F426430

General Info

Members Datasets Scaffolds Average Seq Length
373 214 746 121

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0338349|Ga0451793_0338349_277_684
Length 135
Sequence VARFAVAVVEGSILSMFAYICLGSNDLGRSARFYDAVFYPLGARRTFDSENAIAYGTNFTTLWIVVRGRSPAPGYGHVALTATGRVAVDAAHAAGVANGGQDDGPPGERPQYGPGYYAAYLRDPDGLRVEVVSRR

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
97 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
100 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
101 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
191 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
192 2519899620 Rhizobium sp. Pop5 Isolate Nodule
193 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
194 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
195 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
196 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
197 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
198 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
199 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
200 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
201 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
202 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
203 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
204 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
205 2643221607 Rhizobium sp. Root73 Isolate Unclassified
206 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
207 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
208 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
209 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
210 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
211 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
212 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
213 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
214 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.3
Metatranscriptomes 0
Isolates 6.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.01
Nodule 0.54
Rhizoplane 9.12
Rhizosphere 56.03
Stem 0
Stem Tuber 0
Unclassified 6.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_0338349 3300041452 Unclassified 708
2 JGI25158J39367_1000145 3300002739 Bacteria 16591
3 JGI25152J39213_1004473 3300002773 Bacteria 4395
4 JGI25152J39213_1005317 3300002773 Bacteria 3794
5 JGI25152J39213_1030471 3300002773 Bacteria 838
6 JGI25152J39213_1030479 3300002773 Bacteria 838
7 JGI25159J45721_1002361 3300002987 Bacteria 7210
8 JGI25151J46595_10012258 3300003187 Bacteria 3905
9 JGI25151J46595_10057730 3300003187 Bacteria 1263
10 JGI25151J46595_10061756 3300003187 Bacteria 1190
11 JGI25153J46596_10013244 3300003215 Bacteria 3500
12 JGI25153J46596_10077562 3300003215 Bacteria 838
13 JGI25153J46596_10077579 3300003215 Bacteria 838
14 rootH2_10049405 3300003320 Bacteria 2030
15 rootL2_10149126 3300003322 Bacteria 1337
16 JGI25160J50197_1006159 3300003354 Bacteria 4885
17 JGI25161J50226_1000051 3300003374 Bacteria 110051
18 Ga0055526_1004082 3300003771 Bacteria 8939
19 Ga0055524_1006945 3300003775 Bacteria 4867
20 Ga0055528_1000373 3300003790 Bacteria 36405
21 Ga0055528_1002033 3300003790 Bacteria 11342
22 Ga0055540_1029300 3300003792 Bacteria 1290
23 Ga0055540_1032883 3300003792 Bacteria 1180
24 Ga0055543_1000095 3300004625 Bacteria 77750
25 Ga0065165_1008933 3300005262 Bacteria 4591
26 Ga0070683_100467532 3300005329 Unclassified 1204
27 Ga0070682_100390423 3300005337 Bacteria 1049
28 Ga0068868_100530453 3300005338 Bacteria 1035
29 Ga0070669_100256764 3300005353 Bacteria 1393
30 Ga0070714_100197610 3300005435 Bacteria 1838
31 Ga0070714_100709698 3300005435 Bacteria 971
32 Ga0070713_100122981 3300005436 Bacteria 2278
33 Ga0070713_100212376 3300005436 Bacteria 1752
34 Ga0070710_10082316 3300005437 Bacteria 1881
35 Ga0070710_10501724 3300005437 Bacteria 831
36 Ga0070711_101252626 3300005439 Bacteria 643
37 Ga0070698_101332818 3300005471 Archaea 668
38 Ga0070679_101222109 3300005530 Bacteria 697
39 Ga0070684_100525558 3300005535 Unclassified 1097
40 Ga0070665_101043082 3300005548 Bacteria 830
41 Ga0068856_100128607 3300005614 Bacteria 2537
42 Ga0068856_100292800 3300005614 Unclassified 1645
43 Ga0068852_100830680 3300005616 Bacteria 939
44 Ga0068859_101997129 3300005617 Unclassified 640
45 Ga0070717_10199401 3300006028 Bacteria 1752
46 Ga0070717_10376055 3300006028 Bacteria 1273
47 Ga0070717_10603611 3300006028 Bacteria 996
48 Ga0070717_10702410 3300006028 Bacteria 919
49 Ga0070712_100012844 3300006175 Bacteria 5332
50 Ga0070712_100297039 3300006175 Bacteria 1306
51 Ga0070712_100736330 3300006175 Bacteria 843
52 Ga0070712_101135490 3300006175 Bacteria 679
53 Ga0070712_101191973 3300006175 Unclassified 662
54 Ga0075367_10542508 3300006178 Bacteria 738
55 Ga0075369_10228688 3300006186 Bacteria 862
56 Ga0075370_10002896 3300006353 Bacteria 8052
57 Ga0075431_101022515 3300006847 Bacteria 793
58 Ga0075434_101318672 3300006871 Unclassified 733
59 Ga0075434_102239493 3300006871 Bacteria 550
60 Ga0097620_101997500 3300006931 Unclassified 640
61 Ga0114129_12393242 3300009147 Bacteria 633
62 Ga0105243_10691636 3300009148 Bacteria 993
63 Ga0105237_10006102 3300009545 Bacteria 13469
64 Ga0105239_10092058 3300010375 Bacteria 3346
65 Ga0105239_12139653 3300010375 Bacteria 650
66 Ga0182007_10002551 3300015262 Bacteria 8961
67 Ga0182005_1004707 3300015265 Bacteria 4358
68 Ga0213874_10000263 3300021377 Bacteria 10106
69 Ga0213874_10028211 3300021377 Bacteria 1602
70 Ga0213874_10035861 3300021377 Bacteria 1459
71 Ga0213874_10071304 3300021377 Unclassified 1109
72 Ga0213874_10255362 3300021377 Bacteria 647
73 Ga0213874_10412698 3300021377 Bacteria 527
74 Ga0213876_10034391 3300021384 Bacteria 2672
75 Ga0213876_10075676 3300021384 Bacteria 1778
76 Ga0213876_10089617 3300021384 Bacteria 1629
77 Ga0213876_10107783 3300021384 Bacteria 1478
78 Ga0213876_10131730 3300021384 Bacteria 1329
79 Ga0213876_10132015 3300021384 Bacteria 1327
80 Ga0213876_10268935 3300021384 Unclassified 906
81 Ga0213876_10475113 3300021384 Bacteria 665
82 Ga0213875_10015074 3300021388 Bacteria 3764
83 Ga0213875_10028831 3300021388 Bacteria 2633
84 Ga0213875_10043716 3300021388 Bacteria 2103
85 Ga0209436_100032 3300025208 Bacteria 80755
86 Ga0207425_1001819 3300025245 Bacteria 8260
87 Ga0207425_1051471 3300025245 Bacteria 750
88 Ga0209129_1000137 3300025258 Bacteria 123213
89 Ga0209129_1000886 3300025258 Bacteria 18430
90 Ga0209129_1006420 3300025258 Bacteria 3801
91 Ga0209129_1009848 3300025258 Bacteria 2459
92 Ga0209673_1000041 3300025273 Bacteria 307397
93 Ga0209673_1007481 3300025273 Bacteria 5024
94 Ga0209130_1000006 3300025284 Bacteria 596528
95 Ga0209025_1001120 3300025294 Bacteria 38378
96 Ga0209025_1014875 3300025294 Bacteria 4743
97 Ga0209025_1019774 3300025294 Bacteria 3724
98 Ga0209025_1106954 3300025294 Bacteria 869
99 Ga0209564_1000591 3300025295 Bacteria 57183
100 Ga0209758_1008558 3300025297 Bacteria 6589
101 Ga0209758_1014764 3300025297 Bacteria 4119
102 Ga0209758_1032623 3300025297 Bacteria 2109
103 Ga0209758_1083212 3300025297 Bacteria 960
104 Ga0209256_1000404 3300025299 Bacteria 68364
105 Ga0209256_1002262 3300025299 Bacteria 16321
106 Ga0209256_1004571 3300025299 Bacteria 8578
107 Ga0209256_1005825 3300025299 Bacteria 6861
108 Ga0207426_1000231 3300025302 Bacteria 128171
109 Ga0209051_1004928 3300025303 Bacteria 7988
110 Ga0209051_1043675 3300025303 Bacteria 1570
111 Ga0209257_1012458 3300025304 Bacteria 3925
112 Ga0209257_1099026 3300025304 Bacteria 714
113 Ga0207692_10501511 3300025898 Bacteria 770
114 Ga0207699_10009436 3300025906 Bacteria 4858
115 Ga0207671_10007788 3300025914 Bacteria 9222
116 Ga0207693_10001165 3300025915 Bacteria 23432
117 Ga0207693_10282416 3300025915 Bacteria 1301
118 Ga0207693_10410146 3300025915 Bacteria 1059
119 Ga0207693_10492789 3300025915 Unclassified 957
120 Ga0207663_10047777 3300025916 Bacteria 2644
121 Ga0207687_11187843 3300025927 Bacteria 656
122 Ga0207700_10128088 3300025928 Bacteria 2068
123 Ga0207700_11512859 3300025928 Unclassified 595
124 Ga0207664_10016644 3300025929 Bacteria 5369
125 Ga0207664_10421762 3300025929 Bacteria 1189
126 Ga0207664_10501132 3300025929 Bacteria 1087
127 Ga0207664_10637405 3300025929 Bacteria 958
128 Ga0207706_11343132 3300025933 Unclassified 589
129 Ga0207665_10144545 3300025939 Bacteria 1699
130 Ga0207711_10880329 3300025941 Bacteria 833
131 Ga0207661_10384255 3300025944 Unclassified 1271
132 Ga0207677_10372670 3300026023 Bacteria 1203
133 Ga0207702_10242426 3300026078 Bacteria 1689
134 Ga0207702_11069710 3300026078 Bacteria 800
135 Ga0207698_12557943 3300026142 Unclassified 520
136 Ga0265319_1002445 3300028563 Bacteria 10147
137 Ga0265319_1057375 3300028563 Bacteria 1270
138 Ga0265318_10009018 3300028577 Bacteria 4410
139 Ga0265338_10045390 3300028800 Bacteria 4041
140 Ga0265320_10005211 3300031240 Bacteria 8387
141 Ga0265320_10373241 3300031240 Bacteria 630
142 Ga0265316_10039961 3300031344 Bacteria 3764
143 Ga0265314_10028199 3300031711 Bacteria 4189
144 Ga0265314_10609691 3300031711 Bacteria 561
145 Ga0307409_101378474 3300031995 Bacteria 731
146 Ga0373934_0076253 3300035086 Bacteria 1345
147 Ga0373956_0057136 3300035119 Bacteria 1763
148 Ga0373943_0322325 3300035170 Bacteria 881
149 Ga0373947_0705944 3300035725 Bacteria 688
150 Ga0373937_0018191 3300036401 Bacteria 6271
151 Ga0373925_1038603 3300037068 Bacteria 675
152 Ga0395898_0001576 3300037466 Bacteria 31191
153 Ga0436364_0062986 3300037853 Bacteria 934
154 Ga0436364_0359221 3300037853 Bacteria 7783
155 Ga0436364_0794842 3300037853 Bacteria 5894
156 Ga0436364_0805041 3300037853 Bacteria 891
157 Ga0436364_1256162 3300037853 Bacteria 762
158 Ga0436364_1313755 3300037853 Bacteria 1519
159 Ga0436364_1317946 3300037853 Bacteria 6022
160 Ga0436364_1345122 3300037853 Bacteria 1444
161 Ga0436364_1380236 3300037853 Bacteria 3008
162 Ga0436364_1409870 3300037853 Bacteria 4864
163 Ga0436365_0388687 3300039437 Bacteria 8356
164 Ga0436365_0430601 3300039437 Bacteria 1422
165 Ga0436365_0431161 3300039437 Bacteria 4807
166 Ga0436365_0527331 3300039437 Bacteria 2639
167 Ga0436365_0628449 3300039437 Bacteria 4883
168 Ga0436365_0633084 3300039437 Bacteria 3098
169 Ga0436365_0655567 3300039437 Bacteria 2026
170 Ga0436365_0723962 3300039437 Bacteria 2432
171 Ga0436365_0770923 3300039437 Bacteria 6220
172 Ga0436365_0797261 3300039437 Bacteria 659
173 Ga0436365_1411920 3300039437 Bacteria 5465
174 Ga0436365_1503924 3300039437 Bacteria 2557
175 Ga0436365_1890319 3300039437 Bacteria 3031
176 Ga0436361_0583973 3300039447 Bacteria 774
177 Ga0436363_0272970 3300039450 Bacteria 759
178 Ga0436363_0289311 3300039450 Bacteria 650
179 Ga0436363_0365326 3300039450 Bacteria 16368
180 Ga0436363_0750111 3300039450 Bacteria 859
181 Ga0436363_1063131 3300039450 Bacteria 8992
182 Ga0436363_1412174 3300039450 Bacteria 744
183 Ga0436363_1459736 3300039450 Bacteria 684
184 Ga0436363_1500786 3300039450 Bacteria 3443
185 Ga0436363_1531522 3300039450 Bacteria 1811
186 Ga0436362_0644808 3300039453 Unclassified 683
187 Ga0436362_0818522 3300039453 Bacteria 1858
188 Ga0439465_0180580 3300041413 Bacteria 763
189 Ga0451787_090590 3300041441 Bacteria 2449
190 Ga0451789_1000145 3300041443 Bacteria 1054
191 Ga0451791_1713133 3300041451 Bacteria 2220
192 Ga0451795_1459472 3300041456 Bacteria 2344
193 Ga0451800_0344108 3300041459 Bacteria 4410
194 Ga0451804_0173088 3300041463 Bacteria 1134
195 Ga0451807_0192923 3300041486 Bacteria 3897
196 Ga0451849_0710338 3300041505 Bacteria 882
197 Ga0451853_2784920 3300041512 Bacteria 734
198 Ga0466969_0043211 3300044656 Bacteria 2246
199 Ga0466965_0022895 3300044683 Bacteria 3014
200 Ga0466965_0266828 3300044683 Bacteria 921
201 Ga0466966_0024313 3300044684 Bacteria 3963
202 Ga0466966_0096697 3300044684 Bacteria 1829
203 Ga0466966_0349235 3300044684 Bacteria 889
204 Ga0466966_0381652 3300044684 Bacteria 847
205 Ga0466966_0415145 3300044684 Bacteria 809
206 Ga0466966_0710406 3300044684 Unclassified 606
207 Ga0466961_0014737 3300044693 Bacteria 5024
208 Ga0466961_0079461 3300044693 Bacteria 2077
209 Ga0466963_0001551 3300044694 Bacteria 12458
210 Ga0466963_0091644 3300044694 Bacteria 2070
211 Ga0466963_0435052 3300044694 Bacteria 925
212 Ga0466971_0660516 3300044719 Bacteria 524
213 Ga0466968_0010359 3300044735 Bacteria 3612
214 Ga0466968_0012127 3300044735 Bacteria 3367
215 Ga0466968_0028105 3300044735 Bacteria 2318
216 Ga0466968_0534294 3300044735 Unclassified 587
217 Ga0466968_0684499 3300044735 Bacteria 523
218 Ga0466970_0207515 3300044765 Bacteria 1091
219 Ga0466957_0007031 3300044842 Bacteria 6360
220 Ga0466957_0293503 3300044842 Bacteria 1091
221 Ga0466957_0404511 3300044842 Bacteria 934
222 Ga0466959_0002079 3300045049 Bacteria 12668
223 Ga0466959_0004535 3300045049 Bacteria 9315
224 Ga0466959_0012882 3300045049 Bacteria 6053
225 Ga0466959_0098409 3300045049 Bacteria 2096
226 Ga0466959_0116535 3300045049 Bacteria 1902
227 Ga0466959_0292052 3300045049 Bacteria 1117
228 Ga0466959_0309342 3300045049 Bacteria 1081
229 Ga0466958_0001164 3300045836 Bacteria 12224
230 Ga0466958_0046182 3300045836 Bacteria 2628
231 Ga0466958_0047421 3300045836 Bacteria 2594
232 Ga0466958_0085199 3300045836 Bacteria 1949
233 Ga0466958_0137865 3300045836 Bacteria 1535
234 Ga0466958_0169253 3300045836 Bacteria 1383
235 Ga0466958_0295399 3300045836 Bacteria 1040
236 Ga0466958_0582815 3300045836 Bacteria 727
237 Ga0466958_0811350 3300045836 Bacteria 610
238 Ga0466958_1042950 3300045836 Bacteria 534
239 Ga0466967_0021311 3300045976 Bacteria 5260
240 Ga0466967_0038806 3300045976 Bacteria 4088
241 Ga0466967_0085827 3300045976 Bacteria 2851
242 Ga0466967_0267215 3300045976 Bacteria 1638
243 Ga0466967_0612282 3300045976 Unclassified 1075
244 Ga0466967_0709240 3300045976 Bacteria 997
245 Ga0466967_1967044 3300045976 Unclassified 581
246 Ga0466967_2546114 3300045976 Bacteria 506
247 Ga0495627_009382 3300046453 Bacteria 3605
248 Ga0495590_0018409 3300046457 Bacteria 2501
249 Ga0495629_0042541 3300046459 Bacteria 3192
250 Ga0495641_0063197 3300046461 Bacteria 1669
251 Ga0495651_0011320 3300046462 Bacteria 6855
252 Ga0495651_0404851 3300046462 Bacteria 890
253 Ga0495653_0007787 3300046463 Bacteria 8769
254 Ga0495653_0398994 3300046463 Bacteria 875
255 Ga0495664_0326203 3300046477 Bacteria 926
256 Ga0495606_0004680 3300046507 Bacteria 13523
257 Ga0495608_0003047 3300046511 Bacteria 11967
258 Ga0495610_0362176 3300046512 Bacteria 543
259 Ga0495616_0178574 3300046513 Bacteria 945
260 Ga0495618_0013953 3300046514 Bacteria 4890
261 Ga0495618_0650976 3300046514 Unclassified 623
262 Ga0495628_0063393 3300046516 Bacteria 2896
263 Ga0495628_0251343 3300046516 Bacteria 1320
264 Ga0495630_0596944 3300046517 Bacteria 846
265 Ga0495632_0126681 3300046519 Bacteria 1190
266 Ga0495652_0069243 3300046529 Bacteria 2954
267 Ga0495665_0215656 3300046531 Bacteria 993
268 Ga0495640_0045305 3300046533 Bacteria 3053
269 Ga0495587_0064884 3300046536 Bacteria 2133
270 Ga0495645_0262866 3300046543 Bacteria 1142
271 Ga0495667_0004076 3300046559 Bacteria 9816
272 Ga0495667_0079906 3300046559 Bacteria 2126
273 Ga0495634_0086099 3300046642 Bacteria 2047
274 Ga0495634_0897545 3300046642 Unclassified 502
275 Ga0495635_0024767 3300046663 Bacteria 4182
276 Ga0495588_0016659 3300046674 Bacteria 3555
277 Ga0495657_0011197 3300046675 Bacteria 6719
278 Ga0495599_0063860 3300046678 Bacteria 2300
279 Ga0495623_0179330 3300046679 Bacteria 1232
280 Ga0495646_0038142 3300046680 Bacteria 2968
281 Ga0495613_0092358 3300046689 Bacteria 2192
282 Ga0495649_0033858 3300046694 Bacteria 2812
283 Ga0495600_0014581 3300046809 Bacteria 4953
284 Ga0495604_0023699 3300047317 Bacteria 4898
285 Ga0495674_0293909 3300047319 Bacteria 1328
286 Ga0495674_0475282 3300047319 Bacteria 1002
287 Ga0495676_0363589 3300047321 Bacteria 966
288 Ga0495680_0034349 3300047322 Bacteria 4095
289 Ga0495680_0371090 3300047322 Bacteria 993
290 Ga0495675_0114104 3300047444 Bacteria 1685
291 Ga0495681_0098522 3300047470 Bacteria 1281
292 Ga0495684_0031601 3300047471 Bacteria 4065
293 Ga0495686_0010083 3300047472 Bacteria 6748
294 Ga0495686_0216191 3300047472 Bacteria 1092
295 Ga0495593_0063025 3300047673 Bacteria 1937
296 Ga0495602_0015649 3300048088 Bacteria 7647
297 Ga0495602_0291114 3300048088 Bacteria 1199
298 Ga0496100_0009542 3300048903 Bacteria 5455
299 Ga0496100_0320452 3300048903 Unclassified 1164
300 Ga0496101_0653316 3300048904 Bacteria 831
301 Ga0496102_0074467 3300048905 Bacteria 3121
302 Ga0496102_1235007 3300048905 Bacteria 667
303 Ga0496104_0021471 3300048907 Bacteria 5927
304 Ga0496104_0583272 3300048907 Bacteria 1028
305 Ga0496105_0062944 3300048908 Bacteria 3061
306 Ga0496105_0237919 3300048908 Bacteria 1478
307 Ga0496106_0032632 3300048909 Bacteria 3883
308 Ga0496106_0299515 3300048909 Bacteria 1289
309 Ga0496108_0000747 3300048911 Bacteria 25332
310 Ga0496109_0033633 3300048912 Bacteria 4612
311 Ga0496109_0280937 3300048912 Bacteria 1569
312 Ga0496110_0002594 3300048913 Bacteria 13596
313 Ga0496110_0035690 3300048913 Bacteria 4315
314 Ga0496111_0012118 3300048914 Bacteria 5830
315 Ga0496111_0322298 3300048914 Bacteria 1144
316 Ga0496112_0015468 3300048915 Bacteria 7121
317 Ga0496112_0055077 3300048915 Bacteria 3909
318 Ga0496113_0078657 3300048916 Bacteria 2523
319 Ga0496113_0097992 3300048916 Bacteria 2269
320 Ga0496113_1542276 3300048916 Bacteria 512
321 Ga0496114_0472144 3300048917 Bacteria 1110
322 Ga0496115_0232034 3300048918 Bacteria 1522
323 Ga0496115_1305919 3300048918 Unclassified 540
324 Ga0496116_0157238 3300048919 Bacteria 1252
325 Ga0496116_0261342 3300048919 Bacteria 853
326 Ga0496118_0015995 3300048921 Bacteria 6908
327 Ga0496119_0017775 3300048922 Bacteria 5330
328 Ga0496120_0013782 3300048923 Bacteria 5421
329 Ga0496121_0003295 3300048924 Bacteria 23190
330 Ga0496121_0023237 3300048924 Bacteria 5980
331 Ga0496121_0242004 3300048924 Bacteria 1256
332 Ga0496122_0299760 3300048925 Bacteria 867
333 Ga0496123_0079627 3300048926 Bacteria 2001
334 Ga0496124_0085572 3300048927 Bacteria 2583
335 Ga0496124_0557304 3300048927 Bacteria 755
336 Ga0496125_0008336 3300048928 Bacteria 10874
337 Ga0501042_0762217 3300049578 Bacteria 704
338 nmdc:mga0sz30_375900_c1 3300050516 Bacteria 636
339 Ga0495601_0209617 3300053077 Bacteria 1273
340 Ga0495612_0078374 3300053078 Bacteria 1386
341 Ga0495595_0004282 3300053084 Bacteria 5740
342 Ga0495619_0032917 3300053085 Bacteria 3365
343 Ga0495619_0422233 3300053085 Bacteria 920
344 Ga0500622_0005796 3300053156 Bacteria 7322
345 Ga0500636_0037412 3300053177 Bacteria 2871
346 Ga0466962_0131807 3300061719 Bacteria 1208
347 Ga0466962_0170098 3300061719 Bacteria 1061
348 Ga0466962_0440556 3300061719 Bacteria 655
349 2511131883 2510917022 Bacteria 6504556
350 2511197074 2510917030 Bacteria 7460662
351 2520375216 2519899620 Bacteria 6499161
352 2585168193 2582581283 Bacteria 6030556
353 2585221199 2582581298 Bacteria 7315509
354 2585273926 2582581307 Bacteria 6597605
355 2585279385 2582581308 Bacteria 7413247
356 2585331125 2582581316 Bacteria 7774528
357 2585531131 2585427527 Bacteria 7273426
358 2585549401 2585427529 Bacteria 7395659
359 2585552947 2585427530 Bacteria 7383882
360 2585560377 2585427531 Bacteria 6992870
361 2585903842 2585427609 Bacteria 6667127
362 2587981039 2585428125 Bacteria 6662905
363 2616306958 2615840626 Bacteria 7921970
364 2644049668 2643221607 Bacteria 6314006
365 2644203924 2643221636 Bacteria 6583769
366 2644241301 2643221643 Bacteria 5749658
367 2644482701 2643221686 Bacteria 6310811
368 2819640083 2818991453 Bacteria 7181617
369 2919103952 2919100787 Bacteria 7710546
370 3005412562 3005409236 Bacteria 7188837
371 3005418861 3005416602 Bacteria 7064308
372 3005446870 3005445848 Bacteria 6906074
373 8005318247 8005314921 Bacteria 7072929
374 Ga0451793_0338349
375 JGI25158J39367_1000145
376 JGI25152J39213_1004473
377 JGI25152J39213_1005317
378 JGI25152J39213_1030471
379 JGI25152J39213_1030479
380 JGI25159J45721_1002361
381 JGI25151J46595_10012258
382 JGI25151J46595_10057730
383 JGI25151J46595_10061756
384 JGI25153J46596_10013244
385 JGI25153J46596_10077562
386 JGI25153J46596_10077579
387 rootH2_10049405
388 rootL2_10149126
389 JGI25160J50197_1006159
390 JGI25161J50226_1000051
391 Ga0055526_1004082
392 Ga0055524_1006945
393 Ga0055528_1000373
394 Ga0055528_1002033
395 Ga0055540_1029300
396 Ga0055540_1032883
397 Ga0055543_1000095
398 Ga0065165_1008933
399 Ga0070683_100467532
400 Ga0070682_100390423
401 Ga0068868_100530453
402 Ga0070669_100256764
403 Ga0070714_100197610
404 Ga0070714_100709698
405 Ga0070713_100122981
406 Ga0070713_100212376
407 Ga0070710_10082316
408 Ga0070710_10501724
409 Ga0070711_101252626
410 Ga0070698_101332818
411 Ga0070679_101222109
412 Ga0070684_100525558
413 Ga0070665_101043082
414 Ga0068856_100128607
415 Ga0068856_100292800
416 Ga0068852_100830680
417 Ga0068859_101997129
418 Ga0070717_10199401
419 Ga0070717_10376055
420 Ga0070717_10603611
421 Ga0070717_10702410
422 Ga0070712_100012844
423 Ga0070712_100297039
424 Ga0070712_100736330
425 Ga0070712_101135490
426 Ga0070712_101191973
427 Ga0075367_10542508
428 Ga0075369_10228688
429 Ga0075370_10002896
430 Ga0075431_101022515
431 Ga0075434_101318672
432 Ga0075434_102239493
433 Ga0097620_101997500
434 Ga0114129_12393242
435 Ga0105243_10691636
436 Ga0105237_10006102
437 Ga0105239_10092058
438 Ga0105239_12139653
439 Ga0182007_10002551
440 Ga0182005_1004707
441 Ga0213874_10000263
442 Ga0213874_10028211
443 Ga0213874_10035861
444 Ga0213874_10071304
445 Ga0213874_10255362
446 Ga0213874_10412698
447 Ga0213876_10034391
448 Ga0213876_10075676
449 Ga0213876_10089617
450 Ga0213876_10107783
451 Ga0213876_10131730
452 Ga0213876_10132015
453 Ga0213876_10268935
454 Ga0213876_10475113
455 Ga0213875_10015074
456 Ga0213875_10028831
457 Ga0213875_10043716
458 Ga0209436_100032
459 Ga0207425_1001819
460 Ga0207425_1051471
461 Ga0209129_1000137
462 Ga0209129_1000886
463 Ga0209129_1006420
464 Ga0209129_1009848
465 Ga0209673_1000041
466 Ga0209673_1007481
467 Ga0209130_1000006
468 Ga0209025_1001120
469 Ga0209025_1014875
470 Ga0209025_1019774
471 Ga0209025_1106954
472 Ga0209564_1000591
473 Ga0209758_1008558
474 Ga0209758_1014764
475 Ga0209758_1032623
476 Ga0209758_1083212
477 Ga0209256_1000404
478 Ga0209256_1002262
479 Ga0209256_1004571
480 Ga0209256_1005825
481 Ga0207426_1000231
482 Ga0209051_1004928
483 Ga0209051_1043675
484 Ga0209257_1012458
485 Ga0209257_1099026
486 Ga0207692_10501511
487 Ga0207699_10009436
488 Ga0207671_10007788
489 Ga0207693_10001165
490 Ga0207693_10282416
491 Ga0207693_10410146
492 Ga0207693_10492789
493 Ga0207663_10047777
494 Ga0207687_11187843
495 Ga0207700_10128088
496 Ga0207700_11512859
497 Ga0207664_10016644
498 Ga0207664_10421762
499 Ga0207664_10501132
500 Ga0207664_10637405
501 Ga0207706_11343132
502 Ga0207665_10144545
503 Ga0207711_10880329
504 Ga0207661_10384255
505 Ga0207677_10372670
506 Ga0207702_10242426
507 Ga0207702_11069710
508 Ga0207698_12557943
509 Ga0265319_1002445
510 Ga0265319_1057375
511 Ga0265318_10009018
512 Ga0265338_10045390
513 Ga0265320_10005211
514 Ga0265320_10373241
515 Ga0265316_10039961
516 Ga0265314_10028199
517 Ga0265314_10609691
518 Ga0307409_101378474
519 Ga0373934_0076253
520 Ga0373956_0057136
521 Ga0373943_0322325
522 Ga0373947_0705944
523 Ga0373937_0018191
524 Ga0373925_1038603
525 Ga0395898_0001576
526 Ga0436364_0062986
527 Ga0436364_0359221
528 Ga0436364_0794842
529 Ga0436364_0805041
530 Ga0436364_1256162
531 Ga0436364_1313755
532 Ga0436364_1317946
533 Ga0436364_1345122
534 Ga0436364_1380236
535 Ga0436364_1409870
536 Ga0436365_0388687
537 Ga0436365_0430601
538 Ga0436365_0431161
539 Ga0436365_0527331
540 Ga0436365_0628449
541 Ga0436365_0633084
542 Ga0436365_0655567
543 Ga0436365_0723962
544 Ga0436365_0770923
545 Ga0436365_0797261
546 Ga0436365_1411920
547 Ga0436365_1503924
548 Ga0436365_1890319
549 Ga0436361_0583973
550 Ga0436363_0272970
551 Ga0436363_0289311
552 Ga0436363_0365326
553 Ga0436363_0750111
554 Ga0436363_1063131
555 Ga0436363_1412174
556 Ga0436363_1459736
557 Ga0436363_1500786
558 Ga0436363_1531522
559 Ga0436362_0644808
560 Ga0436362_0818522
561 Ga0439465_0180580
562 Ga0451787_090590
563 Ga0451789_1000145
564 Ga0451791_1713133
565 Ga0451795_1459472
566 Ga0451800_0344108
567 Ga0451804_0173088
568 Ga0451807_0192923
569 Ga0451849_0710338
570 Ga0451853_2784920
571 Ga0466969_0043211
572 Ga0466965_0022895
573 Ga0466965_0266828
574 Ga0466966_0024313
575 Ga0466966_0096697
576 Ga0466966_0349235
577 Ga0466966_0381652
578 Ga0466966_0415145
579 Ga0466966_0710406
580 Ga0466961_0014737
581 Ga0466961_0079461
582 Ga0466963_0001551
583 Ga0466963_0091644
584 Ga0466963_0435052
585 Ga0466971_0660516
586 Ga0466968_0010359
587 Ga0466968_0012127
588 Ga0466968_0028105
589 Ga0466968_0534294
590 Ga0466968_0684499
591 Ga0466970_0207515
592 Ga0466957_0007031
593 Ga0466957_0293503
594 Ga0466957_0404511
595 Ga0466959_0002079
596 Ga0466959_0004535
597 Ga0466959_0012882
598 Ga0466959_0098409
599 Ga0466959_0116535
600 Ga0466959_0292052
601 Ga0466959_0309342
602 Ga0466958_0001164
603 Ga0466958_0046182
604 Ga0466958_0047421
605 Ga0466958_0085199
606 Ga0466958_0137865
607 Ga0466958_0169253
608 Ga0466958_0295399
609 Ga0466958_0582815
610 Ga0466958_0811350
611 Ga0466958_1042950
612 Ga0466967_0021311
613 Ga0466967_0038806
614 Ga0466967_0085827
615 Ga0466967_0267215
616 Ga0466967_0612282
617 Ga0466967_0709240
618 Ga0466967_1967044
619 Ga0466967_2546114
620 Ga0495627_009382
621 Ga0495590_0018409
622 Ga0495629_0042541
623 Ga0495641_0063197
624 Ga0495651_0011320
625 Ga0495651_0404851
626 Ga0495653_0007787
627 Ga0495653_0398994
628 Ga0495664_0326203
629 Ga0495606_0004680
630 Ga0495608_0003047
631 Ga0495610_0362176
632 Ga0495616_0178574
633 Ga0495618_0013953
634 Ga0495618_0650976
635 Ga0495628_0063393
636 Ga0495628_0251343
637 Ga0495630_0596944
638 Ga0495632_0126681
639 Ga0495652_0069243
640 Ga0495665_0215656
641 Ga0495640_0045305
642 Ga0495587_0064884
643 Ga0495645_0262866
644 Ga0495667_0004076
645 Ga0495667_0079906
646 Ga0495634_0086099
647 Ga0495634_0897545
648 Ga0495635_0024767
649 Ga0495588_0016659
650 Ga0495657_0011197
651 Ga0495599_0063860
652 Ga0495623_0179330
653 Ga0495646_0038142
654 Ga0495613_0092358
655 Ga0495649_0033858
656 Ga0495600_0014581
657 Ga0495604_0023699
658 Ga0495674_0293909
659 Ga0495674_0475282
660 Ga0495676_0363589
661 Ga0495680_0034349
662 Ga0495680_0371090
663 Ga0495675_0114104
664 Ga0495681_0098522
665 Ga0495684_0031601
666 Ga0495686_0010083
667 Ga0495686_0216191
668 Ga0495593_0063025
669 Ga0495602_0015649
670 Ga0495602_0291114
671 Ga0496100_0009542
672 Ga0496100_0320452
673 Ga0496101_0653316
674 Ga0496102_0074467
675 Ga0496102_1235007
676 Ga0496104_0021471
677 Ga0496104_0583272
678 Ga0496105_0062944
679 Ga0496105_0237919
680 Ga0496106_0032632
681 Ga0496106_0299515
682 Ga0496108_0000747
683 Ga0496109_0033633
684 Ga0496109_0280937
685 Ga0496110_0002594
686 Ga0496110_0035690
687 Ga0496111_0012118
688 Ga0496111_0322298
689 Ga0496112_0015468
690 Ga0496112_0055077
691 Ga0496113_0078657
692 Ga0496113_0097992
693 Ga0496113_1542276
694 Ga0496114_0472144
695 Ga0496115_0232034
696 Ga0496115_1305919
697 Ga0496116_0157238
698 Ga0496116_0261342
699 Ga0496118_0015995
700 Ga0496119_0017775
701 Ga0496120_0013782
702 Ga0496121_0003295
703 Ga0496121_0023237
704 Ga0496121_0242004
705 Ga0496122_0299760
706 Ga0496123_0079627
707 Ga0496124_0085572
708 Ga0496124_0557304
709 Ga0496125_0008336
710 Ga0501042_0762217
711 nmdc:mga0sz30_375900_c1
712 Ga0495601_0209617
713 Ga0495612_0078374
714 Ga0495595_0004282
715 Ga0495619_0032917
716 Ga0495619_0422233
717 Ga0500622_0005796
718 Ga0500636_0037412
719 Ga0466962_0131807
720 Ga0466962_0170098
721 Ga0466962_0440556
722 2511131883
723 2511197074
724 2520375216
725 2585168193
726 2585221199
727 2585273926
728 2585279385
729 2585331125
730 2585531131
731 2585549401
732 2585552947
733 2585560377
734 2585903842
735 2587981039
736 2616306958
737 2644049668
738 2644203924
739 2644241301
740 2644482701
741 2819640083
742 2919103952
743 3005412562
744 3005418861
745 3005446870
746 8005318247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

131

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9093 1 125
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8953 1 125
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8722 1 122
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8654 1 122
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8646 1 122
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9093 1 125 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8953 1 125 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8891 64 125 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8788 64 124 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8654 64 124 3.30.720.110
ID Description Score Start End GO Terms
AF-K8CMT2-F1-model_v4 deleted 0.998 66 121
AF-A0A1Y2R398-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9948 67 122
AF-A0A0Q6QCC6-F1-model_v4 Glyoxalase 0.9941 1 125
AF-A0A514BFE7-F1-model_v4 deleted 0.9934 65 122
AF-A0A5B8L3H5-F1-model_v4 VOC family protein 0.9925 1 124

Map