3300026118 Unclassified 1336
270 Ga0207683_10000535 3300026121 Bacteria 35178
271 Ga0207683_10049613 3300026121 Bacteria 3675
272 Ga0207683_10732987 3300026121 Bacteria 917
273 Ga0207698_10121109 3300026142 Bacteria 2215
274 Ga0207698_10279234 3300026142 Unclassified 1544
275 Ga0207698_10493403 3300026142 Bacteria 1190
276 Ga0209969_1013460 3300027360 Bacteria 1185
277 Ga0209974_10014051 3300027876 Bacteria 2668
278 Ga0268266_10124101 3300028379 Bacteria 2302
279 Ga0268266_10147519 3300028379 Bacteria 2117
280 Ga0268266_10402479 3300028379 Bacteria 1294
281 Ga0268265_10012131 3300028380 Bacteria 5835
282 Ga0268265_10079380 3300028380 Bacteria 2584
283 Ga0268265_10136725 3300028380 Bacteria 2046
284 Ga0268265_10534307 3300028380 Bacteria 1111
285 Ga0268265_10564287 3300028380 Unclassified 1083
286 Ga0268264_10038113 3300028381 Bacteria 3965
287 Ga0268264_10080830 3300028381 Bacteria 2776
288 Ga0268264_10086279 3300028381 Bacteria 2696
289 Ga0265327_10040546 3300031251 Bacteria 2517
290 Ga0307408_100411471 3300031548 Bacteria 1164
291 Ga0307516_10216680 3300031730 Bacteria 1626
292 Ga0307413_10098889 3300031824 Bacteria 1922
293 Ga0307413_10336325 3300031824 Bacteria 1159
294 Ga0307410_10066381 3300031852 Bacteria 2485
295 Ga0307412_10559679 3300031911 Bacteria 962
296 Ga0307414_10023661 3300032004 Unclassified 3901
297 Ga0307414_10218910 3300032004 Unclassified 1562
298 Ga0307414_10285969 3300032004 Unclassified 1388
299 Ga0307415_100079830 3300032126 Bacteria 2332
300 Ga0373923_0069019 3300035111 Bacteria 1515
301 Ga0373955_0061576 3300035172 Bacteria 2073
302 Ga0373924_0006355 3300035410 Bacteria 4232
303 Ga0373947_0047450 3300035725 Bacteria 2574
304 Ga0373937_0002054 3300036401 Bacteria 16833
305 Ga0395900_0163188 3300037418 Bacteria 2272
306 Ga0395900_0219095 3300037418 Bacteria 1919
307 Ga0395900_0510746 3300037418 Unclassified 1151
308 Ga0395898_0558286 3300037466 Unclassified 1087
309 Ga0395905_0002388 3300037471 Bacteria 20901
310 Ga0395905_0148041 3300037471 Unclassified 2209
311 Ga0451807_2161341 3300041486 Unclassified 753
312 Ga0451853_2873042 3300041512 Bacteria 1089
313 Ga0450897_006616 3300042128 Bacteria 1038
314 Ga0450898_007508 3300042134 Bacteria 1699
315 Ga0450899_009980 3300042135 Bacteria 1050
316 Ga0439446_0038595 3300042156 Unclassified 1401
317 Ga0439434_0001225 3300042435 Bacteria 7392
318 Ga0451577_0440028 3300042876 Unclassified 1184
319 Ga0495653_0056965 3300046463 Bacteria 2978
320 Ga0495650_0059469 3300046471 Bacteria 1539
321 Ga0495618_0035182 3300046514 Bacteria 3144
322 Ga0495628_0014749 3300046516 Bacteria 6541
323 Ga0495630_0062399 3300046517 Bacteria 2800
324 Ga0495643_0029209 3300046522 Unclassified 3086
325 Ga0495640_0243881 3300046533 Bacteria 1127
326 Ga0495587_0032733 3300046536 Bacteria 3141
327 Ga0495598_0010464 3300046537 Bacteria 2223
328 Ga0495621_0024167 3300046539 Bacteria 2028
329 Ga0495621_0149501 3300046539 Bacteria 918
330 Ga0495667_0031786 3300046559 Bacteria 3540
331 Ga0495634_0314845 3300046642 Bacteria 943
332 Ga0495635_0064346 3300046663 Bacteria 2518
333 Ga0495659_0136108 3300046664 Bacteria 978
334 Ga0495604_0115459 3300047317 Bacteria 1951
335 Ga0495686_0036372 3300047472 Unclassified 3160
336 Ga0496110_0317929 3300048913 Bacteria 1418
337 Ga0496114_0001763 3300048917 Bacteria 16431
338 Ga0501296_003466 3300049519 Bacteria 1684
339 Ga0501032_0030710 3300049569 Bacteria 3687
340 Ga0501034_0065838 3300049571 Bacteria 3637
341 Ga0501034_0283247 3300049571 Bacteria 1597
342 Ga0501034_0787239 3300049571 Bacteria 844
343 Ga0501036_0023141 3300049572 Bacteria 5231
344 Ga0501036_0178988 3300049572 Bacteria 1785
345 Ga0501039_0624124 3300049575 Bacteria 844
346 Ga0501043_0018214 3300049579 Bacteria 5505
347 Ga0501043_0508212 3300049579 Bacteria 899
348 Ga0501046_0057508 3300049580 Bacteria 3050
349 Ga0501046_0111956 3300049580 Bacteria 2084
350 Ga0501047_0164795 3300049581 Bacteria 2087
351 Ga0501047_0626153 3300049581 Bacteria 896
352 Ga0501070_0068713 3300049586 Bacteria 2933
353 Ga0501073_0444178 3300049589 Bacteria 896
354 Ga0501074_0059192 3300049590 Bacteria 2760
355 Ga0501074_0485591 3300049590 Bacteria 875
356 Ga0501198_002654 3300049649 Bacteria 2419
357 Ga0501233_021296 3300049668 Bacteria 1391
358 Ga0501221_014308 3300049704 Bacteria 1473
359 Ga0501079_0206498 3300049741 Bacteria 1534
360 Ga0501080_0369404 3300049742 Bacteria 1293
361 Ga0501080_0722563 3300049742 Unclassified 877
362 Ga0501083_0003657 3300049744 Bacteria 10792
363 Ga0501266_007118 3300049763 Bacteria 1397
364 Ga0501279_011150 3300049775 Unclassified 1213
365 Ga0501035_0027193 3300049822 Bacteria 5229
366 Ga0501044_0002309 3300049823 Bacteria 21726
367 Ga0501044_0303442 3300049823 Bacteria 1525
368 Ga0500642_0022990 3300053130 Unclassified 2496
369 Ga0500568_0000606 3300053139 Bacteria 25992
370 Ga0500616_0001236 3300053153 Bacteria 25651
371 Ga0500627_0004766 3300053158 Unclassified 4408
372 2819588066 2818991444 Bacteria 6968812
373 2929157938 2929154850 Bacteria 6753285
374 Ga0501083_0188284
375 JGI24736J21556_1007680
376 JGI24740J21852_10024371
377 JGI24742J22300_10013573
378 JGI24751J29686_10001227
379 rootH1_10001033
380 rootH2_10031819
381 rootL2_10181104
382 rootL2_10301676
383 rootH1_10068631
384 rootH1_10107669
385 Ga0065707_10153474
386 Ga0065707_10346118
387 Ga0070676_10053496
388 Ga0070676_10294899
389 Ga0070683_100001537
390 Ga0070683_100003859
391 Ga0070683_100084050
392 Ga0070690_100158938
393 Ga0070690_100209690
394 Ga0070690_100400787
395 Ga0070670_100018940
396 Ga0070670_100056579
397 Ga0070670_100110802
398 Ga0070670_100598754
399 Ga0070677_10086122
400 Ga0068869_100005537
401 Ga0068869_100011142
402 Ga0068869_100034568
403 Ga0068869_100046888
404 Ga0068869_100097226
405 Ga0068868_100125816
406 Ga0068868_100160143
407 Ga0068868_100249480
408 Ga0068868_100574834
409 Ga0070660_100000634
410 Ga0070660_100592105
411 Ga0070689_100064829
412 Ga0070689_100314481
413 Ga0070687_100564034
414 Ga0070661_100004500
415 Ga0070661_100040725
416 Ga0070661_100118868
417 Ga0070661_100704154
418 Ga0070668_100061899
419 Ga0070668_100094665
420 Ga0070669_100015966
421 Ga0070669_101037212
422 Ga0070675_100016377
423 Ga0070675_100017220
424 Ga0070675_100025463
425 Ga0070675_100074864
426 Ga0070671_100076222
427 Ga0070674_100025313
428 Ga0070673_100009985
429 Ga0070673_100290922
430 Ga0070673_100371437
431 Ga0070673_100736986
432 Ga0070688_100272675
433 Ga0070688_100889451
434 Ga0070659_100140819
435 Ga0070667_100018403
436 Ga0070667_100293545
437 Ga0070667_100433991
438 Ga0070663_100122295
439 Ga0070678_100000605
440 Ga0070678_100227640
441 Ga0070678_100631268
442 Ga0070662_100155295
443 Ga0068867_100264981
444 Ga0070685_10021315
445 Ga0070685_10173321
446 Ga0070679_100247269
447 Ga0070679_100625113
448 Ga0070684_100008209
449 Ga0070684_100042671
450 Ga0070684_100088334
451 Ga0070684_100333587
452 Ga0068853_100011576
453 Ga0068853_100014397
454 Ga0068853_100115131
455 Ga0068853_100586321
456 Ga0070672_100016222
457 Ga0070672_100062458
458 Ga0070672_100552648
459 Ga0070696_100220211
460 Ga0070693_100316244
461 Ga0070704_100282402
462 Ga0070664_100002506
463 Ga0070664_100007949
464 Ga0070664_100030846
465 Ga0070664_100068652
466 Ga0070664_100182738
467 Ga0068857_100000631
468 Ga0068857_100132344
469 Ga0068857_100152832
470 Ga0068857_100240115
471 Ga0068857_100346631
472 Ga0068854_100068828
473 Ga0068854_100260190
474 Ga0068852_100095753
475 Ga0068852_100187798
476 Ga0068852_100992534
477 Ga0068859_100020700
478 Ga0068859_100045007
479 Ga0068859_100076009
480 Ga0068859_100125375
481 Ga0068859_100126275
482 Ga0068859_100133923
483 Ga0068859_100470464
484 Ga0068864_100027322
485 Ga0068866_10091427
486 Ga0068866_10362202
487 Ga0068861_100013160
488 Ga0068851_10021563
489 Ga0068870_10042154
490 Ga0068863_100015639
491 Ga0068863_100101926
492 Ga0068863_100247538
493 Ga0068858_100308934
494 Ga0068860_100030725
495 Ga0068860_100093369
496 Ga0068860_100144752
497 Ga0068862_100069362
498 Ga0068862_100111541
499 Ga0097621_100120755
500 Ga0097621_100158510
501 Ga0068871_100050535
502 Ga0068871_100060448
503 Ga0068865_100003471
504 Ga0075436_100326138
505 Ga0097620_100020700
506 Ga0097620_100045010
507 Ga0097620_100076007
508 Ga0097620_100125370
509 Ga0097620_100126277
510 Ga0097620_100133927
511 Ga0097620_100470456
512 Ga0105240_10524407
513 Ga0105247_10026481
514 Ga0105242_10030655
515 Ga0105242_10054010
516 Ga0105242_10117183
517 Ga0105242_10142400
518 Ga0105248_10528124
519 Ga0105237_10045297
520 Ga0105249_10008092
521 Ga0105249_10015599
522 Ga0105249_10038682
523 Ga0105249_10072246
524 Ga0105249_10185811
525 Ga0105249_10698705
526 Ga0105239_10004433
527 Ga0157373_10030321
528 Ga0157371_10044253
529 Ga0157371_10069210
530 Ga0157371_10101997
531 Ga0157371_10106561
532 Ga0157369_10053744
533 Ga0157374_10006141
534 Ga0157374_10014348
535 Ga0157374_10090293
536 Ga0157378_10022162
537 Ga0163162_10023857
538 Ga0163162_10174908
539 Ga0163162_10178301
540 Ga0163162_10545951
541 Ga0157372_10037839
542 Ga0157372_10061936
543 Ga0157372_10222609
544 Ga0157372_10231920
545 Ga0157372_10319858
546 Ga0157372_10433179
547 Ga0157372_10470012
548 Ga0157372_10545614
549 Ga0157375_10037384
550 Ga0157375_10060041
551 Ga0157375_10083843
552 Ga0157375_10169217
553 Ga0157375_10169345
554 Ga0157375_10536398
555 Ga0163163_10000457
556 Ga0163163_10227349
557 Ga0157380_10037736
558 Ga0157380_10118146
559 Ga0157380_10347366
560 Ga0157380_10556538
561 Ga0157377_10008715
562 Ga0157379_10640047
563 Ga0157376_10053369
564 Ga0163161_10025053
565 Ga0163161_10473895
566 Ga0207426_1000230
567 Ga0207656_10167779
568 Ga0207682_10098251
569 Ga0207642_10369798
570 Ga0207710_10001364
571 Ga0207688_10057138
572 Ga0207680_10301848
573 Ga0207680_10343057
574 Ga0207647_10000279
575 Ga0207645_10000571
576 Ga0207645_10050334
577 Ga0207645_10202377
578 Ga0207671_10074060
579 Ga0207657_10000767
580 Ga0207657_10459755
581 Ga0207649_10001702
582 Ga0207649_10090993
583 Ga0207649_10144757
584 Ga0207652_10566734
585 Ga0207681_10218210
586 Ga0207681_10474317
587 Ga0207650_10057642
588 Ga0207650_10141905
589 Ga0207659_10027089
590 Ga0207659_10172258
591 Ga0207644_10051489
592 Ga0207706_10003814
593 Ga0207686_10010589
594 Ga0207686_10073975
595 Ga0207670_10017181
596 Ga0207669_10215656
597 Ga0207704_10042766
598 Ga0207691_10018349
599 Ga0207691_10059667
600 Ga0207691_10326041
601 Ga0207691_10581038
602 Ga0207689_10000939
603 Ga0207689_10002211
604 Ga0207689_10004612
605 Ga0207689_10065117
606 Ga0207689_10080057
607 Ga0207689_10354195
608 Ga0207661_10013438
609 Ga0207661_10094086
610 Ga0207679_10036816
611 Ga0207679_10071336
612 Ga0207679_10086514
613 Ga0207679_10483887
614 Ga0207651_10073403
615 Ga0207712_10013744
616 Ga0207712_10022325
617 Ga0207712_10039494
618 Ga0207712_10054734
619 Ga0207668_10159202
620 Ga0207640_10236468
621 Ga0207658_10252755
622 Ga0207677_10128437
623 Ga0207677_10332701
624 Ga0207677_10550999
625 Ga0207639_10107457
626 Ga0207639_10163186
627 Ga0207639_10275588
628 Ga0207641_10001344
629 Ga0207641_10063801
630 Ga0207641_10159426
631 Ga0207648_10002203
632 Ga0207648_10069680
633 Ga0207676_10011078
634 Ga0207674_10004512
635 Ga0207674_10116979
636 Ga0207674_10175835
637 Ga0207674_10189600
638 Ga0207674_10570637
639 Ga0207675_100008902
640 Ga0207675_100086472
641 Ga0207675_100304442
642 Ga0207675_100410502
643 Ga0207683_10000535
644 Ga0207683_10049613
645 Ga0207683_10732987
646 Ga0207698_10121109
647 Ga0207698_10279234
648 Ga0207698_10493403
649 Ga0209969_1013460
650 Ga0209974_10014051
651 Ga0268266_10124101
652 Ga0268266_10147519
653 Ga0268266_10402479
654 Ga0268265_10012131
655 Ga0268265_10079380
656 Ga0268265_10136725
657 Ga0268265_10534307
658 Ga0268265_10564287
659 Ga0268264_10038113
660 Ga0268264_10080830
661 Ga0268264_10086279
662 Ga0265327_10040546
663 Ga0307408_100411471
664 Ga0307516_10216680
665 Ga0307413_10098889
666 Ga0307413_10336325
667 Ga0307410_10066381
668 Ga0307412_10559679
669 Ga0307414_10023661
670 Ga0307414_10218910
671 Ga0307414_10285969
672 Ga0307415_100079830
673 Ga0373923_0069019
674 Ga0373955_0061576
675 Ga0373924_0006355
676 Ga0373947_0047450
677 Ga0373937_0002054
678 Ga0395900_0163188
679 Ga0395900_0219095
680 Ga0395900_0510746
681 Ga0395898_0558286
682 Ga0395905_0002388
683 Ga0395905_0148041
684 Ga0451807_2161341
685 Ga0451853_2873042
686 Ga0450897_006616
687 Ga0450898_007508
688 Ga0450899_009980
689 Ga0439446_0038595
690 Ga0439434_0001225
691 Ga0451577_0440028
692 Ga0495653_0056965
693 Ga0495650_0059469
694 Ga0495618_0035182
695 Ga0495628_0014749
696 Ga0495630_0062399
697 Ga0495643_0029209
698 Ga0495640_0243881
699 Ga0495587_0032733
700 Ga0495598_0010464
701 Ga0495621_0024167
702 Ga0495621_0149501
703 Ga0495667_0031786
704 Ga0495634_0314845
705 Ga0495635_0064346
706 Ga0495659_0136108
707 Ga0495604_0115459
708 Ga0495686_0036372
709 Ga0496110_0317929
710 Ga0496114_0001763
711 Ga0501296_003466
712 Ga0501032_0030710
713 Ga0501034_0065838
714 Ga0501034_0283247
715 Ga0501034_0787239
716 Ga0501036_0023141
717 Ga0501036_0178988
718 Ga0501039_0624124
719 Ga0501043_0018214
720 Ga0501043_0508212
721 Ga0501046_0057508
722 Ga0501046_0111956
723 Ga0501047_0164795
724 Ga0501047_0626153
725 Ga0501070_0068713
726 Ga0501073_0444178
727 Ga0501074_0059192
728 Ga0501074_0485591
729 Ga0501198_002654
730 Ga0501233_021296
731 Ga0501221_014308
732 Ga0501079_0206498
733 Ga0501080_0369404
734 Ga0501080_0722563
735 Ga0501083_0003657
736 Ga0501266_007118
737 Ga0501279_011150
738 Ga0501035_0027193
739 Ga0501044_0002309
740 Ga0501044_0303442
741 Ga0500642_0022990
742 Ga0500568_0000606
743 Ga0500616_0001236
744 Ga0500627_0004766
745 2819588066
746 2929157938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

61

192

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.2949 31 211
2c23-assembly1.cif.gz_A-2 14-3-3 protein beta (human) in complex with exoenzyme s peptide 0.2744 49 179
5o0t-assembly1.cif.gz_A crystal structure of trans-membrane domain of cylindrospermum stagnale nadph-oxidase 5 (nox5) 0.2739 17 213
3h2v-assembly2.cif.gz_B human raver1 rrm1 domain in complex with human vinculin tail domain vt 0.2698 20 181
6fnb-assembly1.cif.gz_A mono- and bivalent 14-3-3 inhibitors for characterizing supramolecular lysine-peg interactions in proteins 0.2688 49 179
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6808 50 176 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6483 50 176 1.10.1760.20
af_Q9UT92_325_480_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4459 19 211 1.20.1250.20
af_P71616_238_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4454 17 212 1.20.1250.20
af_K7MLI3_277_440_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4295 19 189 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I3MTZ7-F1-model_v4 Membrane-associated protein 0.9373 19 221 GO:0005886
AF-A0A0B5RTQ8-F1-model_v4 deleted 0.9272 19 225
AF-A0A0T0M5E2-F1-model_v4 Alkaline phosphatase 0.9252 20 226 GO:0005886
AF-A0A7V3CTL6-F1-model_v4 DedA family protein 0.9192 19 221 GO:0005886
AF-A0A3C1LCQ2-F1-model_v4 VTT domain-containing protein 0.9161 20 224 GO:0005886

Map