F426416

General Info

Members Datasets Scaffolds Average Seq Length
373 234 746 406

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0035859|Ga0395898_0035859_2479_3753
Length 424
Sequence LADAGRKKYVHGINQGEMMRSERPRIAALATAVVLLTSGATLAQKKYDPGATDTEIKIGNIMPYSGPASAYGVIGKTEQAYFDKINAEGGINGRKIKFISYDDSYSPPKAVEQARKLVESDGVLLIFNSLGTPSNSAIQKYLNAKKVPQLFVASGASKWNDPKRFPWTMGWQPSYQSEAHIYAKYILKEKPNAKIGVLYQNDDFGKDYLKGLKDALGNKSSMIVAAESYETSEPSIDDHVVKLKAAGVDVFISVTTPKFAAQAIKKLAEIDWHPMHIVSNVSASVGGVLKPAGFENSQGILSSAYAKDASDPQWNNDPGMKKFYAFMEKYYPDGNKLDGSTVYGYGAAQTLVQVLKQCGDDLTRENVMKQAANLKDFQPDTLLPGVKVNTSPTDFAPLKQLQMMRFKGQKWELFGEILSGKLSE

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
102 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
103 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
222 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
223 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
224 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
225 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
226 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
229 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
230 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
231 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
232 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
233 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
234 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0.27
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.97
Nodule 2.14
Rhizoplane 7.24
Rhizosphere 76.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0035859 3300037466 Bacteria 4929
2 JGI24740J21852_10002850 3300001979 Bacteria 7730
3 JGI25160J50197_1011517 3300003354 Bacteria 3131
4 JGI25404J52841_10009205 3300003659 Bacteria 2110
5 Ga0070658_10033545 3300005327 Bacteria 4131
6 Ga0070683_100006494 3300005329 Bacteria 9820
7 Ga0070683_100056500 3300005329 Bacteria 3645
8 Ga0070683_100243538 3300005329 Bacteria 1710
9 Ga0070666_10087098 3300005335 Bacteria 2140
10 Ga0070680_100009025 3300005336 Bacteria 7646
11 Ga0070680_100043809 3300005336 Bacteria 3635
12 Ga0070680_100171885 3300005336 Bacteria 1823
13 Ga0068868_100033155 3300005338 Bacteria 3979
14 Ga0070660_100016156 3300005339 Bacteria 5411
15 Ga0070661_100085450 3300005344 Bacteria 2331
16 Ga0070668_100013950 3300005347 Bacteria 6008
17 Ga0070668_100203333 3300005347 Bacteria 1627
18 Ga0070674_100123414 3300005356 Bacteria 1920
19 Ga0070709_10132557 3300005434 Bacteria 1703
20 Ga0070709_10142551 3300005434 Bacteria 1648
21 Ga0070714_100064176 3300005435 Bacteria 3160
22 Ga0070714_100075596 3300005435 Bacteria 2922
23 Ga0070714_100091880 3300005435 Bacteria 2660
24 Ga0070713_100011248 3300005436 Bacteria 6509
25 Ga0070713_100101517 3300005436 Bacteria 2492
26 Ga0070710_10008860 3300005437 Bacteria 4910
27 Ga0070711_100020416 3300005439 Bacteria 4269
28 Ga0070711_100022280 3300005439 Bacteria 4104
29 Ga0070711_100164564 3300005439 Bacteria 1685
30 Ga0070711_100172083 3300005439 Bacteria 1651
31 Ga0070678_100016331 3300005456 Bacteria 4747
32 Ga0070681_10006811 3300005458 Bacteria 11120
33 Ga0070681_10148666 3300005458 Bacteria 2270
34 Ga0070706_100251037 3300005467 Bacteria 1652
35 Ga0070679_100008033 3300005530 Bacteria 9913
36 Ga0070684_100007203 3300005535 Bacteria 8643
37 Ga0070684_100037753 3300005535 Bacteria 4146
38 Ga0068853_100044215 3300005539 Bacteria 3812
39 Ga0070665_100106972 3300005548 Bacteria 2799
40 Ga0068855_100010185 3300005563 Bacteria 11331
41 Ga0068857_100008048 3300005577 Bacteria 9091
42 Ga0068857_100134299 3300005577 Bacteria 2234
43 Ga0068854_100003864 3300005578 Bacteria 9387
44 Ga0068856_100099016 3300005614 Bacteria 2906
45 Ga0068852_100014849 3300005616 Bacteria 6018
46 Ga0068852_100098341 3300005616 Bacteria 2635
47 Ga0068859_100050414 3300005617 Bacteria 4181
48 Ga0068851_10001316 3300005834 Bacteria 10815
49 Ga0068851_10071299 3300005834 Bacteria 1798
50 Ga0068851_10088353 3300005834 Bacteria 1629
51 Ga0068858_100045852 3300005842 Bacteria 4053
52 Ga0068858_100057565 3300005842 Bacteria 3592
53 Ga0068860_100005520 3300005843 Bacteria 12804
54 Ga0068860_100040134 3300005843 Bacteria 4475
55 Ga0081455_10003860 3300005937 Bacteria 17086
56 Ga0081540_1016236 3300005983 Bacteria 4671
57 Ga0081540_1028785 3300005983 Bacteria 3110
58 Ga0081539_10010685 3300005985 Bacteria 7401
59 Ga0070717_10001987 3300006028 Bacteria 14301
60 Ga0075365_10065331 3300006038 Bacteria 2438
61 Ga0075363_100022788 3300006048 Bacteria 3169
62 Ga0075364_10039637 3300006051 Bacteria 3055
63 Ga0070712_100012567 3300006175 Bacteria 5384
64 Ga0070712_100076336 3300006175 Bacteria 2412
65 Ga0075362_10028147 3300006177 Bacteria 2412
66 Ga0075367_10037202 3300006178 Bacteria 2827
67 Ga0075367_10077486 3300006178 Bacteria 2007
68 Ga0068865_100072975 3300006881 Bacteria 2439
69 Ga0075436_100106674 3300006914 Bacteria 1954
70 Ga0097620_100050414 3300006931 Bacteria 4181
71 Ga0075435_100010720 3300007076 Bacteria 6711
72 Ga0105240_10011548 3300009093 Bacteria 12292
73 Ga0105240_10018312 3300009093 Bacteria 9413
74 Ga0105240_10067861 3300009093 Bacteria 4419
75 Ga0105240_10101428 3300009093 Bacteria 3500
76 Ga0105247_10141500 3300009101 Bacteria 1577
77 Ga0105241_10000956 3300009174 Bacteria 21835
78 Ga0105248_10143272 3300009177 Bacteria 2696
79 Ga0105238_10001848 3300009551 Bacteria 21222
80 Ga0105238_10003834 3300009551 Bacteria 14931
81 Ga0105238_10179525 3300009551 Bacteria 2094
82 Ga0105239_10025364 3300010375 Bacteria 6527
83 Ga0105239_10029282 3300010375 Bacteria 6054
84 Ga0105246_10073372 3300011119 Bacteria 2416
85 Ga0157370_10015722 3300013104 Bacteria 7685
86 Ga0157370_10099701 3300013104 Bacteria 2722
87 Ga0157370_10100980 3300013104 Bacteria 2702
88 Ga0157369_10005973 3300013105 Bacteria 14139
89 Ga0157369_10021637 3300013105 Bacteria 7192
90 Ga0157369_10076807 3300013105 Bacteria 3580
91 Ga0163162_10173372 3300013306 Bacteria 2281
92 Ga0163162_10178150 3300013306 Bacteria 2252
93 Ga0157372_10237373 3300013307 Bacteria 2115
94 Ga0157375_10309324 3300013308 Bacteria 1744
95 Ga0163163_10055746 3300014325 Bacteria 3906
96 Ga0157380_10243063 3300014326 Bacteria 1624
97 Ga0157379_10290081 3300014968 Bacteria 1490
98 Ga0163161_10142420 3300017792 Bacteria 1816
99 Ga0213875_10098214 3300021388 Bacteria 1366
100 Ga0213871_10000565 3300021441 Bacteria 5182
101 Ga0224712_10043102 3300022467 Bacteria 1713
102 Ga0209677_102404 3300025253 Bacteria 7105
103 Ga0207697_10075314 3300025315 Bacteria 1418
104 Ga0207656_10036230 3300025321 Bacteria 2070
105 Ga0207656_10058361 3300025321 Bacteria 1686
106 Ga0207692_10024745 3300025898 Bacteria 2795
107 Ga0207692_10073194 3300025898 Bacteria 1812
108 Ga0207710_10007375 3300025900 Bacteria 4658
109 Ga0207680_10033681 3300025903 Bacteria 2925
110 Ga0207699_10144043 3300025906 Bacteria 1569
111 Ga0207684_10120145 3300025910 Bacteria 2253
112 Ga0207654_10000153 3300025911 Bacteria 43627
113 Ga0207707_10000143 3300025912 Bacteria 74226
114 Ga0207707_10000613 3300025912 Bacteria 35676
115 Ga0207707_10034799 3300025912 Bacteria 4406
116 Ga0207707_10128940 3300025912 Bacteria 2212
117 Ga0207695_10000506 3300025913 Bacteria 82904
118 Ga0207695_10009613 3300025913 Bacteria 11939
119 Ga0207671_10008011 3300025914 Bacteria 9044
120 Ga0207671_10031170 3300025914 Bacteria 3974
121 Ga0207671_10091794 3300025914 Bacteria 2289
122 Ga0207693_10019423 3300025915 Bacteria 5405
123 Ga0207693_10033293 3300025915 Bacteria 4067
124 Ga0207693_10092802 3300025915 Bacteria 2366
125 Ga0207693_10217205 3300025915 Bacteria 1502
126 Ga0207663_10122785 3300025916 Bacteria 1781
127 Ga0207663_10161487 3300025916 Bacteria 1582
128 Ga0207660_10001451 3300025917 Bacteria 15916
129 Ga0207657_10003960 3300025919 Bacteria 15723
130 Ga0207652_10007603 3300025921 Bacteria 8726
131 Ga0207652_10024167 3300025921 Bacteria 5040
132 Ga0207694_10000086 3300025924 Bacteria 108152
133 Ga0207694_10003812 3300025924 Bacteria 11930
134 Ga0207700_10007251 3300025928 Bacteria 6763
135 Ga0207700_10011456 3300025928 Bacteria 5654
136 Ga0207700_10051764 3300025928 Bacteria 3066
137 Ga0207670_10034393 3300025936 Bacteria 3275
138 Ga0207665_10085898 3300025939 Bacteria 2172
139 Ga0207665_10091758 3300025939 Bacteria 2106
140 Ga0207711_10332027 3300025941 Bacteria 1406
141 Ga0207661_10000712 3300025944 Bacteria 21611
142 Ga0207661_10010436 3300025944 Bacteria 6686
143 Ga0207661_10280464 3300025944 Bacteria 1489
144 Ga0207667_10010781 3300025949 Bacteria 10662
145 Ga0207667_10039982 3300025949 Bacteria 4993
146 Ga0207667_10049058 3300025949 Bacteria 4461
147 Ga0207667_10376265 3300025949 Bacteria 1447
148 Ga0207639_10003617 3300026041 Bacteria 10381
149 Ga0207639_10034330 3300026041 Bacteria 3748
150 Ga0207678_10039262 3300026067 Bacteria 4109
151 Ga0207678_10272545 3300026067 Bacteria 1451
152 Ga0207702_10000006 3300026078 Bacteria 346370
153 Ga0207641_10218656 3300026088 Bacteria 1765
154 Ga0207676_10054160 3300026095 Bacteria 3143
155 Ga0207676_10153108 3300026095 Bacteria 1988
156 Ga0207674_10005444 3300026116 Bacteria 15120
157 Ga0207674_10016172 3300026116 Bacteria 8171
158 Ga0207675_100290832 3300026118 Bacteria 1589
159 Ga0207683_10051547 3300026121 Bacteria 3605
160 Ga0207683_10115480 3300026121 Bacteria 2406
161 Ga0207698_10151113 3300026142 Bacteria 2016
162 Ga0207698_10344477 3300026142 Bacteria 1405
163 Ga0209589_1000015 3300027357 Bacteria 225913
164 Ga0209489_100015 3300027361 Bacteria 225913
165 Ga0209700_100025 3300027363 Bacteria 225913
166 Ga0209588_1008434 3300027671 Bacteria 3056
167 Ga0268266_10039943 3300028379 Bacteria 3998
168 Ga0268266_10187088 3300028379 Bacteria 1889
169 Ga0268264_10006148 3300028381 Bacteria 10139
170 Ga0307511_10067067 3300030521 Bacteria 2667
171 Ga0265330_10043177 3300031235 Bacteria 1996
172 Ga0265339_10099745 3300031249 Bacteria 1513
173 Ga0307509_10059877 3300031507 Bacteria 4027
174 Ga0265342_10126468 3300031712 Bacteria 1435
175 Ga0307516_10002779 3300031730 Bacteria 23102
176 Ga0307416_100153212 3300032002 Bacteria 2118
177 Ga0307507_10021942 3300033179 Bacteria 7083
178 Ga0373934_0034347 3300035086 Bacteria 1993
179 Ga0373923_0019693 3300035111 Bacteria 2615
180 Ga0373932_0012652 3300035112 Bacteria 2082
181 Ga0373954_0000194 3300035118 Bacteria 21982
182 Ga0373956_0005615 3300035119 Bacteria 5015
183 Ga0373956_0025265 3300035119 Bacteria 2566
184 Ga0373957_0000558 3300035120 Bacteria 9469
185 Ga0373957_0010547 3300035120 Bacteria 3059
186 Ga0373943_0026477 3300035170 Bacteria 2717
187 Ga0373955_0002265 3300035172 Bacteria 8358
188 Ga0373955_0013408 3300035172 Bacteria 3964
189 Ga0373955_0068221 3300035172 Bacteria 1981
190 Ga0373924_0003352 3300035410 Bacteria 5503
191 Ga0373924_0010472 3300035410 Bacteria 3420
192 Ga0373931_0003286 3300035691 Bacteria 7238
193 Ga0373935_0001679 3300035692 Bacteria 12372
194 Ga0373927_0000137 3300035695 Bacteria 56546
195 Ga0373927_0006798 3300035695 Bacteria 7781
196 Ga0373927_0018690 3300035695 Bacteria 4549
197 Ga0373933_0000108 3300035724 Bacteria 53024
198 Ga0373933_0000961 3300035724 Bacteria 17558
199 Ga0373933_0026822 3300035724 Bacteria 3312
200 Ga0373947_0006199 3300035725 Bacteria 6955
201 Ga0373947_0008600 3300035725 Bacteria 5876
202 Ga0373947_0036007 3300035725 Bacteria 2932
203 Ga0373947_0097970 3300035725 Bacteria 1839
204 Ga0373937_0007705 3300036401 Bacteria 9334
205 Ga0373937_0029297 3300036401 Bacteria 4985
206 Ga0373937_0035980 3300036401 Bacteria 4510
207 Ga0373925_0002159 3300037068 Bacteria 16068
208 Ga0373925_0062697 3300037068 Bacteria 2796
209 Ga0373925_0076795 3300037068 Bacteria 2534
210 Ga0395900_0025734 3300037418 Bacteria 6023
211 Ga0395898_0027242 3300037466 Bacteria 5739
212 Ga0395905_0015996 3300037471 Bacteria 7131
213 Ga0436364_0645914 3300037853 Bacteria 7805
214 Ga0436364_1258003 3300037853 Bacteria 3768
215 Ga0395901_0609805 3300038443 Bacteria 1100
216 Ga0436365_1536444 3300039437 Bacteria 1078
217 Ga0436365_1664434 3300039437 Bacteria 2619
218 Ga0436360_0071874 3300039438 Bacteria 7147
219 Ga0436360_1094659 3300039438 Bacteria 1699
220 Ga0436363_1703312 3300039450 Bacteria 4535
221 Ga0436362_0788595 3300039453 Bacteria 4622
222 Ga0436362_0948918 3300039453 Bacteria 1996
223 Ga0466964_0031735 3300044706 Bacteria 2097
224 Ga0466967_0012239 3300045976 Bacteria 6551
225 Ga0495592_0000339 3300046454 Bacteria 38389
226 Ga0495592_0048953 3300046454 Bacteria 3142
227 Ga0495592_0064585 3300046454 Bacteria 2682
228 Ga0495603_0000277 3300046455 Bacteria 27280
229 Ga0495603_0107533 3300046455 Bacteria 1628
230 Ga0495629_0000029 3300046459 Bacteria 127000
231 Ga0495629_0002796 3300046459 Bacteria 13308
232 Ga0495641_0001504 3300046461 Bacteria 19881
233 Ga0495651_0004273 3300046462 Bacteria 10957
234 Ga0495651_0016412 3300046462 Bacteria 5734
235 Ga0495651_0256695 3300046462 Bacteria 1191
236 Ga0495653_0002916 3300046463 Bacteria 13678
237 Ga0495580_0000705 3300046472 Bacteria 28569
238 Ga0495580_0019991 3300046472 Bacteria 4963
239 Ga0495582_0000024 3300046473 Bacteria 82444
240 Ga0495639_0000135 3300046475 Bacteria 38122
241 Ga0495639_0014282 3300046475 Bacteria 3437
242 Ga0495662_0098104 3300046476 Bacteria 1433
243 Ga0495664_0006991 3300046477 Bacteria 6252
244 Ga0495664_0055999 3300046477 Bacteria 2345
245 Ga0495594_0000822 3300046499 Bacteria 16021
246 Ga0495606_0077003 3300046507 Bacteria 2083
247 Ga0495608_0002299 3300046511 Bacteria 13791
248 Ga0495628_0014062 3300046516 Bacteria 6717
249 Ga0495628_0036340 3300046516 Bacteria 3954
250 Ga0495630_0007650 3300046517 Bacteria 7726
251 Ga0495630_0018001 3300046517 Bacteria 5185
252 Ga0495652_0007414 3300046529 Bacteria 10113
253 Ga0495652_0014055 3300046529 Bacteria 7192
254 Ga0495652_0040545 3300046529 Bacteria 4024
255 Ga0495665_0000178 3300046531 Bacteria 32333
256 Ga0495640_0003708 3300046533 Bacteria 12271
257 Ga0495640_0009567 3300046533 Bacteria 7539
258 Ga0495586_0065823 3300046535 Bacteria 1976
259 Ga0495587_0002322 3300046536 Bacteria 12716
260 Ga0495621_0072847 3300046539 Bacteria 1269
261 Ga0495645_0004703 3300046543 Bacteria 9324
262 Ga0495622_0009145 3300046557 Bacteria 4587
263 Ga0495622_0076383 3300046557 Bacteria 1543
264 Ga0495667_0015948 3300046559 Bacteria 5078
265 Ga0495667_0042815 3300046559 Bacteria 3002
266 Ga0495634_0007096 3300046642 Bacteria 8449
267 Ga0495634_0035779 3300046642 Bacteria 3398
268 Ga0495635_0004181 3300046663 Bacteria 10017
269 Ga0495635_0013090 3300046663 Bacteria 5806
270 Ga0495588_0006153 3300046674 Bacteria 5389
271 Ga0495657_0023707 3300046675 Bacteria 4382
272 Ga0495657_0031986 3300046675 Bacteria 3674
273 Ga0495599_0000440 3300046678 Bacteria 23669
274 Ga0495599_0010340 3300046678 Bacteria 5706
275 Ga0495623_0004965 3300046679 Bacteria 8727
276 Ga0495623_0005289 3300046679 Bacteria 8457
277 Ga0495646_0051629 3300046680 Bacteria 2488
278 Ga0495646_0071664 3300046680 Bacteria 2038
279 Ga0495647_0013024 3300046681 Bacteria 2873
280 Ga0495658_0001504 3300046683 Bacteria 12223
281 Ga0495613_0006457 3300046689 Bacteria 8768
282 Ga0495624_0000788 3300046690 Bacteria 24985
283 Ga0495581_0000004 3300047315 Bacteria 84424
284 Ga0495604_0023550 3300047317 Bacteria 4912
285 Ga0495674_0001728 3300047319 Bacteria 21443
286 Ga0495674_0008604 3300047319 Bacteria 9712
287 Ga0495674_0054777 3300047319 Bacteria 3500
288 Ga0495676_0021097 3300047321 Bacteria 5701
289 Ga0495680_0035194 3300047322 Bacteria 4035
290 Ga0495675_0000801 3300047444 Bacteria 19376
291 Ga0495675_0028548 3300047444 Bacteria 3556
292 Ga0495684_0002197 3300047471 Bacteria 15622
293 Ga0495684_0004302 3300047471 Bacteria 11119
294 Ga0495684_0007205 3300047471 Bacteria 8633
295 Ga0495593_0000197 3300047673 Bacteria 31593
296 Ga0495602_0014005 3300048088 Bacteria 8161
297 Ga0496100_0103316 3300048903 Bacteria 1967
298 Ga0496101_0001342 3300048904 Bacteria 14755
299 Ga0496102_0013166 3300048905 Bacteria 7157
300 Ga0496102_0091966 3300048905 Bacteria 2809
301 Ga0496102_0172535 3300048905 Bacteria 2036
302 Ga0496104_0008089 3300048907 Bacteria 9330
303 Ga0496104_0016010 3300048907 Bacteria 6808
304 Ga0496105_0020063 3300048908 Bacteria 5395
305 Ga0496105_0033032 3300048908 Bacteria 4248
306 Ga0496106_0002085 3300048909 Bacteria 14990
307 Ga0496106_0002213 3300048909 Bacteria 14507
308 Ga0496106_0177890 3300048909 Bacteria 1688
309 Ga0496107_0001626 3300048910 Bacteria 14005
310 Ga0496107_0036725 3300048910 Bacteria 3514
311 Ga0496108_0246549 3300048911 Bacteria 1554
312 Ga0496109_0079526 3300048912 Bacteria 3021
313 Ga0496109_0084688 3300048912 Bacteria 2925
314 Ga0496110_0015096 3300048913 Bacteria 6423
315 Ga0496110_0257993 3300048913 Bacteria 1587
316 Ga0496110_0277348 3300048913 Bacteria 1526
317 Ga0496112_0017137 3300048915 Bacteria 6803
318 Ga0496112_0148618 3300048915 Bacteria 2311
319 Ga0496114_0018948 3300048917 Bacteria 5574
320 Ga0496114_0053276 3300048917 Bacteria 3372
321 Ga0496114_0194316 3300048917 Bacteria 1776
322 Ga0496115_0001562 3300048918 Bacteria 16472
323 Ga0496115_0013435 3300048918 Bacteria 6196
324 Ga0496117_0012163 3300048920 Bacteria 7622
325 Ga0496118_0003764 3300048921 Bacteria 18746
326 Ga0496121_0002004 3300048924 Bacteria 32342
327 Ga0496121_0088401 3300048924 Bacteria 2429
328 Ga0496121_0097392 3300048924 Bacteria 2280
329 Ga0496124_0004431 3300048927 Bacteria 16374
330 Ga0496124_0317346 3300048927 Bacteria 1117
331 Ga0496125_0082351 3300048928 Bacteria 2453
332 Ga0496125_0136984 3300048928 Bacteria 1710
333 Ga0496126_0017831 3300048929 Bacteria 7065
334 Ga0496126_0030015 3300048929 Bacteria 5158
335 Ga0496126_0058113 3300048929 Bacteria 3487
336 Ga0496126_0092903 3300048929 Bacteria 2650
337 Ga0496126_0096120 3300048929 Bacteria 2598
338 Ga0501043_0112884 3300049579 Bacteria 2134
339 nmdc:mga03683_29276_c1 3300050489 Bacteria 2195
340 nmdc:mga0yw44_36551_c1 3300050492 Bacteria 2895
341 nmdc:mga06z11_88908_c1 3300050494 Bacteria 1673
342 nmdc:mga0n895_118328_c1 3300050512 Bacteria 2669
343 nmdc:mga0n895_42830_c1 3300050512 Bacteria 4407
344 nmdc:mga0rr50_16069_c1 3300050513 Bacteria 4959
345 Ga0495601_0014688 3300053077 Bacteria 4723
346 Ga0500635_0003136 3300053080 Bacteria 4132
347 Ga0500635_0010047 3300053080 Bacteria 2646
348 Ga0495595_0003578 3300053084 Bacteria 6170
349 Ga0495595_0008429 3300053084 Bacteria 4230
350 Ga0495619_0012552 3300053085 Bacteria 5335
351 Ga0495619_0016178 3300053085 Bacteria 4722
352 Ga0495619_0031966 3300053085 Bacteria 3412
353 Ga0500566_0000223 3300053094 Bacteria 30380
354 Ga0500566_0006638 3300053094 Bacteria 6852
355 Ga0500650_0014319 3300053098 Bacteria 3351
356 Ga0500572_000848 3300053111 Bacteria 9536
357 Ga0500595_001519 3300053119 Bacteria 12326
358 Ga0500608_059277 3300053122 Bacteria 1831
359 Ga0500559_0002267 3300053136 Bacteria 10164
360 Ga0500603_000237 3300053150 Bacteria 14490
361 Ga0500627_0041663 3300053158 Bacteria 1975
362 Ga0500630_000468 3300053159 Bacteria 17761
363 Ga0500638_001847 3300053162 Bacteria 6994
364 Ga0500639_000031 3300053163 Bacteria 69938
365 Ga0500637_0002841 3300053178 Bacteria 7801
366 Ga0466962_0026234 3300061719 Bacteria 2798
367 2509151529 2508501128 Bacteria 8613869
368 2513715392 2513237104 Bacteria 10034502
369 2728753827 2728368998 Bacteria 8720350
370 2885387817 2885383462 Bacteria 9473874
371 2885411933 2885409591 Bacteria 9235467
372 2922366731 2922361189 Bacteria 7436256
373 8056683428 8056681323 Bacteria 8472857
374 Ga0395898_0035859
375 JGI24740J21852_10002850
376 JGI25160J50197_1011517
377 JGI25404J52841_10009205
378 Ga0070658_10033545
379 Ga0070683_100006494
380 Ga0070683_100056500
381 Ga0070683_100243538
382 Ga0070666_10087098
383 Ga0070680_100009025
384 Ga0070680_100043809
385 Ga0070680_100171885
386 Ga0068868_100033155
387 Ga0070660_100016156
388 Ga0070661_100085450
389 Ga0070668_100013950
390 Ga0070668_100203333
391 Ga0070674_100123414
392 Ga0070709_10132557
393 Ga0070709_10142551
394 Ga0070714_100064176
395 Ga0070714_100075596
396 Ga0070714_100091880
397 Ga0070713_100011248
398 Ga0070713_100101517
399 Ga0070710_10008860
400 Ga0070711_100020416
401 Ga0070711_100022280
402 Ga0070711_100164564
403 Ga0070711_100172083
404 Ga0070678_100016331
405 Ga0070681_10006811
406 Ga0070681_10148666
407 Ga0070706_100251037
408 Ga0070679_100008033
409 Ga0070684_100007203
410 Ga0070684_100037753
411 Ga0068853_100044215
412 Ga0070665_100106972
413 Ga0068855_100010185
414 Ga0068857_100008048
415 Ga0068857_100134299
416 Ga0068854_100003864
417 Ga0068856_100099016
418 Ga0068852_100014849
419 Ga0068852_100098341
420 Ga0068859_100050414
421 Ga0068851_10001316
422 Ga0068851_10071299
423 Ga0068851_10088353
424 Ga0068858_100045852
425 Ga0068858_100057565
426 Ga0068860_100005520
427 Ga0068860_100040134
428 Ga0081455_10003860
429 Ga0081540_1016236
430 Ga0081540_1028785
431 Ga0081539_10010685
432 Ga0070717_10001987
433 Ga0075365_10065331
434 Ga0075363_100022788
435 Ga0075364_10039637
436 Ga0070712_100012567
437 Ga0070712_100076336
438 Ga0075362_10028147
439 Ga0075367_10037202
440 Ga0075367_10077486
441 Ga0068865_100072975
442 Ga0075436_100106674
443 Ga0097620_100050414
444 Ga0075435_100010720
445 Ga0105240_10011548
446 Ga0105240_10018312
447 Ga0105240_10067861
448 Ga0105240_10101428
449 Ga0105247_10141500
450 Ga0105241_10000956
451 Ga0105248_10143272
452 Ga0105238_10001848
453 Ga0105238_10003834
454 Ga0105238_10179525
455 Ga0105239_10025364
456 Ga0105239_10029282
457 Ga0105246_10073372
458 Ga0157370_10015722
459 Ga0157370_10099701
460 Ga0157370_10100980
461 Ga0157369_10005973
462 Ga0157369_10021637
463 Ga0157369_10076807
464 Ga0163162_10173372
465 Ga0163162_10178150
466 Ga0157372_10237373
467 Ga0157375_10309324
468 Ga0163163_10055746
469 Ga0157380_10243063
470 Ga0157379_10290081
471 Ga0163161_10142420
472 Ga0213875_10098214
473 Ga0213871_10000565
474 Ga0224712_10043102
475 Ga0209677_102404
476 Ga0207697_10075314
477 Ga0207656_10036230
478 Ga0207656_10058361
479 Ga0207692_10024745
480 Ga0207692_10073194
481 Ga0207710_10007375
482 Ga0207680_10033681
483 Ga0207699_10144043
484 Ga0207684_10120145
485 Ga0207654_10000153
486 Ga0207707_10000143
487 Ga0207707_10000613
488 Ga0207707_10034799
489 Ga0207707_10128940
490 Ga0207695_10000506
491 Ga0207695_10009613
492 Ga0207671_10008011
493 Ga0207671_10031170
494 Ga0207671_10091794
495 Ga0207693_10019423
496 Ga0207693_10033293
497 Ga0207693_10092802
498 Ga0207693_10217205
499 Ga0207663_10122785
500 Ga0207663_10161487
501 Ga0207660_10001451
502 Ga0207657_10003960
503 Ga0207652_10007603
504 Ga0207652_10024167
505 Ga0207694_10000086
506 Ga0207694_10003812
507 Ga0207700_10007251
508 Ga0207700_10011456
509 Ga0207700_10051764
510 Ga0207670_10034393
511 Ga0207665_10085898
512 Ga0207665_10091758
513 Ga0207711_10332027
514 Ga0207661_10000712
515 Ga0207661_10010436
516 Ga0207661_10280464
517 Ga0207667_10010781
518 Ga0207667_10039982
519 Ga0207667_10049058
520 Ga0207667_10376265
521 Ga0207639_10003617
522 Ga0207639_10034330
523 Ga0207678_10039262
524 Ga0207678_10272545
525 Ga0207702_10000006
526 Ga0207641_10218656
527 Ga0207676_10054160
528 Ga0207676_10153108
529 Ga0207674_10005444
530 Ga0207674_10016172
531 Ga0207675_100290832
532 Ga0207683_10051547
533 Ga0207683_10115480
534 Ga0207698_10151113
535 Ga0207698_10344477
536 Ga0209589_1000015
537 Ga0209489_100015
538 Ga0209700_100025
539 Ga0209588_1008434
540 Ga0268266_10039943
541 Ga0268266_10187088
542 Ga0268264_10006148
543 Ga0307511_10067067
544 Ga0265330_10043177
545 Ga0265339_10099745
546 Ga0307509_10059877
547 Ga0265342_10126468
548 Ga0307516_10002779
549 Ga0307416_100153212
550 Ga0307507_10021942
551 Ga0373934_0034347
552 Ga0373923_0019693
553 Ga0373932_0012652
554 Ga0373954_0000194
555 Ga0373956_0005615
556 Ga0373956_0025265
557 Ga0373957_0000558
558 Ga0373957_0010547
559 Ga0373943_0026477
560 Ga0373955_0002265
561 Ga0373955_0013408
562 Ga0373955_0068221
563 Ga0373924_0003352
564 Ga0373924_0010472
565 Ga0373931_0003286
566 Ga0373935_0001679
567 Ga0373927_0000137
568 Ga0373927_0006798
569 Ga0373927_0018690
570 Ga0373933_0000108
571 Ga0373933_0000961
572 Ga0373933_0026822
573 Ga0373947_0006199
574 Ga0373947_0008600
575 Ga0373947_0036007
576 Ga0373947_0097970
577 Ga0373937_0007705
578 Ga0373937_0029297
579 Ga0373937_0035980
580 Ga0373925_0002159
581 Ga0373925_0062697
582 Ga0373925_0076795
583 Ga0395900_0025734
584 Ga0395898_0027242
585 Ga0395905_0015996
586 Ga0436364_0645914
587 Ga0436364_1258003
588 Ga0395901_0609805
589 Ga0436365_1536444
590 Ga0436365_1664434
591 Ga0436360_0071874
592 Ga0436360_1094659
593 Ga0436363_1703312
594 Ga0436362_0788595
595 Ga0436362_0948918
596 Ga0466964_0031735
597 Ga0466967_0012239
598 Ga0495592_0000339
599 Ga0495592_0048953
600 Ga0495592_0064585
601 Ga0495603_0000277
602 Ga0495603_0107533
603 Ga0495629_0000029
604 Ga0495629_0002796
605 Ga0495641_0001504
606 Ga0495651_0004273
607 Ga0495651_0016412
608 Ga0495651_0256695
609 Ga0495653_0002916
610 Ga0495580_0000705
611 Ga0495580_0019991
612 Ga0495582_0000024
613 Ga0495639_0000135
614 Ga0495639_0014282
615 Ga0495662_0098104
616 Ga0495664_0006991
617 Ga0495664_0055999
618 Ga0495594_0000822
619 Ga0495606_0077003
620 Ga0495608_0002299
621 Ga0495628_0014062
622 Ga0495628_0036340
623 Ga0495630_0007650
624 Ga0495630_0018001
625 Ga0495652_0007414
626 Ga0495652_0014055
627 Ga0495652_0040545
628 Ga0495665_0000178
629 Ga0495640_0003708
630 Ga0495640_0009567
631 Ga0495586_0065823
632 Ga0495587_0002322
633 Ga0495621_0072847
634 Ga0495645_0004703
635 Ga0495622_0009145
636 Ga0495622_0076383
637 Ga0495667_0015948
638 Ga0495667_0042815
639 Ga0495634_0007096
640 Ga0495634_0035779
641 Ga0495635_0004181
642 Ga0495635_0013090
643 Ga0495588_0006153
644 Ga0495657_0023707
645 Ga0495657_0031986
646 Ga0495599_0000440
647 Ga0495599_0010340
648 Ga0495623_0004965
649 Ga0495623_0005289
650 Ga0495646_0051629
651 Ga0495646_0071664
652 Ga0495647_0013024
653 Ga0495658_0001504
654 Ga0495613_0006457
655 Ga0495624_0000788
656 Ga0495581_0000004
657 Ga0495604_0023550
658 Ga0495674_0001728
659 Ga0495674_0008604
660 Ga0495674_0054777
661 Ga0495676_0021097
662 Ga0495680_0035194
663 Ga0495675_0000801
664 Ga0495675_0028548
665 Ga0495684_0002197
666 Ga0495684_0004302
667 Ga0495684_0007205
668 Ga0495593_0000197
669 Ga0495602_0014005
670 Ga0496100_0103316
671 Ga0496101_0001342
672 Ga0496102_0013166
673 Ga0496102_0091966
674 Ga0496102_0172535
675 Ga0496104_0008089
676 Ga0496104_0016010
677 Ga0496105_0020063
678 Ga0496105_0033032
679 Ga0496106_0002085
680 Ga0496106_0002213
681 Ga0496106_0177890
682 Ga0496107_0001626
683 Ga0496107_0036725
684 Ga0496108_0246549
685 Ga0496109_0079526
686 Ga0496109_0084688
687 Ga0496110_0015096
688 Ga0496110_0257993
689 Ga0496110_0277348
690 Ga0496112_0017137
691 Ga0496112_0148618
692 Ga0496114_0018948
693 Ga0496114_0053276
694 Ga0496114_0194316
695 Ga0496115_0001562
696 Ga0496115_0013435
697 Ga0496117_0012163
698 Ga0496118_0003764
699 Ga0496121_0002004
700 Ga0496121_0088401
701 Ga0496121_0097392
702 Ga0496124_0004431
703 Ga0496124_0317346
704 Ga0496125_0082351
705 Ga0496125_0136984
706 Ga0496126_0017831
707 Ga0496126_0030015
708 Ga0496126_0058113
709 Ga0496126_0092903
710 Ga0496126_0096120
711 Ga0501043_0112884
712 nmdc:mga03683_29276_c1
713 nmdc:mga0yw44_36551_c1
714 nmdc:mga06z11_88908_c1
715 nmdc:mga0n895_118328_c1
716 nmdc:mga0n895_42830_c1
717 nmdc:mga0rr50_16069_c1
718 Ga0495601_0014688
719 Ga0500635_0003136
720 Ga0500635_0010047
721 Ga0495595_0003578
722 Ga0495595_0008429
723 Ga0495619_0012552
724 Ga0495619_0016178
725 Ga0495619_0031966
726 Ga0500566_0000223
727 Ga0500566_0006638
728 Ga0500650_0014319
729 Ga0500572_000848
730 Ga0500595_001519
731 Ga0500608_059277
732 Ga0500559_0002267
733 Ga0500603_000237
734 Ga0500627_0041663
735 Ga0500630_000468
736 Ga0500638_001847
737 Ga0500639_000031
738 Ga0500637_0002841
739 Ga0466962_0026234
740 2509151529
741 2513715392
742 2728753827
743 2885387817
744 2885411933
745 2922366731
746 8056683428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

55

410

0.9

PF01094

ANF_receptor

Receptor family ligand binding region

80

393

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lop-assembly1.cif.gz_A crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum 0.9087 40 396
4kv7-assembly1.cif.gz_A the crystal structure of a possible leucine/isoleucine/valine-binding protein from rhodopirellula baltica sh 1 0.9072 38 399
3lop-assembly1.cif.gz_A crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum 0.9038 40 396
3lkb-assembly1.cif.gz_A crystal structure of a branched chain amino acid abc transporter from thermus thermophilus with bound valine 0.8997 35 405
5ere-assembly1.cif.gz_A extracellular ligand binding receptor from desulfohalobium retbaense dsm5692 0.877 40 398
ID Description Score Start End Superfamily
3lopA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.894 159 284 3.40.50.2300
4kv7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8829 38 381 3.40.50.2300
af_Q9SHV1_60_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8785 86 138 3.40.50.2300
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8767 160 288 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8705 40 399 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V7FKW0-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9776 50 406
AF-A0A2A6NCT9-F1-model_v4 Leucine-binding protein domain-containing protein 0.9696 175 408
AF-D9XDB9-F1-model_v4 Extracellular ligand-binding receptor 0.9646 71 403
AF-A0A151FSE7-F1-model_v4 deleted 0.963 165 403
AF-A0A1I7M9Y0-F1-model_v4 deleted 0.958 85 404

Map