F426464

General Info

Members Datasets Scaffolds Average Seq Length
373 260 746 203

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0189367|Ga0495610_0189367_104_727
Length 207
Sequence MMQPFNDATRRNIAERCAAFARREPGELTGLKPAAVAIALVEAGDGGTALLLTLRAAGLRAHSSQWALPGGRCDAGETPVEAALRELHEELGLELRPDDVLGTLDDYPTRSGYLITPVVTWAADSANLIPNPAEVRSVHRIALTDVEQPDAFDFVTIPQSERRVIRFRHAGQHIHAPTAALIYQFREVLAGRDTRVSELEQPVFAWK

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
158 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
240 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
243 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
244 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
245 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
246 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
247 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
248 2791355199
249 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
250 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
251 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
252 2906610324
253 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
254 2922425934
255 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
256 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
257 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
258 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
259 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
260 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 0
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 2.95
Rhizoplane 8.85
Rhizosphere 69.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0189367 3300046512 Bacteria 850
2 Ga0070658_10163965 3300005327 Bacteria 1865
3 Ga0070683_100619274 3300005329 Bacteria 1036
4 Ga0068869_100104866 3300005334 Bacteria 2143
5 Ga0070666_10380118 3300005335 Bacteria 1014
6 Ga0070680_100400732 3300005336 Bacteria 1169
7 Ga0070682_100410517 3300005337 Bacteria 1026
8 Ga0070660_100016881 3300005339 Bacteria 5310
9 Ga0070660_100038402 3300005339 Bacteria 3635
10 Ga0070660_100962315 3300005339 Bacteria 721
11 Ga0070689_100402274 3300005340 Bacteria 1158
12 Ga0070691_10032139 3300005341 Bacteria 2465
13 Ga0070687_100105033 3300005343 Bacteria 1589
14 Ga0070668_100181126 3300005347 Bacteria 1721
15 Ga0070668_100321579 3300005347 Bacteria 1303
16 Ga0070668_100416608 3300005347 Bacteria 1150
17 Ga0070674_100231985 3300005356 Bacteria 1441
18 Ga0070673_100373136 3300005364 Bacteria 1270
19 Ga0070659_100125787 3300005366 Bacteria 2079
20 Ga0070667_100244612 3300005367 Bacteria 1603
21 Ga0070667_100287568 3300005367 Bacteria 1477
22 Ga0070713_100082138 3300005436 Bacteria 2751
23 Ga0070711_100674168 3300005439 Bacteria 869
24 Ga0070700_100042091 3300005441 Bacteria 2803
25 Ga0070700_100237163 3300005441 Bacteria 1301
26 Ga0070708_101050738 3300005445 Bacteria 763
27 Ga0070663_100008024 3300005455 Bacteria 6470
28 Ga0070663_100047491 3300005455 Bacteria 3041
29 Ga0070663_100167809 3300005455 Bacteria 1694
30 Ga0070678_100226535 3300005456 Bacteria 1556
31 Ga0070678_100339247 3300005456 Bacteria 1289
32 Ga0070678_100716558 3300005456 Bacteria 903
33 Ga0070681_10228031 3300005458 Bacteria 1777
34 Ga0068867_100119677 3300005459 Bacteria 2033
35 Ga0070684_100012031 3300005535 Bacteria 6917
36 Ga0070697_100008732 3300005536 Bacteria 7911
37 Ga0068853_100006712 3300005539 Bacteria 9170
38 Ga0068853_100219638 3300005539 Bacteria 1735
39 Ga0070672_100028397 3300005543 Bacteria 4184
40 Ga0070686_100052605 3300005544 Bacteria 2597
41 Ga0070665_100737077 3300005548 Bacteria 998
42 Ga0070665_101232723 3300005548 Bacteria 758
43 Ga0070664_100230584 3300005564 Bacteria 1660
44 Ga0070702_100025267 3300005615 Bacteria 3181
45 Ga0068852_100027939 3300005616 Bacteria 4608
46 Ga0068859_100054600 3300005617 Bacteria 4018
47 Ga0068864_100602070 3300005618 Bacteria 1067
48 Ga0068866_10208207 3300005718 Bacteria 1172
49 Ga0068861_100147202 3300005719 Bacteria 1928
50 Ga0068851_10039804 3300005834 Bacteria 2361
51 Ga0068863_100208045 3300005841 Bacteria 1883
52 Ga0068858_100290918 3300005842 Bacteria 1557
53 Ga0068860_100001737 3300005843 Bacteria 23226
54 Ga0068860_100490499 3300005843 Bacteria 1225
55 Ga0068862_100141010 3300005844 Bacteria 2139
56 Ga0081540_1045522 3300005983 Bacteria 2227
57 Ga0075365_10188348 3300006038 Bacteria 1444
58 Ga0075368_10039242 3300006042 Bacteria 1855
59 Ga0075363_100001722 3300006048 Bacteria 8505
60 Ga0070715_10159402 3300006163 Bacteria 1114
61 Ga0070716_100291370 3300006173 Bacteria 1131
62 Ga0070712_100180477 3300006175 Bacteria 1644
63 Ga0075367_10041655 3300006178 Bacteria 2685
64 Ga0075370_10017848 3300006353 Bacteria 3839
65 Ga0075428_100502939 3300006844 Bacteria 1297
66 Ga0075430_100140450 3300006846 Bacteria 2012
67 Ga0097620_100054600 3300006931 Bacteria 4018
68 Ga0099794_10066350 3300007265 Bacteria 1761
69 Ga0099794_10175569 3300007265 Bacteria 1093
70 Ga0099795_10007335 3300007788 Bacteria 3070
71 Ga0105250_10094233 3300009092 Bacteria 1220
72 Ga0105240_10033572 3300009093 Bacteria 6626
73 Ga0111539_10508493 3300009094 Bacteria 1403
74 Ga0105245_10420985 3300009098 Bacteria 1339
75 Ga0105245_10486844 3300009098 Bacteria 1248
76 Ga0105245_10719236 3300009098 Bacteria 1033
77 Ga0105247_10057488 3300009101 Bacteria 2405
78 Ga0105247_10123538 3300009101 Bacteria 1680
79 Ga0105247_10282157 3300009101 Bacteria 1146
80 Ga0114129_10126190 3300009147 Bacteria 3518
81 Ga0105243_10028125 3300009148 Bacteria 4313
82 Ga0105241_10208981 3300009174 Bacteria 1634
83 Ga0105242_10241218 3300009176 Bacteria 1625
84 Ga0105237_10009459 3300009545 Bacteria 10438
85 Ga0105237_10030745 3300009545 Bacteria 5451
86 Ga0105237_10133559 3300009545 Bacteria 2477
87 Ga0105237_10225636 3300009545 Bacteria 1874
88 Ga0105238_10009011 3300009551 Bacteria 9983
89 Ga0105249_10509768 3300009553 Bacteria 1249
90 Ga0105249_10704255 3300009553 Bacteria 1070
91 Ga0105249_10898425 3300009553 Bacteria 953
92 Ga0099796_10128973 3300010159 Bacteria 979
93 Ga0105239_10077224 3300010375 Bacteria 3665
94 Ga0105239_10113115 3300010375 Bacteria 3010
95 Ga0105239_11819642 3300010375 Bacteria 706
96 Ga0157370_10027020 3300013104 Bacteria 5661
97 Ga0157370_10534926 3300013104 Bacteria 1075
98 Ga0157369_10042613 3300013105 Bacteria 4951
99 Ga0157374_10328543 3300013296 Bacteria 1516
100 Ga0163162_10229379 3300013306 Bacteria 1987
101 Ga0163162_10829220 3300013306 Bacteria 1041
102 Ga0157372_10014953 3300013307 Bacteria 8308
103 Ga0157375_10966248 3300013308 Bacteria 993
104 Ga0163163_10012790 3300014325 Bacteria 7659
105 Ga0163163_10033422 3300014325 Bacteria 4975
106 Ga0157377_10253920 3300014745 Bacteria 1141
107 Ga0157379_10058491 3300014968 Bacteria 3447
108 Ga0157379_10324745 3300014968 Bacteria 1405
109 Ga0157379_10416391 3300014968 Bacteria 1237
110 Ga0157376_10141262 3300014969 Bacteria 2161
111 Ga0163161_10029435 3300017792 Bacteria 3905
112 Ga0163161_10148914 3300017792 Bacteria 1777
113 Ga0209455_1018205 3300025272 Bacteria 1450
114 Ga0207710_10031369 3300025900 Bacteria 2324
115 Ga0207710_10197616 3300025900 Bacteria 992
116 Ga0207688_10089106 3300025901 Bacteria 1770
117 Ga0207688_10228878 3300025901 Bacteria 1122
118 Ga0207680_10265971 3300025903 Bacteria 1188
119 Ga0207699_11018399 3300025906 Bacteria 612
120 Ga0207705_10097801 3300025909 Bacteria 2156
121 Ga0207654_10312078 3300025911 Bacteria 1072
122 Ga0207707_10000772 3300025912 Bacteria 31487
123 Ga0207671_10096691 3300025914 Bacteria 2232
124 Ga0207671_10133252 3300025914 Bacteria 1909
125 Ga0207671_10414707 3300025914 Bacteria 1071
126 Ga0207693_10012185 3300025915 Bacteria 6946
127 Ga0207663_10043696 3300025916 Bacteria 2746
128 Ga0207662_10116437 3300025918 Bacteria 1671
129 Ga0207657_10006315 3300025919 Bacteria 12312
130 Ga0207657_10467814 3300025919 Bacteria 989
131 Ga0207652_10017663 3300025921 Bacteria 5840
132 Ga0207646_10100188 3300025922 Bacteria 2597
133 Ga0207681_10293500 3300025923 Bacteria 1284
134 Ga0207687_10007501 3300025927 Bacteria 7173
135 Ga0207687_10336581 3300025927 Bacteria 1226
136 Ga0207700_10161408 3300025928 Bacteria 1862
137 Ga0207644_10400653 3300025931 Bacteria 1122
138 Ga0207690_10305415 3300025932 Bacteria 1246
139 Ga0207706_10010878 3300025933 Bacteria 8301
140 Ga0207686_10117835 3300025934 Bacteria 1802
141 Ga0207709_10005272 3300025935 Bacteria 7351
142 Ga0207670_10404373 3300025936 Bacteria 1092
143 Ga0207669_10015222 3300025937 Bacteria 3874
144 Ga0207669_10221913 3300025937 Bacteria 1388
145 Ga0207704_10062844 3300025938 Bacteria 2311
146 Ga0207704_10706472 3300025938 Bacteria 835
147 Ga0207665_10336846 3300025939 Bacteria 1136
148 Ga0207665_10641078 3300025939 Bacteria 832
149 Ga0207691_10060364 3300025940 Bacteria 3445
150 Ga0207711_10875555 3300025941 Bacteria 835
151 Ga0207689_10181871 3300025942 Bacteria 1733
152 Ga0207667_10014461 3300025949 Bacteria 8997
153 Ga0207651_10119395 3300025960 Bacteria 1996
154 Ga0207712_10379191 3300025961 Bacteria 1183
155 Ga0207712_10640859 3300025961 Bacteria 923
156 Ga0207668_10163875 3300025972 Bacteria 1735
157 Ga0207668_10572947 3300025972 Bacteria 980
158 Ga0207640_10205392 3300025981 Bacteria 1496
159 Ga0207658_10172295 3300025986 Bacteria 1784
160 Ga0207677_11145594 3300026023 Bacteria 710
161 Ga0207703_10089268 3300026035 Bacteria 2588
162 Ga0207639_10031182 3300026041 Bacteria 3916
163 Ga0207678_10000808 3300026067 Bacteria 28722
164 Ga0207678_10083034 3300026067 Bacteria 2740
165 Ga0207678_10106245 3300026067 Bacteria 2395
166 Ga0207678_10110247 3300026067 Bacteria 2348
167 Ga0207678_10689455 3300026067 Bacteria 899
168 Ga0207708_10325166 3300026075 Bacteria 1256
169 Ga0207708_10573229 3300026075 Bacteria 954
170 Ga0207641_10858022 3300026088 Bacteria 900
171 Ga0207648_10255809 3300026089 Bacteria 1562
172 Ga0207648_10373939 3300026089 Bacteria 1287
173 Ga0207676_10532866 3300026095 Bacteria 1120
174 Ga0207676_10612930 3300026095 Bacteria 1047
175 Ga0207674_10078005 3300026116 Bacteria 3318
176 Ga0207675_100059521 3300026118 Bacteria 3564
177 Ga0207675_100503037 3300026118 Bacteria 1206
178 Ga0207683_10370609 3300026121 Bacteria 1316
179 Ga0207683_10413251 3300026121 Bacteria 1242
180 Ga0207683_10497221 3300026121 Bacteria 1126
181 Ga0207698_10524797 3300026142 Bacteria 1156
182 Ga0209813_10013977 3300027866 Bacteria 2153
183 Ga0207428_10446772 3300027907 Bacteria 943
184 Ga0268266_10000936 3300028379 Bacteria 37196
185 Ga0268265_10057596 3300028380 Bacteria 2962
186 Ga0268265_10513228 3300028380 Bacteria 1131
187 Ga0268265_10538445 3300028380 Bacteria 1106
188 Ga0268264_10000051 3300028381 Bacteria 321565
189 Ga0268264_10363990 3300028381 Bacteria 1380
190 Ga0265329_10067330 3300031242 Bacteria 1133
191 Ga0265340_10094664 3300031247 Bacteria 1393
192 Ga0307509_10009503 3300031507 Bacteria 12134
193 Ga0307509_10188874 3300031507 Bacteria 1914
194 Ga0307509_10339864 3300031507 Bacteria 1229
195 Ga0307508_10436424 3300031616 Bacteria 901
196 Ga0307516_10054397 3300031730 Bacteria 3911
197 Ga0307516_10215694 3300031730 Bacteria 1631
198 Ga0307507_10116754 3300033179 Bacteria 2154
199 Ga0307510_10008288 3300033180 Bacteria 12388
200 Ga0373951_0109829 3300035091 Bacteria 741
201 Ga0373945_0131498 3300035116 Bacteria 1003
202 Ga0373957_0005728 3300035120 Bacteria 3871
203 Ga0373957_0144023 3300035120 Bacteria 976
204 Ga0373943_0148149 3300035170 Bacteria 1270
205 Ga0373943_0196546 3300035170 Bacteria 1115
206 Ga0373946_0137726 3300035171 Bacteria 1129
207 Ga0373955_0373124 3300035172 Bacteria 865
208 Ga0373924_0157371 3300035410 Bacteria 996
209 Ga0373931_0378041 3300035691 Bacteria 892
210 Ga0373935_0032619 3300035692 Bacteria 3236
211 Ga0373935_0132175 3300035692 Bacteria 1678
212 Ga0373935_0311789 3300035692 Bacteria 1114
213 Ga0373927_0045319 3300035695 Bacteria 2845
214 Ga0373927_0061369 3300035695 Bacteria 2432
215 Ga0373927_0102649 3300035695 Bacteria 1860
216 Ga0373927_0285636 3300035695 Bacteria 1085
217 Ga0373933_0090767 3300035724 Bacteria 1885
218 Ga0373947_0093596 3300035725 Bacteria 1878
219 Ga0373925_0052973 3300037068 Bacteria 3032
220 Ga0373925_0098257 3300037068 Bacteria 2246
221 Ga0395905_0085268 3300037471 Bacteria 2960
222 Ga0395905_0360044 3300037471 Bacteria 1347
223 Ga0436365_0349419 3300039437 Bacteria 1495
224 Ga0451800_1605265 3300041459 Bacteria 980
225 Ga0451837_1230920 3300041494 Bacteria 847
226 Ga0439432_083826 3300042006 Bacteria 964
227 Ga0466972_0000136 3300044658 Bacteria 60410
228 Ga0466959_0242343 3300045049 Bacteria 1245
229 Ga0466967_0023086 3300045976 Bacteria 5092
230 Ga0495592_0319147 3300046454 Bacteria 1004
231 Ga0495603_0005899 3300046455 Bacteria 7321
232 Ga0495603_0019452 3300046455 Bacteria 4109
233 Ga0495603_0188081 3300046455 Bacteria 1194
234 Ga0495629_0371082 3300046459 Bacteria 974
235 Ga0495638_0126961 3300046460 Bacteria 1502
236 Ga0495638_0258281 3300046460 Bacteria 957
237 Ga0495651_0039759 3300046462 Bacteria 3660
238 Ga0495651_0192821 3300046462 Bacteria 1432
239 Ga0495653_0151549 3300046463 Bacteria 1619
240 Ga0495582_0519092 3300046473 Bacteria 689
241 Ga0495639_0063300 3300046475 Bacteria 1698
242 Ga0495664_0237002 3300046477 Bacteria 1104
243 Ga0495584_0064540 3300046491 Bacteria 1841
244 Ga0495594_0086222 3300046499 Bacteria 1757
245 Ga0495606_0010481 3300046507 Bacteria 7684
246 Ga0495606_0140661 3300046507 Bacteria 1426
247 Ga0495618_0239296 3300046514 Bacteria 1141
248 Ga0495630_0145284 3300046517 Bacteria 1804
249 Ga0495644_0030162 3300046523 Bacteria 2048
250 Ga0495644_0076091 3300046523 Bacteria 1264
251 Ga0495652_0430395 3300046529 Bacteria 928
252 Ga0495652_0556797 3300046529 Bacteria 788
253 Ga0495640_0054605 3300046533 Bacteria 2735
254 Ga0495586_0119962 3300046535 Bacteria 1469
255 Ga0495587_0036166 3300046536 Bacteria 2971
256 Ga0495598_0003337 3300046537 Bacteria 3401
257 Ga0495609_0122189 3300046538 Bacteria 1119
258 Ga0495597_0365378 3300046542 Bacteria 552
259 Ga0495622_0018960 3300046557 Bacteria 3205
260 Ga0495656_0012214 3300046615 Bacteria 3164
261 Ga0495625_0231446 3300046660 Bacteria 1207
262 Ga0495635_0491453 3300046663 Bacteria 808
263 Ga0495657_0038230 3300046675 Bacteria 3304
264 Ga0495658_0155861 3300046683 Bacteria 1406
265 Ga0495658_0285083 3300046683 Bacteria 1043
266 Ga0495658_0332106 3300046683 Bacteria 965
267 Ga0495669_0012886 3300046684 Bacteria 3559
268 Ga0495671_0118995 3300046692 Bacteria 1289
269 Ga0495649_0193338 3300046694 Bacteria 1059
270 Ga0495674_0570070 3300047319 Bacteria 899
271 Ga0495676_0121681 3300047321 Bacteria 1897
272 Ga0495675_0089981 3300047444 Bacteria 1926
273 Ga0495677_0015899 3300047445 Bacteria 2732
274 Ga0495677_0062240 3300047445 Bacteria 1385
275 Ga0495673_0014126 3300047469 Bacteria 4162
276 Ga0495673_0079414 3300047469 Bacteria 1362
277 Ga0495684_0126499 3300047471 Bacteria 1922
278 Ga0496100_0124877 3300048903 Bacteria 1805
279 Ga0496101_0101745 3300048904 Bacteria 2151
280 Ga0496101_0151295 3300048904 Bacteria 1775
281 Ga0496102_0086026 3300048905 Bacteria 2903
282 Ga0496104_0012329 3300048907 Bacteria 7684
283 Ga0496104_0060885 3300048907 Bacteria 3577
284 Ga0496104_1053325 3300048907 Bacteria 717
285 Ga0496104_1368751 3300048907 Bacteria 611
286 Ga0496105_0051631 3300048908 Bacteria 3397
287 Ga0496105_0314687 3300048908 Bacteria 1256
288 Ga0496106_0015784 3300048909 Bacteria 5586
289 Ga0496106_0045769 3300048909 Bacteria 3287
290 Ga0496106_0142450 3300048909 Bacteria 1886
291 Ga0496106_0146923 3300048909 Bacteria 1858
292 Ga0496106_0391758 3300048909 Bacteria 1116
293 Ga0496106_0429644 3300048909 Bacteria 1061
294 Ga0496107_0255462 3300048910 Bacteria 1304
295 Ga0496107_0712957 3300048910 Bacteria 737
296 Ga0496108_0996931 3300048911 Bacteria 716
297 Ga0496109_0345322 3300048912 Bacteria 1405
298 Ga0496110_0007702 3300048913 Bacteria 8619
299 Ga0496111_0046881 3300048914 Bacteria 3113
300 Ga0496111_0064401 3300048914 Bacteria 2659
301 Ga0496112_0009361 3300048915 Bacteria 8821
302 Ga0496112_0024406 3300048915 Bacteria 5789
303 Ga0496112_1014604 3300048915 Bacteria 749
304 Ga0496113_0070335 3300048916 Bacteria 2660
305 Ga0496113_0248246 3300048916 Bacteria 1421
306 Ga0496114_0101197 3300048917 Bacteria 2460
307 Ga0496114_0278760 3300048917 Bacteria 1474
308 Ga0496114_0485561 3300048917 Bacteria 1093
309 Ga0496115_0156178 3300048918 Bacteria 1885
310 Ga0496117_0010097 3300048920 Bacteria 8665
311 Ga0496117_0194174 3300048920 Bacteria 1153
312 Ga0496118_0009789 3300048921 Bacteria 9610
313 Ga0496118_0107174 3300048921 Bacteria 1867
314 Ga0496119_0066656 3300048922 Bacteria 2126
315 Ga0496119_0151014 3300048922 Bacteria 1245
316 Ga0496121_0000214 3300048924 Bacteria 127349
317 Ga0496121_0000685 3300048924 Bacteria 63117
318 Ga0496121_0068818 3300048924 Bacteria 2861
319 Ga0496121_0351017 3300048924 Bacteria 982
320 Ga0496122_0079313 3300048925 Bacteria 2295
321 Ga0496124_0003154 3300048927 Bacteria 20391
322 Ga0496124_0131231 3300048927 Bacteria 1990
323 Ga0496124_0500918 3300048927 Bacteria 814
324 Ga0496125_0043095 3300048928 Bacteria 3836
325 Ga0496125_0091250 3300048928 Bacteria 2283
326 Ga0496125_0202921 3300048928 Bacteria 1296
327 Ga0496126_0014799 3300048929 Bacteria 7869
328 Ga0496126_0101713 3300048929 Bacteria 2513
329 Ga0496126_0175302 3300048929 Bacteria 1824
330 Ga0496126_0179695 3300048929 Bacteria 1798
331 Ga0496126_0187898 3300048929 Bacteria 1751
332 Ga0496126_0377578 3300048929 Bacteria 1154
333 Ga0496126_0688648 3300048929 Bacteria 796
334 Ga0501036_0113612 3300049572 Bacteria 2289
335 Ga0501070_0218345 3300049586 Bacteria 1564
336 nmdc:mga03n38_269_c1 3300050490 Bacteria 12311
337 nmdc:mga00v17_12363_c1 3300050491 Bacteria 4709
338 nmdc:mga0yw44_9583_c1 3300050492 Bacteria 4908
339 nmdc:mga0k408_114560_c1 3300050493 Bacteria 1160
340 nmdc:mga06z11_21420_c1 3300050494 Bacteria 3004
341 nmdc:mga06z11_462091_c1 3300050494 Bacteria 767
342 nmdc:mga04h51_12652_c1 3300050495 Bacteria 2373
343 nmdc:mga07m45_43199_c1 3300050496 Bacteria 2527
344 Ga0500641_0033902 3300053096 Bacteria 2029
345 Ga0500572_003231 3300053111 Bacteria 3756
346 Ga0500595_020577 3300053119 Bacteria 2372
347 Ga0500608_131852 3300053122 Bacteria 1120
348 Ga0500568_0024795 3300053139 Bacteria 2537
349 Ga0500568_0147902 3300053139 Bacteria 870
350 Ga0500590_056008 3300053148 Bacteria 1993
351 Ga0500604_0040458 3300053151 Bacteria 1405
352 Ga0500638_099240 3300053162 Bacteria 1361
353 Ga0500639_074228 3300053163 Bacteria 1726
354 Ga0500636_0046891 3300053177 Bacteria 2547
355 Ga0500637_0134630 3300053178 Bacteria 1431
356 Ga0500596_007990 3300053735 Bacteria 1701
357 2513678710 2513237098 Bacteria 9902361
358 2513694505 2513237101 Bacteria 7952346
359 2524465445 2524023210 Bacteria 9029266
360 2793070275 2791355197 Bacteria 8420563
361 2793079063
362 2885379892 2885374607 Bacteria 8927485
363 2885390510 2885383462 Bacteria 9473874
364 2903776174 2903768456 Bacteria 9749579
365 2906614719
366 2922364759 2922361189 Bacteria 7436256
367 2922426586
368 3005595786 3005594810 Bacteria 8716512
369 8006965093 8006964411 Bacteria 8966052
370 8006995341 8006994254 Bacteria 8309700
371 8019561411 8019555841 Bacteria 9642137
372 8019571490 8019565922 Bacteria 9639779
373 8056681510 8056681323 Bacteria 8472857
374 Ga0495610_0189367
375 Ga0070658_10163965
376 Ga0070683_100619274
377 Ga0068869_100104866
378 Ga0070666_10380118
379 Ga0070680_100400732
380 Ga0070682_100410517
381 Ga0070660_100016881
382 Ga0070660_100038402
383 Ga0070660_100962315
384 Ga0070689_100402274
385 Ga0070691_10032139
386 Ga0070687_100105033
387 Ga0070668_100181126
388 Ga0070668_100321579
389 Ga0070668_100416608
390 Ga0070674_100231985
391 Ga0070673_100373136
392 Ga0070659_100125787
393 Ga0070667_100244612
394 Ga0070667_100287568
395 Ga0070713_100082138
396 Ga0070711_100674168
397 Ga0070700_100042091
398 Ga0070700_100237163
399 Ga0070708_101050738
400 Ga0070663_100008024
401 Ga0070663_100047491
402 Ga0070663_100167809
403 Ga0070678_100226535
404 Ga0070678_100339247
405 Ga0070678_100716558
406 Ga0070681_10228031
407 Ga0068867_100119677
408 Ga0070684_100012031
409 Ga0070697_100008732
410 Ga0068853_100006712
411 Ga0068853_100219638
412 Ga0070672_100028397
413 Ga0070686_100052605
414 Ga0070665_100737077
415 Ga0070665_101232723
416 Ga0070664_100230584
417 Ga0070702_100025267
418 Ga0068852_100027939
419 Ga0068859_100054600
420 Ga0068864_100602070
421 Ga0068866_10208207
422 Ga0068861_100147202
423 Ga0068851_10039804
424 Ga0068863_100208045
425 Ga0068858_100290918
426 Ga0068860_100001737
427 Ga0068860_100490499
428 Ga0068862_100141010
429 Ga0081540_1045522
430 Ga0075365_10188348
431 Ga0075368_10039242
432 Ga0075363_100001722
433 Ga0070715_10159402
434 Ga0070716_100291370
435 Ga0070712_100180477
436 Ga0075367_10041655
437 Ga0075370_10017848
438 Ga0075428_100502939
439 Ga0075430_100140450
440 Ga0097620_100054600
441 Ga0099794_10066350
442 Ga0099794_10175569
443 Ga0099795_10007335
444 Ga0105250_10094233
445 Ga0105240_10033572
446 Ga0111539_10508493
447 Ga0105245_10420985
448 Ga0105245_10486844
449 Ga0105245_10719236
450 Ga0105247_10057488
451 Ga0105247_10123538
452 Ga0105247_10282157
453 Ga0114129_10126190
454 Ga0105243_10028125
455 Ga0105241_10208981
456 Ga0105242_10241218
457 Ga0105237_10009459
458 Ga0105237_10030745
459 Ga0105237_10133559
460 Ga0105237_10225636
461 Ga0105238_10009011
462 Ga0105249_10509768
463 Ga0105249_10704255
464 Ga0105249_10898425
465 Ga0099796_10128973
466 Ga0105239_10077224
467 Ga0105239_10113115
468 Ga0105239_11819642
469 Ga0157370_10027020
470 Ga0157370_10534926
471 Ga0157369_10042613
472 Ga0157374_10328543
473 Ga0163162_10229379
474 Ga0163162_10829220
475 Ga0157372_10014953
476 Ga0157375_10966248
477 Ga0163163_10012790
478 Ga0163163_10033422
479 Ga0157377_10253920
480 Ga0157379_10058491
481 Ga0157379_10324745
482 Ga0157379_10416391
483 Ga0157376_10141262
484 Ga0163161_10029435
485 Ga0163161_10148914
486 Ga0209455_1018205
487 Ga0207710_10031369
488 Ga0207710_10197616
489 Ga0207688_10089106
490 Ga0207688_10228878
491 Ga0207680_10265971
492 Ga0207699_11018399
493 Ga0207705_10097801
494 Ga0207654_10312078
495 Ga0207707_10000772
496 Ga0207671_10096691
497 Ga0207671_10133252
498 Ga0207671_10414707
499 Ga0207693_10012185
500 Ga0207663_10043696
501 Ga0207662_10116437
502 Ga0207657_10006315
503 Ga0207657_10467814
504 Ga0207652_10017663
505 Ga0207646_10100188
506 Ga0207681_10293500
507 Ga0207687_10007501
508 Ga0207687_10336581
509 Ga0207700_10161408
510 Ga0207644_10400653
511 Ga0207690_10305415
512 Ga0207706_10010878
513 Ga0207686_10117835
514 Ga0207709_10005272
515 Ga0207670_10404373
516 Ga0207669_10015222
517 Ga0207669_10221913
518 Ga0207704_10062844
519 Ga0207704_10706472
520 Ga0207665_10336846
521 Ga0207665_10641078
522 Ga0207691_10060364
523 Ga0207711_10875555
524 Ga0207689_10181871
525 Ga0207667_10014461
526 Ga0207651_10119395
527 Ga0207712_10379191
528 Ga0207712_10640859
529 Ga0207668_10163875
530 Ga0207668_10572947
531 Ga0207640_10205392
532 Ga0207658_10172295
533 Ga0207677_11145594
534 Ga0207703_10089268
535 Ga0207639_10031182
536 Ga0207678_10000808
537 Ga0207678_10083034
538 Ga0207678_10106245
539 Ga0207678_10110247
540 Ga0207678_10689455
541 Ga0207708_10325166
542 Ga0207708_10573229
543 Ga0207641_10858022
544 Ga0207648_10255809
545 Ga0207648_10373939
546 Ga0207676_10532866
547 Ga0207676_10612930
548 Ga0207674_10078005
549 Ga0207675_100059521
550 Ga0207675_100503037
551 Ga0207683_10370609
552 Ga0207683_10413251
553 Ga0207683_10497221
554 Ga0207698_10524797
555 Ga0209813_10013977
556 Ga0207428_10446772
557 Ga0268266_10000936
558 Ga0268265_10057596
559 Ga0268265_10513228
560 Ga0268265_10538445
561 Ga0268264_10000051
562 Ga0268264_10363990
563 Ga0265329_10067330
564 Ga0265340_10094664
565 Ga0307509_10009503
566 Ga0307509_10188874
567 Ga0307509_10339864
568 Ga0307508_10436424
569 Ga0307516_10054397
570 Ga0307516_10215694
571 Ga0307507_10116754
572 Ga0307510_10008288
573 Ga0373951_0109829
574 Ga0373945_0131498
575 Ga0373957_0005728
576 Ga0373957_0144023
577 Ga0373943_0148149
578 Ga0373943_0196546
579 Ga0373946_0137726
580 Ga0373955_0373124
581 Ga0373924_0157371
582 Ga0373931_0378041
583 Ga0373935_0032619
584 Ga0373935_0132175
585 Ga0373935_0311789
586 Ga0373927_0045319
587 Ga0373927_0061369
588 Ga0373927_0102649
589 Ga0373927_0285636
590 Ga0373933_0090767
591 Ga0373947_0093596
592 Ga0373925_0052973
593 Ga0373925_0098257
594 Ga0395905_0085268
595 Ga0395905_0360044
596 Ga0436365_0349419
597 Ga0451800_1605265
598 Ga0451837_1230920
599 Ga0439432_083826
600 Ga0466972_0000136
601 Ga0466959_0242343
602 Ga0466967_0023086
603 Ga0495592_0319147
604 Ga0495603_0005899
605 Ga0495603_0019452
606 Ga0495603_0188081
607 Ga0495629_0371082
608 Ga0495638_0126961
609 Ga0495638_0258281
610 Ga0495651_0039759
611 Ga0495651_0192821
612 Ga0495653_0151549
613 Ga0495582_0519092
614 Ga0495639_0063300
615 Ga0495664_0237002
616 Ga0495584_0064540
617 Ga0495594_0086222
618 Ga0495606_0010481
619 Ga0495606_0140661
620 Ga0495618_0239296
621 Ga0495630_0145284
622 Ga0495644_0030162
623 Ga0495644_0076091
624 Ga0495652_0430395
625 Ga0495652_0556797
626 Ga0495640_0054605
627 Ga0495586_0119962
628 Ga0495587_0036166
629 Ga0495598_0003337
630 Ga0495609_0122189
631 Ga0495597_0365378
632 Ga0495622_0018960
633 Ga0495656_0012214
634 Ga0495625_0231446
635 Ga0495635_0491453
636 Ga0495657_0038230
637 Ga0495658_0155861
638 Ga0495658_0285083
639 Ga0495658_0332106
640 Ga0495669_0012886
641 Ga0495671_0118995
642 Ga0495649_0193338
643 Ga0495674_0570070
644 Ga0495676_0121681
645 Ga0495675_0089981
646 Ga0495677_0015899
647 Ga0495677_0062240
648 Ga0495673_0014126
649 Ga0495673_0079414
650 Ga0495684_0126499
651 Ga0496100_0124877
652 Ga0496101_0101745
653 Ga0496101_0151295
654 Ga0496102_0086026
655 Ga0496104_0012329
656 Ga0496104_0060885
657 Ga0496104_1053325
658 Ga0496104_1368751
659 Ga0496105_0051631
660 Ga0496105_0314687
661 Ga0496106_0015784
662 Ga0496106_0045769
663 Ga0496106_0142450
664 Ga0496106_0146923
665 Ga0496106_0391758
666 Ga0496106_0429644
667 Ga0496107_0255462
668 Ga0496107_0712957
669 Ga0496108_0996931
670 Ga0496109_0345322
671 Ga0496110_0007702
672 Ga0496111_0046881
673 Ga0496111_0064401
674 Ga0496112_0009361
675 Ga0496112_0024406
676 Ga0496112_1014604
677 Ga0496113_0070335
678 Ga0496113_0248246
679 Ga0496114_0101197
680 Ga0496114_0278760
681 Ga0496114_0485561
682 Ga0496115_0156178
683 Ga0496117_0010097
684 Ga0496117_0194174
685 Ga0496118_0009789
686 Ga0496118_0107174
687 Ga0496119_0066656
688 Ga0496119_0151014
689 Ga0496121_0000214
690 Ga0496121_0000685
691 Ga0496121_0068818
692 Ga0496121_0351017
693 Ga0496122_0079313
694 Ga0496124_0003154
695 Ga0496124_0131231
696 Ga0496124_0500918
697 Ga0496125_0043095
698 Ga0496125_0091250
699 Ga0496125_0202921
700 Ga0496126_0014799
701 Ga0496126_0101713
702 Ga0496126_0175302
703 Ga0496126_0179695
704 Ga0496126_0187898
705 Ga0496126_0377578
706 Ga0496126_0688648
707 Ga0501036_0113612
708 Ga0501070_0218345
709 nmdc:mga03n38_269_c1
710 nmdc:mga00v17_12363_c1
711 nmdc:mga0yw44_9583_c1
712 nmdc:mga0k408_114560_c1
713 nmdc:mga06z11_21420_c1
714 nmdc:mga06z11_462091_c1
715 nmdc:mga04h51_12652_c1
716 nmdc:mga07m45_43199_c1
717 Ga0500641_0033902
718 Ga0500572_003231
719 Ga0500595_020577
720 Ga0500608_131852
721 Ga0500568_0024795
722 Ga0500568_0147902
723 Ga0500590_056008
724 Ga0500604_0040458
725 Ga0500638_099240
726 Ga0500639_074228
727 Ga0500636_0046891
728 Ga0500637_0134630
729 Ga0500596_007990
730 2513678710
731 2513694505
732 2524465445
733 2793070275
734 2793079063
735 2885379892
736 2885390510
737 2903776174
738 2906614719
739 2922364759
740 2922426586
741 3005595786
742 8006965093
743 8006995341
744 8019561411
745 8019571490
746 8056681510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

31

160

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cng-assembly1.cif.gz_B crystal structure of nudix hydrolase from nitrosomonas europaea 0.8606 31 144
6ypf-assembly1.cif.gz_A nudix1 hydrolase from rosa x hybrida in complex with geranyl pyrophosphate 0.853 31 147
5isy-assembly1.cif.gz_A crystal structure of nudix family protein with nad 0.8168 33 148
6nch-assembly1.cif.gz_B crystal structure of cdp-chase: raster data collection 0.8167 25 144
5iw5-assembly2.cif.gz_A-3 crystal structure of e. coli nudc in complex with nmn 0.8122 30 148
ID Description Score Start End Superfamily
af_A0A1D8PU14_38_158_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8365 36 137 3.90.79.10
af_P91148_5_207_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.814 32 144 3.90.79.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8071 12 189 3.90.79.10
af_Q8IDK8_11_194_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.806 34 150 3.90.79.10
af_Q9NA25_10_186_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8006 10 189 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A844THJ2-F1-model_v4 NUDIX domain-containing protein 0.9544 1 210 GO:0010945
AF-A0A2U3QC50-F1-model_v4 Nudix hydrolase domain-containing protein 0.9501 3 210 GO:0010945
AF-A0A844THJ2-F1-model_v4 NUDIX domain-containing protein 0.95 1 210 GO:0010945
AF-A0A6G3VA15-F1-model_v4 deleted 0.9468 21 125
AF-A0A1G2WR41-F1-model_v4 deleted 0.9459 27 210

Map