F426479

General Info

Members Datasets Scaffolds Average Seq Length
373 264 746 292

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0029843|Ga0496109_0029843_20_1105
Length 354
Sequence MHEAGADDPFVVHRNLLFTVAYEMLGCAADAEDVLQETWLRWAGVDRSQVREPRAYLLRAVTRQCLNRLRTLARSREDYVGQWLPEPLLTGPGVAEDLELAESVSIAMLTVLETLAPIERAVFVLREVFDVPYAQIAEAVGKSAAAVRQIARRSREHVAARRPRMQVGRWERQAVTERFLTALDTGRLQDLLGVMARGVVLIADGGGIVSAVLEPVHGAAGVAPLLARARRVAGVLETAVVWLNGAPAGRIGFDGEPAAVGIGVRGGRVSRICVVRNPDRLRRLREPVSLARWRAVTGPVRTRQGHGCSCRGRPEMPSGRGRPFRSVMRWIFDPLLPRSVGFGPVKGPLLPPAG

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
245 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
251 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
252 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
253 2808606372 Agromyces sp. 23-23 Isolate Unclassified
254 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
255 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
256 2891562705 Microbispora tritici MT50 Isolate Unclassified
257 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
258 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
259 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
260 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
261 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
262 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
263 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
264 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.91
Metatranscriptomes 0.8
Isolates 4.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.75
Nodule 0.54
Rhizoplane 8.31
Rhizosphere 79.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0029843 3300048912 Bacteria 4887
2 JGI24740J21852_10002591 3300001979 Bacteria 8152
3 JGI25406J46586_10007773 3300003203 Bacteria 4877
4 JGI25406J46586_10009152 3300003203 Bacteria 4442
5 rootH2_10013079 3300003320 Bacteria 3541
6 Ga0006562J51391_1091491 3300003578 Bacteria 3460
7 Ga0006562J51391_1091492 3300003578 Bacteria 3460
8 Ga0070682_100086600 3300005337 Bacteria 2040
9 Ga0068868_100027953 3300005338 Bacteria 4307
10 Ga0070689_100016278 3300005340 Bacteria 5440
11 Ga0070674_100256184 3300005356 Bacteria 1376
12 Ga0070688_100027446 3300005365 Bacteria 3393
13 Ga0070709_10105035 3300005434 Bacteria 1888
14 Ga0070714_100049349 3300005435 Bacteria 3582
15 Ga0070714_100053473 3300005435 Bacteria 3447
16 Ga0070713_100099182 3300005436 Bacteria 2520
17 Ga0070710_10013150 3300005437 Bacteria 4135
18 Ga0070711_100036778 3300005439 Bacteria 3282
19 Ga0070700_100214649 3300005441 Bacteria 1360
20 Ga0070663_100227236 3300005455 Bacteria 1468
21 Ga0070678_100403029 3300005456 Bacteria 1189
22 Ga0068867_100093131 3300005459 Bacteria 2290
23 Ga0070685_10020808 3300005466 Bacteria 3556
24 Ga0070684_100051700 3300005535 Bacteria 3571
25 Ga0070686_100135536 3300005544 Bacteria 1708
26 Ga0068855_100227335 3300005563 Bacteria 2091
27 Ga0068854_100234276 3300005578 Bacteria 1459
28 Ga0068854_100294483 3300005578 Bacteria 1311
29 Ga0070702_100100285 3300005615 Bacteria 1775
30 Ga0070702_100179938 3300005615 Bacteria 1383
31 Ga0068852_100302507 3300005616 Bacteria 1549
32 Ga0068859_100134356 3300005617 Bacteria 2545
33 Ga0068864_100157616 3300005618 Bacteria 2062
34 Ga0068861_100134353 3300005719 Bacteria 2011
35 Ga0068861_100221747 3300005719 Bacteria 1599
36 Ga0068858_100117414 3300005842 Bacteria 2487
37 Ga0068860_100057363 3300005843 Bacteria 3702
38 Ga0068862_100336671 3300005844 Bacteria 1397
39 Ga0081539_10005818 3300005985 Bacteria 12255
40 Ga0081539_10081177 3300005985 Bacteria 1704
41 Ga0070717_10126415 3300006028 Bacteria 2195
42 Ga0070717_10136956 3300006028 Bacteria 2109
43 Ga0075363_100019514 3300006048 Bacteria 3390
44 Ga0075363_100046275 3300006048 Bacteria 2308
45 Ga0075364_10087965 3300006051 Bacteria 2059
46 Ga0070715_10066204 3300006163 Bacteria 1601
47 Ga0070716_100013525 3300006173 Bacteria 4160
48 Ga0075367_10026168 3300006178 Bacteria 3306
49 Ga0075367_10071543 3300006178 Bacteria 2086
50 Ga0075428_100214699 3300006844 Bacteria 2078
51 Ga0075430_100005395 3300006846 Bacteria 10799
52 Ga0075431_100000549 3300006847 Bacteria 31563
53 Ga0075434_100071600 3300006871 Bacteria 3458
54 Ga0075429_100000823 3300006880 Bacteria 24344
55 Ga0075429_100093381 3300006880 Bacteria 2624
56 Ga0097620_100134367 3300006931 Bacteria 2545
57 Ga0075435_100138760 3300007076 Bacteria 2038
58 Ga0111539_10089823 3300009094 Bacteria 3610
59 Ga0105245_10035252 3300009098 Bacteria 4440
60 Ga0114129_10203165 3300009147 Bacteria 2682
61 Ga0105243_10012505 3300009148 Bacteria 6418
62 Ga0105243_10038516 3300009148 Bacteria 3723
63 Ga0105242_10052959 3300009176 Bacteria 3313
64 Ga0105242_10227865 3300009176 Bacteria 1669
65 Ga0105248_10216036 3300009177 Bacteria 2159
66 Ga0105238_10297593 3300009551 Bacteria 1597
67 Ga0105249_10016403 3300009553 Bacteria 6572
68 Ga0105249_10059186 3300009553 Bacteria 3513
69 Ga0105028_102090 3300009993 Bacteria 2096
70 Ga0105246_10020946 3300011119 Bacteria 4200
71 Ga0105246_10200040 3300011119 Bacteria 1553
72 Ga0157370_10215483 3300013104 Bacteria 1779
73 Ga0157369_10215714 3300013105 Bacteria 2010
74 Ga0163162_10131049 3300013306 Bacteria 2616
75 Ga0157372_10162779 3300013307 Bacteria 2579
76 Ga0157375_10170240 3300013308 Bacteria 2325
77 Ga0157380_10166225 3300014326 Bacteria 1923
78 Ga0163161_10270899 3300017792 Bacteria 1329
79 Ga0163161_10307811 3300017792 Bacteria 1249
80 Ga0206354_11165691 3300020081 Bacteria 1506
81 Ga0213876_10172900 3300021384 Bacteria 1149
82 Ga0213875_10030223 3300021388 Bacteria 2566
83 Ga0207426_1030160 3300025302 Bacteria 1781
84 Ga0207692_10018891 3300025898 Bacteria 3103
85 Ga0207692_10102085 3300025898 Bacteria 1576
86 Ga0207688_10002722 3300025901 Bacteria 9568
87 Ga0207647_10048030 3300025904 Bacteria 2652
88 Ga0207699_10030944 3300025906 Bacteria 3001
89 Ga0207693_10006589 3300025915 Bacteria 9606
90 Ga0207663_10097855 3300025916 Bacteria 1963
91 Ga0207694_10286594 3300025924 Bacteria 1354
92 Ga0207700_10039396 3300025928 Bacteria 3440
93 Ga0207664_10054923 3300025929 Bacteria 3158
94 Ga0207664_10125855 3300025929 Bacteria 2151
95 Ga0207664_10186083 3300025929 Bacteria 1786
96 Ga0207664_10338848 3300025929 Bacteria 1329
97 Ga0207644_10028503 3300025931 Bacteria 3867
98 Ga0207690_10059875 3300025932 Bacteria 2581
99 Ga0207686_10238077 3300025934 Bacteria 1323
100 Ga0207709_10075458 3300025935 Bacteria 2155
101 Ga0207709_10132301 3300025935 Bacteria 1702
102 Ga0207670_10434679 3300025936 Bacteria 1056
103 Ga0207665_10007065 3300025939 Bacteria 7433
104 Ga0207711_10173916 3300025941 Bacteria 1955
105 Ga0207689_10024564 3300025942 Bacteria 5055
106 Ga0207679_10689727 3300025945 Bacteria 926
107 Ga0207712_10090463 3300025961 Bacteria 2252
108 Ga0207677_10092838 3300026023 Bacteria 2199
109 Ga0207703_10299672 3300026035 Bacteria 1466
110 Ga0207678_10120187 3300026067 Bacteria 2242
111 Ga0207708_10022406 3300026075 Bacteria 4770
112 Ga0207648_10047035 3300026089 Bacteria 3782
113 Ga0207676_10118834 3300026095 Bacteria 2225
114 Ga0207675_100026377 3300026118 Bacteria 5408
115 Ga0207675_100117601 3300026118 Bacteria 2513
116 Ga0207698_10042172 3300026142 Bacteria 3406
117 Ga0207698_10373951 3300026142 Bacteria 1353
118 Ga0209813_10007131 3300027866 Bacteria 2776
119 Ga0268266_10198968 3300028379 Bacteria 1833
120 Ga0268265_10210854 3300028380 Bacteria 1692
121 Ga0268265_10263995 3300028380 Bacteria 1532
122 Ga0307517_10003033 3300028786 Bacteria 26536
123 Ga0307515_10000025 3300028794 Bacteria 390205
124 Ga0307509_10000888 3300031507 Bacteria 51242
125 Ga0307509_10009107 3300031507 Bacteria 12482
126 Ga0307514_10131286 3300031649 Bacteria 1723
127 Ga0307518_10000373 3300031838 Bacteria 34211
128 Ga0307518_10006772 3300031838 Bacteria 8208
129 Ga0307416_100100659 3300032002 Bacteria 2514
130 Ga0307507_10094002 3300033179 Bacteria 2551
131 Ga0307510_10041263 3300033180 Bacteria 5050
132 Ga0307510_10291427 3300033180 Bacteria 1097
133 Ga0373930_0001681 3300034816 Bacteria 3351
134 Ga0373926_0000196 3300035083 Bacteria 13904
135 Ga0373934_0006238 3300035086 Bacteria 4418
136 Ga0373940_0031424 3300035088 Bacteria 1417
137 Ga0373944_0038039 3300035089 Bacteria 1476
138 Ga0373923_0044629 3300035111 Bacteria 1838
139 Ga0373936_0002904 3300035113 Bacteria 6398
140 Ga0373936_0015777 3300035113 Bacteria 2897
141 Ga0373945_0043100 3300035116 Bacteria 1636
142 Ga0373957_0005509 3300035120 Bacteria 3925
143 Ga0373960_0012988 3300035121 Bacteria 2080
144 Ga0373943_0024040 3300035170 Bacteria 2838
145 Ga0373946_0046288 3300035171 Bacteria 1802
146 Ga0373955_0018138 3300035172 Bacteria 3495
147 Ga0373924_0036760 3300035410 Bacteria 1991
148 Ga0373931_0025527 3300035691 Bacteria 3001
149 Ga0373927_0066223 3300035695 Bacteria 2336
150 Ga0373933_0005050 3300035724 Bacteria 7199
151 Ga0373933_0224612 3300035724 Bacteria 1205
152 Ga0373947_0011501 3300035725 Bacteria 5076
153 Ga0373937_0035121 3300036401 Bacteria 4560
154 Ga0373937_0070192 3300036401 Bacteria 3231
155 Ga0373925_0000266 3300037068 Bacteria 54534
156 Ga0395898_0001874 3300037466 Bacteria 26874
157 Ga0395898_0373562 3300037466 Bacteria 1360
158 Ga0395905_0194867 3300037471 Bacteria 1900
159 Ga0436364_0413335 3300037853 Bacteria 3215
160 Ga0436364_0764179 3300037853 Bacteria 57419
161 Ga0436364_0781320 3300037853 Bacteria 7507
162 Ga0395901_0006164 3300038443 Bacteria 12151
163 Ga0395901_0038825 3300038443 Bacteria 4925
164 Ga0436365_1688985 3300039437 Bacteria 5348
165 Ga0436362_0713907 3300039453 Bacteria 3466
166 Ga0439445_0021166 3300042004 Bacteria 1633
167 Ga0450903_001014 3300042138 Bacteria 5385
168 Ga0439458_0011676 3300042157 Bacteria 1965
169 Ga0466972_0028892 3300044658 Bacteria 2732
170 Ga0466965_0146501 3300044683 Bacteria 1232
171 Ga0466964_0077187 3300044706 Bacteria 1422
172 Ga0466971_0034229 3300044719 Bacteria 2277
173 Ga0466970_0000121 3300044765 Bacteria 35105
174 Ga0466970_0074653 3300044765 Bacteria 1825
175 Ga0466957_0057326 3300044842 Bacteria 2384
176 Ga0466959_0046782 3300045049 Bacteria 3184
177 Ga0466967_0032278 3300045976 Bacteria 4420
178 Ga0466967_0053582 3300045976 Bacteria 3546
179 Ga0466967_0058593 3300045976 Bacteria 3405
180 Ga0466967_0238892 3300045976 Bacteria 1732
181 Ga0466967_0601266 3300045976 Bacteria 1085
182 Ga0495617_033260 3300046452 Bacteria 1730
183 Ga0495592_0008660 3300046454 Bacteria 7639
184 Ga0495592_0041838 3300046454 Bacteria 3433
185 Ga0495603_0031613 3300046455 Bacteria 3186
186 Ga0495629_0001426 3300046459 Bacteria 18856
187 Ga0495629_0006135 3300046459 Bacteria 8928
188 Ga0495629_0007623 3300046459 Bacteria 7969
189 Ga0495629_0232342 3300046459 Bacteria 1271
190 Ga0495638_0068596 3300046460 Bacteria 2174
191 Ga0495641_0038334 3300046461 Bacteria 2239
192 Ga0495651_0013264 3300046462 Bacteria 6373
193 Ga0495651_0046038 3300046462 Bacteria 3377
194 Ga0495651_0079276 3300046462 Bacteria 2482
195 Ga0495653_0027753 3300046463 Bacteria 4531
196 Ga0495653_0045764 3300046463 Bacteria 3391
197 Ga0495582_0012887 3300046473 Bacteria 4607
198 Ga0495582_0062758 3300046473 Bacteria 2053
199 Ga0495664_0000965 3300046477 Bacteria 14789
200 Ga0495664_0010283 3300046477 Bacteria 5250
201 Ga0495664_0041514 3300046477 Bacteria 2722
202 Ga0495607_0030114 3300046501 Bacteria 3335
203 Ga0495583_0030074 3300046506 Bacteria 2650
204 Ga0495583_0068535 3300046506 Bacteria 1564
205 Ga0495606_0011253 3300046507 Bacteria 7321
206 Ga0495608_0007665 3300046511 Bacteria 7610
207 Ga0495608_0036666 3300046511 Bacteria 3300
208 Ga0495616_0018285 3300046513 Bacteria 3850
209 Ga0495618_0009237 3300046514 Bacteria 5953
210 Ga0495618_0261101 3300046514 Bacteria 1084
211 Ga0495628_0032855 3300046516 Bacteria 4186
212 Ga0495628_0039956 3300046516 Bacteria 3751
213 Ga0495628_0253437 3300046516 Bacteria 1313
214 Ga0495630_0013661 3300046517 Bacteria 5903
215 Ga0495631_0013317 3300046518 Bacteria 3994
216 Ga0495666_0007420 3300046526 Bacteria 5497
217 Ga0495652_0023437 3300046529 Bacteria 5471
218 Ga0495652_0090281 3300046529 Bacteria 2507
219 Ga0495652_0109451 3300046529 Bacteria 2224
220 Ga0495652_0184571 3300046529 Bacteria 1597
221 Ga0495665_0048478 3300046531 Bacteria 2252
222 Ga0495640_0047762 3300046533 Bacteria 2961
223 Ga0495586_0010101 3300046535 Bacteria 5024
224 Ga0495587_0011605 3300046536 Bacteria 5578
225 Ga0495587_0019749 3300046536 Bacteria 4167
226 Ga0495587_0133595 3300046536 Bacteria 1418
227 Ga0495609_0054882 3300046538 Bacteria 1768
228 Ga0495645_0022951 3300046543 Bacteria 4516
229 Ga0495622_0024418 3300046557 Bacteria 2822
230 Ga0495622_0084781 3300046557 Bacteria 1457
231 Ga0495633_0046181 3300046558 Bacteria 2061
232 Ga0495667_0006779 3300046559 Bacteria 7772
233 Ga0495667_0021377 3300046559 Bacteria 4366
234 Ga0495667_0068275 3300046559 Bacteria 2321
235 Ga0495668_0003889 3300046616 Bacteria 10902
236 Ga0495634_0004038 3300046642 Bacteria 11643
237 Ga0495634_0159374 3300046642 Bacteria 1423
238 Ga0495611_0061459 3300046648 Bacteria 1707
239 Ga0495625_0007184 3300046660 Bacteria 9762
240 Ga0495625_0088880 3300046660 Bacteria 2139
241 Ga0495635_0000682 3300046663 Bacteria 21852
242 Ga0495635_0013131 3300046663 Bacteria 5798
243 Ga0495635_0060320 3300046663 Bacteria 2607
244 Ga0495635_0176731 3300046663 Bacteria 1451
245 Ga0495588_0011306 3300046674 Bacteria 4184
246 Ga0495588_0089124 3300046674 Bacteria 1615
247 Ga0495657_0009464 3300046675 Bacteria 7378
248 Ga0495657_0034106 3300046675 Bacteria 3537
249 Ga0495623_0176488 3300046679 Bacteria 1244
250 Ga0495646_0000442 3300046680 Bacteria 21949
251 Ga0495646_0033965 3300046680 Bacteria 3170
252 Ga0495646_0105338 3300046680 Bacteria 1612
253 Ga0495613_0001704 3300046689 Bacteria 16729
254 Ga0495613_0070281 3300046689 Bacteria 2553
255 Ga0495624_0011129 3300046690 Bacteria 6190
256 Ga0495624_0127347 3300046690 Bacteria 1562
257 Ga0495671_0017729 3300046692 Bacteria 3787
258 Ga0495649_0172629 3300046694 Bacteria 1130
259 Ga0495589_0037697 3300046794 Bacteria 2421
260 Ga0495600_0011655 3300046809 Bacteria 5483
261 Ga0495600_0098534 3300046809 Bacteria 1905
262 Ga0495581_0031457 3300047315 Bacteria 3075
263 Ga0495604_0001259 3300047317 Bacteria 20728
264 Ga0495604_0029789 3300047317 Bacteria 4341
265 Ga0495604_0077075 3300047317 Bacteria 2506
266 Ga0495636_0096445 3300047318 Bacteria 1289
267 Ga0495674_0003201 3300047319 Bacteria 15901
268 Ga0495674_0062342 3300047319 Bacteria 3247
269 Ga0495674_0093968 3300047319 Bacteria 2559
270 Ga0495676_0027717 3300047321 Bacteria 4853
271 Ga0495676_0141117 3300047321 Bacteria 1726
272 Ga0495680_0006212 3300047322 Bacteria 11134
273 Ga0495680_0035726 3300047322 Bacteria 3999
274 Ga0495680_0100007 3300047322 Bacteria 2161
275 Ga0495687_000324 3300047443 Bacteria 62125
276 Ga0495687_003281 3300047443 Bacteria 11916
277 Ga0495687_098417 3300047443 Bacteria 1103
278 Ga0495675_0093682 3300047444 Bacteria 1884
279 Ga0495681_0001613 3300047470 Bacteria 16802
280 Ga0495684_0007227 3300047471 Bacteria 8619
281 Ga0495684_0074412 3300047471 Bacteria 2581
282 Ga0495593_0009400 3300047673 Bacteria 5673
283 Ga0495593_0025755 3300047673 Bacteria 3255
284 Ga0495602_0024915 3300048088 Bacteria 5798
285 Ga0495602_0028993 3300048088 Bacteria 5284
286 Ga0495602_0208991 3300048088 Bacteria 1483
287 Ga0495614_0001375 3300048089 Bacteria 10501
288 Ga0495626_0017225 3300048091 Bacteria 3655
289 Ga0496100_0074012 3300048903 Bacteria 2281
290 Ga0496100_0134288 3300048903 Bacteria 1746
291 Ga0496101_0078802 3300048904 Bacteria 2431
292 Ga0496102_0054119 3300048905 Bacteria 3659
293 Ga0496102_0110325 3300048905 Bacteria 2564
294 Ga0496104_0171639 3300048907 Bacteria 2079
295 Ga0496104_0369176 3300048907 Bacteria 1347
296 Ga0496105_0005659 3300048908 Bacteria 9509
297 Ga0496105_0020476 3300048908 Bacteria 5345
298 Ga0496105_0133417 3300048908 Bacteria 2046
299 Ga0496105_0386923 3300048908 Bacteria 1112
300 Ga0496106_0026922 3300048909 Bacteria 4282
301 Ga0496106_0045957 3300048909 Bacteria 3281
302 Ga0496106_0083375 3300048909 Bacteria 2458
303 Ga0496107_0107288 3300048910 Bacteria 2051
304 Ga0496108_0017244 3300048911 Bacteria 5906
305 Ga0496108_0032651 3300048911 Bacteria 4324
306 Ga0496109_0018486 3300048912 Bacteria 6123
307 Ga0496109_0064679 3300048912 Bacteria 3347
308 Ga0496110_0069525 3300048913 Bacteria 3118
309 Ga0496110_0119353 3300048913 Bacteria 2375
310 Ga0496111_0003730 3300048914 Bacteria 9486
311 Ga0496111_0276234 3300048914 Bacteria 1246
312 Ga0496112_0006739 3300048915 Bacteria 10118
313 Ga0496112_0054628 3300048915 Bacteria 3924
314 Ga0496112_0119351 3300048915 Bacteria 2607
315 Ga0496113_0044482 3300048916 Bacteria 3289
316 Ga0496113_0126322 3300048916 Bacteria 2003
317 Ga0496115_0017986 3300048918 Bacteria 5415
318 Ga0496115_0127544 3300048918 Bacteria 2096
319 Ga0501031_0000683 3300049568 Bacteria 20253
320 Ga0501032_0000291 3300049569 Bacteria 42013
321 Ga0501034_0003908 3300049571 Bacteria 16740
322 Ga0501034_0050806 3300049571 Bacteria 4181
323 Ga0501036_0001130 3300049572 Bacteria 20310
324 Ga0501037_0000280 3300049573 Bacteria 43512
325 Ga0501038_0000883 3300049574 Bacteria 26567
326 Ga0501039_0000382 3300049575 Bacteria 31795
327 Ga0501039_0051491 3300049575 Bacteria 3186
328 Ga0501040_0020589 3300049576 Bacteria 4397
329 Ga0501040_0254938 3300049576 Bacteria 1252
330 Ga0501042_0036336 3300049578 Bacteria 3494
331 Ga0501043_0001643 3300049579 Bacteria 19416
332 Ga0501046_0000442 3300049580 Bacteria 41660
333 Ga0501047_0002814 3300049581 Bacteria 16515
334 Ga0501048_0001572 3300049582 Bacteria 17352
335 Ga0501069_0000958 3300049585 Bacteria 13759
336 Ga0501070_0003700 3300049586 Bacteria 13210
337 Ga0501073_0001462 3300049589 Bacteria 17490
338 Ga0501074_0000718 3300049590 Bacteria 20753
339 Ga0501080_0001004 3300049742 Bacteria 23167
340 Ga0501083_0008115 3300049744 Bacteria 7425
341 Ga0501035_0002957 3300049822 Bacteria 16341
342 Ga0501044_0002104 3300049823 Bacteria 22907
343 Ga0501044_0240401 3300049823 Bacteria 1755
344 nmdc:mga03n38_145853_c1 3300050490 Bacteria 1187
345 nmdc:mga00v17_25720_c1 3300050491 Bacteria 3424
346 nmdc:mga04h51_72416_c1 3300050495 Bacteria 1206
347 nmdc:mga06r32_273820_c1 3300050510 Bacteria 1676
348 nmdc:mga0rr50_51405_c1 3300050513 Bacteria 3057
349 Ga0495612_0036030 3300053078 Bacteria 2007
350 Ga0495595_0007067 3300053084 Bacteria 4587
351 Ga0495619_0055764 3300053085 Bacteria 2618
352 Ga0500640_074631 3300053095 Bacteria 1449
353 Ga0500560_056748 3300053107 Bacteria 1268
354 Ga0500616_0001299 3300053153 Bacteria 24792
355 Ga0500633_0116504 3300053160 Bacteria 992
356 Ga0501084_0004796 3300054114 Bacteria 11057
357 Ga0466962_0025126 3300061719 Bacteria 2860
358 2676198920 2675902999 Bacteria 9438463
359 2774843498 2773857921 Bacteria 9435764
360 2808849114 2808606359 Bacteria 9866990
361 2808903487 2808606372 Bacteria 4649509
362 2856744340 2856741275 Bacteria 8096094
363 2873151574 2873151551 Bacteria 8625867
364 2873159172 2873151551 Bacteria 8625867
365 2891565906 2891562705 Bacteria 8039471
366 2915769764 2915768154 Bacteria 8424322
367 2919443962 2919443155 Bacteria 4072969
368 2946027144 2946024296 Bacteria 3508095
369 8008486511 8008485437 Bacteria 7198341
370 8025525580 8025524527 Bacteria 7197316
371 8033685075 8033684223 Bacteria 6906479
372 8045832943 8045830549 Bacteria 4444727
373 8056833460 8056829672 Bacteria 9045328
374 Ga0496109_0029843
375 JGI24740J21852_10002591
376 JGI25406J46586_10007773
377 JGI25406J46586_10009152
378 rootH2_10013079
379 Ga0006562J51391_1091491
380 Ga0006562J51391_1091492
381 Ga0070682_100086600
382 Ga0068868_100027953
383 Ga0070689_100016278
384 Ga0070674_100256184
385 Ga0070688_100027446
386 Ga0070709_10105035
387 Ga0070714_100049349
388 Ga0070714_100053473
389 Ga0070713_100099182
390 Ga0070710_10013150
391 Ga0070711_100036778
392 Ga0070700_100214649
393 Ga0070663_100227236
394 Ga0070678_100403029
395 Ga0068867_100093131
396 Ga0070685_10020808
397 Ga0070684_100051700
398 Ga0070686_100135536
399 Ga0068855_100227335
400 Ga0068854_100234276
401 Ga0068854_100294483
402 Ga0070702_100100285
403 Ga0070702_100179938
404 Ga0068852_100302507
405 Ga0068859_100134356
406 Ga0068864_100157616
407 Ga0068861_100134353
408 Ga0068861_100221747
409 Ga0068858_100117414
410 Ga0068860_100057363
411 Ga0068862_100336671
412 Ga0081539_10005818
413 Ga0081539_10081177
414 Ga0070717_10126415
415 Ga0070717_10136956
416 Ga0075363_100019514
417 Ga0075363_100046275
418 Ga0075364_10087965
419 Ga0070715_10066204
420 Ga0070716_100013525
421 Ga0075367_10026168
422 Ga0075367_10071543
423 Ga0075428_100214699
424 Ga0075430_100005395
425 Ga0075431_100000549
426 Ga0075434_100071600
427 Ga0075429_100000823
428 Ga0075429_100093381
429 Ga0097620_100134367
430 Ga0075435_100138760
431 Ga0111539_10089823
432 Ga0105245_10035252
433 Ga0114129_10203165
434 Ga0105243_10012505
435 Ga0105243_10038516
436 Ga0105242_10052959
437 Ga0105242_10227865
438 Ga0105248_10216036
439 Ga0105238_10297593
440 Ga0105249_10016403
441 Ga0105249_10059186
442 Ga0105028_102090
443 Ga0105246_10020946
444 Ga0105246_10200040
445 Ga0157370_10215483
446 Ga0157369_10215714
447 Ga0163162_10131049
448 Ga0157372_10162779
449 Ga0157375_10170240
450 Ga0157380_10166225
451 Ga0163161_10270899
452 Ga0163161_10307811
453 Ga0206354_11165691
454 Ga0213876_10172900
455 Ga0213875_10030223
456 Ga0207426_1030160
457 Ga0207692_10018891
458 Ga0207692_10102085
459 Ga0207688_10002722
460 Ga0207647_10048030
461 Ga0207699_10030944
462 Ga0207693_10006589
463 Ga0207663_10097855
464 Ga0207694_10286594
465 Ga0207700_10039396
466 Ga0207664_10054923
467 Ga0207664_10125855
468 Ga0207664_10186083
469 Ga0207664_10338848
470 Ga0207644_10028503
471 Ga0207690_10059875
472 Ga0207686_10238077
473 Ga0207709_10075458
474 Ga0207709_10132301
475 Ga0207670_10434679
476 Ga0207665_10007065
477 Ga0207711_10173916
478 Ga0207689_10024564
479 Ga0207679_10689727
480 Ga0207712_10090463
481 Ga0207677_10092838
482 Ga0207703_10299672
483 Ga0207678_10120187
484 Ga0207708_10022406
485 Ga0207648_10047035
486 Ga0207676_10118834
487 Ga0207675_100026377
488 Ga0207675_100117601
489 Ga0207698_10042172
490 Ga0207698_10373951
491 Ga0209813_10007131
492 Ga0268266_10198968
493 Ga0268265_10210854
494 Ga0268265_10263995
495 Ga0307517_10003033
496 Ga0307515_10000025
497 Ga0307509_10000888
498 Ga0307509_10009107
499 Ga0307514_10131286
500 Ga0307518_10000373
501 Ga0307518_10006772
502 Ga0307416_100100659
503 Ga0307507_10094002
504 Ga0307510_10041263
505 Ga0307510_10291427
506 Ga0373930_0001681
507 Ga0373926_0000196
508 Ga0373934_0006238
509 Ga0373940_0031424
510 Ga0373944_0038039
511 Ga0373923_0044629
512 Ga0373936_0002904
513 Ga0373936_0015777
514 Ga0373945_0043100
515 Ga0373957_0005509
516 Ga0373960_0012988
517 Ga0373943_0024040
518 Ga0373946_0046288
519 Ga0373955_0018138
520 Ga0373924_0036760
521 Ga0373931_0025527
522 Ga0373927_0066223
523 Ga0373933_0005050
524 Ga0373933_0224612
525 Ga0373947_0011501
526 Ga0373937_0035121
527 Ga0373937_0070192
528 Ga0373925_0000266
529 Ga0395898_0001874
530 Ga0395898_0373562
531 Ga0395905_0194867
532 Ga0436364_0413335
533 Ga0436364_0764179
534 Ga0436364_0781320
535 Ga0395901_0006164
536 Ga0395901_0038825
537 Ga0436365_1688985
538 Ga0436362_0713907
539 Ga0439445_0021166
540 Ga0450903_001014
541 Ga0439458_0011676
542 Ga0466972_0028892
543 Ga0466965_0146501
544 Ga0466964_0077187
545 Ga0466971_0034229
546 Ga0466970_0000121
547 Ga0466970_0074653
548 Ga0466957_0057326
549 Ga0466959_0046782
550 Ga0466967_0032278
551 Ga0466967_0053582
552 Ga0466967_0058593
553 Ga0466967_0238892
554 Ga0466967_0601266
555 Ga0495617_033260
556 Ga0495592_0008660
557 Ga0495592_0041838
558 Ga0495603_0031613
559 Ga0495629_0001426
560 Ga0495629_0006135
561 Ga0495629_0007623
562 Ga0495629_0232342
563 Ga0495638_0068596
564 Ga0495641_0038334
565 Ga0495651_0013264
566 Ga0495651_0046038
567 Ga0495651_0079276
568 Ga0495653_0027753
569 Ga0495653_0045764
570 Ga0495582_0012887
571 Ga0495582_0062758
572 Ga0495664_0000965
573 Ga0495664_0010283
574 Ga0495664_0041514
575 Ga0495607_0030114
576 Ga0495583_0030074
577 Ga0495583_0068535
578 Ga0495606_0011253
579 Ga0495608_0007665
580 Ga0495608_0036666
581 Ga0495616_0018285
582 Ga0495618_0009237
583 Ga0495618_0261101
584 Ga0495628_0032855
585 Ga0495628_0039956
586 Ga0495628_0253437
587 Ga0495630_0013661
588 Ga0495631_0013317
589 Ga0495666_0007420
590 Ga0495652_0023437
591 Ga0495652_0090281
592 Ga0495652_0109451
593 Ga0495652_0184571
594 Ga0495665_0048478
595 Ga0495640_0047762
596 Ga0495586_0010101
597 Ga0495587_0011605
598 Ga0495587_0019749
599 Ga0495587_0133595
600 Ga0495609_0054882
601 Ga0495645_0022951
602 Ga0495622_0024418
603 Ga0495622_0084781
604 Ga0495633_0046181
605 Ga0495667_0006779
606 Ga0495667_0021377
607 Ga0495667_0068275
608 Ga0495668_0003889
609 Ga0495634_0004038
610 Ga0495634_0159374
611 Ga0495611_0061459
612 Ga0495625_0007184
613 Ga0495625_0088880
614 Ga0495635_0000682
615 Ga0495635_0013131
616 Ga0495635_0060320
617 Ga0495635_0176731
618 Ga0495588_0011306
619 Ga0495588_0089124
620 Ga0495657_0009464
621 Ga0495657_0034106
622 Ga0495623_0176488
623 Ga0495646_0000442
624 Ga0495646_0033965
625 Ga0495646_0105338
626 Ga0495613_0001704
627 Ga0495613_0070281
628 Ga0495624_0011129
629 Ga0495624_0127347
630 Ga0495671_0017729
631 Ga0495649_0172629
632 Ga0495589_0037697
633 Ga0495600_0011655
634 Ga0495600_0098534
635 Ga0495581_0031457
636 Ga0495604_0001259
637 Ga0495604_0029789
638 Ga0495604_0077075
639 Ga0495636_0096445
640 Ga0495674_0003201
641 Ga0495674_0062342
642 Ga0495674_0093968
643 Ga0495676_0027717
644 Ga0495676_0141117
645 Ga0495680_0006212
646 Ga0495680_0035726
647 Ga0495680_0100007
648 Ga0495687_000324
649 Ga0495687_003281
650 Ga0495687_098417
651 Ga0495675_0093682
652 Ga0495681_0001613
653 Ga0495684_0007227
654 Ga0495684_0074412
655 Ga0495593_0009400
656 Ga0495593_0025755
657 Ga0495602_0024915
658 Ga0495602_0028993
659 Ga0495602_0208991
660 Ga0495614_0001375
661 Ga0495626_0017225
662 Ga0496100_0074012
663 Ga0496100_0134288
664 Ga0496101_0078802
665 Ga0496102_0054119
666 Ga0496102_0110325
667 Ga0496104_0171639
668 Ga0496104_0369176
669 Ga0496105_0005659
670 Ga0496105_0020476
671 Ga0496105_0133417
672 Ga0496105_0386923
673 Ga0496106_0026922
674 Ga0496106_0045957
675 Ga0496106_0083375
676 Ga0496107_0107288
677 Ga0496108_0017244
678 Ga0496108_0032651
679 Ga0496109_0018486
680 Ga0496109_0064679
681 Ga0496110_0069525
682 Ga0496110_0119353
683 Ga0496111_0003730
684 Ga0496111_0276234
685 Ga0496112_0006739
686 Ga0496112_0054628
687 Ga0496112_0119351
688 Ga0496113_0044482
689 Ga0496113_0126322
690 Ga0496115_0017986
691 Ga0496115_0127544
692 Ga0501031_0000683
693 Ga0501032_0000291
694 Ga0501034_0003908
695 Ga0501034_0050806
696 Ga0501036_0001130
697 Ga0501037_0000280
698 Ga0501038_0000883
699 Ga0501039_0000382
700 Ga0501039_0051491
701 Ga0501040_0020589
702 Ga0501040_0254938
703 Ga0501042_0036336
704 Ga0501043_0001643
705 Ga0501046_0000442
706 Ga0501047_0002814
707 Ga0501048_0001572
708 Ga0501069_0000958
709 Ga0501070_0003700
710 Ga0501073_0001462
711 Ga0501074_0000718
712 Ga0501080_0001004
713 Ga0501083_0008115
714 Ga0501035_0002957
715 Ga0501044_0002104
716 Ga0501044_0240401
717 nmdc:mga03n38_145853_c1
718 nmdc:mga00v17_25720_c1
719 nmdc:mga04h51_72416_c1
720 nmdc:mga06r32_273820_c1
721 nmdc:mga0rr50_51405_c1
722 Ga0495612_0036030
723 Ga0495595_0007067
724 Ga0495619_0055764
725 Ga0500640_074631
726 Ga0500560_056748
727 Ga0500616_0001299
728 Ga0500633_0116504
729 Ga0501084_0004796
730 Ga0466962_0025126
731 2676198920
732 2774843498
733 2808849114
734 2808903487
735 2856744340
736 2873151574
737 2873159172
738 2891565906
739 2915769764
740 2919443962
741 2946027144
742 8008486511
743 8025525580
744 8033685075
745 8045832943
746 8056833460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

105

158

0.95

PF04545

Sigma70_r4

Sigma-70, region 4

111

160

0.94

PF04542

Sigma70_r2

Sigma-70 region 2

10

75

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9396 111 163
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9387 111 161
8d8k-assembly1.cif.gz_6 yeast mitochondrial small subunit assembly intermediate (state 2) 0.917 119 159
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.8711 118 159
1ku3-assembly1.cif.gz_A crystal structure of thermus aquaticus rna polymerase sigma subunit fragment, region 4 0.867 113 164
ID Description Score Start End Superfamily
3vepE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9014 108 161 1.10.10.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9006 108 161 1.10.10.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8988 108 161 1.10.10.10
af_P9WGH9_17_102_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.8928 14 77 1.10.1740.10
af_K7KHD7_484_564_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.878 102 161 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6B2T2Y3-F1-model_v4 RNA polymerase subunit sigma-24 0.9139 178 288 GO:0016987
AF-A0A059W762-F1-model_v4 deleted 0.91 198 298
AF-A0A059W762-F1-model_v4 deleted 0.8849 198 298
AF-A0A1C4U1H3-F1-model_v4 RNA polymerase sigma-70 factor, ECF subfamily 0.8784 198 290 GO:0016987
AF-A0A854Q2L1-F1-model_v4 deleted 0.8766 166 292

Map