F426382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 373 | 262 | 746 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300025941|Ga0207711_10840567|Ga0207711_108405672 |
| Length | 153 |
| Sequence | LNGDRRSGGAPIFHLLLMSDLKLTLVVACALIDPDNRVLLAQRPPGKALAGLWEFPGGKLEPGERPEASLIRELDEELGITVREACLAPLTFASHAYETFHLLMPLYICRRWEGEVSAREGQQLAWVRPNKLRDYPMPPADIPLLPHLIDLLM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 31 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 38 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 39 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 40 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 41 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 54 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 80 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 81 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 82 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 85 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 86 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 87 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 90 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 92 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 93 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 96 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 100 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 102 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 110 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 114 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 117 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 148 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 149 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 152 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 156 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 159 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 160 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 161 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 192 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 196 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 198 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 199 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 200 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 202 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 203 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 204 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 205 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 206 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 207 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 208 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 209 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 210 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 211 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 212 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 213 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 214 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 215 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 216 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 217 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 218 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 219 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 220 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 221 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 222 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 223 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 224 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 226 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 227 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 229 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 230 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 231 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 234 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 235 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 236 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 237 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 238 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 239 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 240 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 241 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 242 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 243 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 244 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 245 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 246 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 247 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 248 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 249 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 250 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 251 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 252 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 253 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 254 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 255 | 2922425934 | |||
| 256 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 257 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 258 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 259 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 260 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 261 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 262 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.47 |
| Metatranscriptomes | 0 |
| Isolates | 7.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.91 |
| Nodule | 7.24 |
| Rhizoplane | 2.41 |
| Rhizosphere | 53.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207711_10840567 | 3300025941 | Bacteria | 854 |
| 2 | JGI24739J22299_10014370 | 3300001989 | Bacteria | 2880 |
| 3 | JGI24737J22298_10017377 | 3300001990 | Bacteria | 2318 |
| 4 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 5 | JGI25404J52841_10005411 | 3300003659 | Bacteria | 2639 |
| 6 | JGI25404J52841_10012915 | 3300003659 | Bacteria | 1811 |
| 7 | Ga0070676_11118367 | 3300005328 | Bacteria | 596 |
| 8 | Ga0070666_10282448 | 3300005335 | Bacteria | 1180 |
| 9 | Ga0070680_100566626 | 3300005336 | Bacteria | 974 |
| 10 | Ga0070659_101427235 | 3300005366 | Bacteria | 616 |
| 11 | Ga0070667_100360702 | 3300005367 | Bacteria | 1317 |
| 12 | Ga0070714_100844649 | 3300005435 | Bacteria | 888 |
| 13 | Ga0070711_100275020 | 3300005439 | Unclassified | 1330 |
| 14 | Ga0070663_100042679 | 3300005455 | Bacteria | 3188 |
| 15 | Ga0070662_100069796 | 3300005457 | Bacteria | 2588 |
| 16 | Ga0070679_100461366 | 3300005530 | Bacteria | 1215 |
| 17 | Ga0070679_101505009 | 3300005530 | Bacteria | 620 |
| 18 | Ga0068853_100019834 | 3300005539 | Bacteria | 5585 |
| 19 | Ga0070665_101678687 | 3300005548 | Bacteria | 643 |
| 20 | Ga0068855_100019461 | 3300005563 | Bacteria | 8157 |
| 21 | Ga0068855_101611552 | 3300005563 | Bacteria | 664 |
| 22 | Ga0068857_100005806 | 3300005577 | Bacteria | 10549 |
| 23 | Ga0068854_100003966 | 3300005578 | Bacteria | 9276 |
| 24 | Ga0068856_100022753 | 3300005614 | Bacteria | 6094 |
| 25 | Ga0068859_100550839 | 3300005617 | Bacteria | 1248 |
| 26 | Ga0068851_10482676 | 3300005834 | Bacteria | 741 |
| 27 | Ga0068858_100027108 | 3300005842 | Bacteria | 5323 |
| 28 | Ga0068858_101264507 | 3300005842 | Bacteria | 726 |
| 29 | Ga0068862_100307104 | 3300005844 | Bacteria | 1461 |
| 30 | Ga0081455_10061026 | 3300005937 | Bacteria | 3175 |
| 31 | Ga0081455_10286133 | 3300005937 | Bacteria | 1189 |
| 32 | Ga0081540_1008966 | 3300005983 | Bacteria | 6923 |
| 33 | Ga0081540_1071190 | 3300005983 | Bacteria | 1608 |
| 34 | Ga0070717_10811925 | 3300006028 | Bacteria | 851 |
| 35 | Ga0070717_11865667 | 3300006028 | Bacteria | 543 |
| 36 | Ga0075365_10065079 | 3300006038 | Bacteria | 2443 |
| 37 | Ga0075365_10068554 | 3300006038 | Bacteria | 2383 |
| 38 | Ga0075365_10085999 | 3300006038 | Bacteria | 2136 |
| 39 | Ga0075365_10220496 | 3300006038 | Bacteria | 1330 |
| 40 | Ga0075365_10392126 | 3300006038 | Bacteria | 980 |
| 41 | Ga0075368_10221723 | 3300006042 | Bacteria | 803 |
| 42 | Ga0075363_100251150 | 3300006048 | Bacteria | 1018 |
| 43 | Ga0075363_100571281 | 3300006048 | Bacteria | 676 |
| 44 | Ga0075363_100921630 | 3300006048 | Bacteria | 536 |
| 45 | Ga0075364_10108037 | 3300006051 | Bacteria | 1855 |
| 46 | Ga0070712_100515771 | 3300006175 | Bacteria | 1004 |
| 47 | Ga0075369_10145691 | 3300006186 | Bacteria | 1081 |
| 48 | Ga0075370_10106625 | 3300006353 | Bacteria | 1625 |
| 49 | Ga0097620_100550850 | 3300006931 | Bacteria | 1248 |
| 50 | Ga0099825_1037668 | 3300006941 | Bacteria | 1585 |
| 51 | Ga0099824_1011582 | 3300006942 | Bacteria | 9927 |
| 52 | Ga0099822_1001321 | 3300006943 | Bacteria | 28451 |
| 53 | Ga0099823_1032421 | 3300006944 | Bacteria | 4253 |
| 54 | Ga0099794_10334612 | 3300007265 | Bacteria | 786 |
| 55 | Ga0105240_10010949 | 3300009093 | Bacteria | 12707 |
| 56 | Ga0111539_11159545 | 3300009094 | Bacteria | 898 |
| 57 | Ga0105247_10486549 | 3300009101 | Bacteria | 896 |
| 58 | Ga0105248_10331440 | 3300009177 | Bacteria | 1714 |
| 59 | Ga0105248_10394502 | 3300009177 | Bacteria | 1558 |
| 60 | Ga0105237_10076009 | 3300009545 | Bacteria | 3349 |
| 61 | Ga0105237_10381534 | 3300009545 | Bacteria | 1414 |
| 62 | Ga0105238_10004205 | 3300009551 | Bacteria | 14291 |
| 63 | Ga0105238_10130331 | 3300009551 | Bacteria | 2493 |
| 64 | Ga0105239_10024643 | 3300010375 | Bacteria | 6628 |
| 65 | Ga0105239_10249799 | 3300010375 | Bacteria | 1992 |
| 66 | Ga0105239_10520527 | 3300010375 | Bacteria | 1353 |
| 67 | Ga0157371_10735848 | 3300013102 | Bacteria | 740 |
| 68 | Ga0157370_10280221 | 3300013104 | Bacteria | 1540 |
| 69 | Ga0163163_11138812 | 3300014325 | Bacteria | 843 |
| 70 | Ga0157380_10129874 | 3300014326 | Bacteria | 2147 |
| 71 | Ga0157380_10426239 | 3300014326 | Bacteria | 1267 |
| 72 | Ga0213876_10157319 | 3300021384 | Bacteria | 1209 |
| 73 | Ga0209148_1011122 | 3300025254 | Bacteria | 1682 |
| 74 | Ga0209148_1034279 | 3300025254 | Bacteria | 737 |
| 75 | Ga0209233_1003722 | 3300025261 | Bacteria | 5327 |
| 76 | Ga0209455_1006163 | 3300025272 | Bacteria | 3585 |
| 77 | Ga0209455_1008327 | 3300025272 | Bacteria | 2827 |
| 78 | Ga0209025_1093002 | 3300025294 | Bacteria | 979 |
| 79 | Ga0209564_1003384 | 3300025295 | Bacteria | 10997 |
| 80 | Ga0209564_1022630 | 3300025295 | Bacteria | 2212 |
| 81 | Ga0209758_1078960 | 3300025297 | Bacteria | 1003 |
| 82 | Ga0207710_10062524 | 3300025900 | Bacteria | 1692 |
| 83 | Ga0207680_10084917 | 3300025903 | Bacteria | 1999 |
| 84 | Ga0207647_10001617 | 3300025904 | Bacteria | 17326 |
| 85 | Ga0207647_10281948 | 3300025904 | Bacteria | 948 |
| 86 | Ga0207695_10127509 | 3300025913 | Bacteria | 2505 |
| 87 | Ga0207671_10046164 | 3300025914 | Bacteria | 3222 |
| 88 | Ga0207671_10724413 | 3300025914 | Bacteria | 790 |
| 89 | Ga0207652_10873405 | 3300025921 | Bacteria | 796 |
| 90 | Ga0207694_10013304 | 3300025924 | Bacteria | 6195 |
| 91 | Ga0207694_10083338 | 3300025924 | Bacteria | 2514 |
| 92 | Ga0207706_10055040 | 3300025933 | Bacteria | 3510 |
| 93 | Ga0207686_11274526 | 3300025934 | Bacteria | 603 |
| 94 | Ga0207667_10002298 | 3300025949 | Bacteria | 24013 |
| 95 | Ga0207667_11890580 | 3300025949 | Bacteria | 559 |
| 96 | Ga0207668_10367217 | 3300025972 | Bacteria | 1208 |
| 97 | Ga0207640_10005948 | 3300025981 | Bacteria | 6660 |
| 98 | Ga0207658_10756903 | 3300025986 | Bacteria | 880 |
| 99 | Ga0207677_10770306 | 3300026023 | Bacteria | 859 |
| 100 | Ga0207703_10017425 | 3300026035 | Bacteria | 5607 |
| 101 | Ga0207703_10595397 | 3300026035 | Bacteria | 1045 |
| 102 | Ga0207639_10002667 | 3300026041 | Bacteria | 11978 |
| 103 | Ga0207678_10052715 | 3300026067 | Bacteria | 3508 |
| 104 | Ga0207678_10301710 | 3300026067 | Bacteria | 1376 |
| 105 | Ga0207674_10007557 | 3300026116 | Bacteria | 12663 |
| 106 | Ga0207698_10603105 | 3300026142 | Bacteria | 1083 |
| 107 | Ga0207698_11472115 | 3300026142 | Bacteria | 696 |
| 108 | Ga0209389_1000110 | 3300027296 | Bacteria | 72586 |
| 109 | Ga0209589_1000026 | 3300027357 | Bacteria | 158154 |
| 110 | Ga0209489_100046 | 3300027361 | Bacteria | 158154 |
| 111 | Ga0209489_100524 | 3300027361 | Bacteria | 72457 |
| 112 | Ga0209700_100047 | 3300027363 | Bacteria | 158154 |
| 113 | Ga0209700_100334 | 3300027363 | Bacteria | 84979 |
| 114 | Ga0268266_10368479 | 3300028379 | Bacteria | 1353 |
| 115 | Ga0268266_10998166 | 3300028379 | Bacteria | 810 |
| 116 | Ga0268266_11961534 | 3300028379 | Bacteria | 559 |
| 117 | Ga0265337_1006676 | 3300028556 | Bacteria | 4407 |
| 118 | Ga0265326_10009868 | 3300028558 | Bacteria | 2849 |
| 119 | Ga0265319_1005328 | 3300028563 | Bacteria | 6174 |
| 120 | Ga0265334_10001546 | 3300028573 | Bacteria | 11100 |
| 121 | Ga0265318_10100686 | 3300028577 | Bacteria | 1063 |
| 122 | Ga0265323_10001795 | 3300028653 | Bacteria | 10187 |
| 123 | Ga0265322_10018937 | 3300028654 | Bacteria | 1976 |
| 124 | Ga0265336_10002399 | 3300028666 | Bacteria | 7759 |
| 125 | Ga0307517_10001290 | 3300028786 | Bacteria | 42017 |
| 126 | Ga0307515_10012007 | 3300028794 | Bacteria | 16357 |
| 127 | Ga0307515_10115369 | 3300028794 | Bacteria | 3095 |
| 128 | Ga0265338_10000621 | 3300028800 | Bacteria | 61786 |
| 129 | Ga0265338_10059849 | 3300028800 | Bacteria | 3353 |
| 130 | Ga0265340_10076713 | 3300031247 | Bacteria | 1578 |
| 131 | Ga0265339_10025421 | 3300031249 | Bacteria | 3398 |
| 132 | Ga0265331_10264230 | 3300031250 | Bacteria | 771 |
| 133 | Ga0265331_10409244 | 3300031250 | Bacteria | 608 |
| 134 | Ga0265316_10399761 | 3300031344 | Bacteria | 990 |
| 135 | Ga0265316_10469150 | 3300031344 | Bacteria | 902 |
| 136 | Ga0316575_10067790 | 3300031665 | Bacteria | 1431 |
| 137 | Ga0265314_10082159 | 3300031711 | Bacteria | 2120 |
| 138 | Ga0265314_10148263 | 3300031711 | Bacteria | 1442 |
| 139 | Ga0265314_10181168 | 3300031711 | Bacteria | 1262 |
| 140 | Ga0307516_11022113 | 3300031730 | Bacteria | 500 |
| 141 | Ga0307410_10915750 | 3300031852 | Bacteria | 752 |
| 142 | Ga0307412_11156994 | 3300031911 | Bacteria | 691 |
| 143 | Ga0307411_10553023 | 3300032005 | Bacteria | 982 |
| 144 | Ga0373945_0014647 | 3300035116 | Bacteria | 2631 |
| 145 | Ga0373943_0004304 | 3300035170 | Bacteria | 6462 |
| 146 | Ga0373935_0007978 | 3300035692 | Bacteria | 6348 |
| 147 | Ga0373927_0180934 | 3300035695 | Bacteria | 1383 |
| 148 | Ga0373947_0013940 | 3300035725 | Bacteria | 4607 |
| 149 | Ga0373925_0006026 | 3300037068 | Bacteria | 8973 |
| 150 | Ga0436364_0040449 | 3300037853 | Bacteria | 880 |
| 151 | Ga0436365_0679034 | 3300039437 | Bacteria | 1518 |
| 152 | Ga0436365_1088908 | 3300039437 | Bacteria | 575 |
| 153 | Ga0436365_1432156 | 3300039437 | Bacteria | 2010 |
| 154 | Ga0436363_0291744 | 3300039450 | Bacteria | 527 |
| 155 | Ga0451802_1297303 | 3300041460 | Bacteria | 560 |
| 156 | Ga0451807_0289605 | 3300041486 | Bacteria | 1004 |
| 157 | Ga0451845_0935202 | 3300041501 | Bacteria | 1167 |
| 158 | Ga0466965_0361230 | 3300044683 | Bacteria | 797 |
| 159 | Ga0495629_0417912 | 3300046459 | Bacteria | 910 |
| 160 | Ga0495638_0019032 | 3300046460 | Bacteria | 4547 |
| 161 | Ga0495638_0470058 | 3300046460 | Bacteria | 639 |
| 162 | Ga0495580_0001477 | 3300046472 | Bacteria | 20624 |
| 163 | Ga0495596_0180636 | 3300046500 | Bacteria | 820 |
| 164 | Ga0495607_0111811 | 3300046501 | Bacteria | 1447 |
| 165 | Ga0495607_0170271 | 3300046501 | Bacteria | 1100 |
| 166 | Ga0495583_0043017 | 3300046506 | Bacteria | 2106 |
| 167 | Ga0495606_0085276 | 3300046507 | Bacteria | 1954 |
| 168 | Ga0495616_0032384 | 3300046513 | Bacteria | 2731 |
| 169 | Ga0495616_0048982 | 3300046513 | Bacteria | 2120 |
| 170 | Ga0495631_0012368 | 3300046518 | Bacteria | 4170 |
| 171 | Ga0495631_0190586 | 3300046518 | Bacteria | 878 |
| 172 | Ga0495631_0194351 | 3300046518 | Bacteria | 868 |
| 173 | Ga0495643_0160646 | 3300046522 | Bacteria | 1106 |
| 174 | Ga0495648_0063759 | 3300046524 | Bacteria | 2174 |
| 175 | Ga0495648_0173256 | 3300046524 | Bacteria | 1104 |
| 176 | Ga0495654_0134438 | 3300046530 | Bacteria | 1107 |
| 177 | Ga0495645_0157873 | 3300046543 | Bacteria | 1570 |
| 178 | Ga0495611_0261047 | 3300046648 | Bacteria | 802 |
| 179 | Ga0495625_0205524 | 3300046660 | Bacteria | 1297 |
| 180 | Ga0495635_0305724 | 3300046663 | Unclassified | 1066 |
| 181 | Ga0495661_0029665 | 3300046665 | Bacteria | 3489 |
| 182 | Ga0495661_0230074 | 3300046665 | Bacteria | 956 |
| 183 | Ga0495658_0000497 | 3300046683 | Bacteria | 21583 |
| 184 | Ga0495670_0004558 | 3300046691 | Bacteria | 6798 |
| 185 | Ga0495671_0071408 | 3300046692 | Bacteria | 1705 |
| 186 | Ga0495600_0092694 | 3300046809 | Bacteria | 1970 |
| 187 | Ga0495660_0336724 | 3300046810 | Bacteria | 674 |
| 188 | Ga0495672_0297970 | 3300047320 | Bacteria | 765 |
| 189 | Ga0495676_0576516 | 3300047321 | Bacteria | 734 |
| 190 | Ga0495684_0074220 | 3300047471 | Bacteria | 2584 |
| 191 | Ga0495686_0029038 | 3300047472 | Bacteria | 3599 |
| 192 | Ga0495686_0670507 | 3300047472 | Bacteria | 531 |
| 193 | Ga0495602_0733558 | 3300048088 | Bacteria | 668 |
| 194 | Ga0495626_0038232 | 3300048091 | Bacteria | 2276 |
| 195 | Ga0496106_0020798 | 3300048909 | Bacteria | 4870 |
| 196 | Ga0496111_0062155 | 3300048914 | Bacteria | 2708 |
| 197 | Ga0496112_0276795 | 3300048915 | Bacteria | 1626 |
| 198 | Ga0496113_0934777 | 3300048916 | Bacteria | 685 |
| 199 | Ga0496114_0024895 | 3300048917 | Bacteria | 4887 |
| 200 | Ga0496115_0612712 | 3300048918 | Bacteria | 864 |
| 201 | Ga0496116_0009854 | 3300048919 | Bacteria | 8085 |
| 202 | Ga0496117_0057484 | 3300048920 | Bacteria | 2701 |
| 203 | Ga0496117_0073141 | 3300048920 | Bacteria | 2288 |
| 204 | Ga0496117_0120351 | 3300048920 | Bacteria | 1614 |
| 205 | Ga0496117_0153976 | 3300048920 | Bacteria | 1356 |
| 206 | Ga0496118_0082022 | 3300048921 | Bacteria | 2261 |
| 207 | Ga0496118_0106121 | 3300048921 | Bacteria | 1881 |
| 208 | Ga0496118_0132831 | 3300048921 | Bacteria | 1594 |
| 209 | Ga0496118_0256742 | 3300048921 | Bacteria | 989 |
| 210 | Ga0496119_0243941 | 3300048922 | Bacteria | 909 |
| 211 | Ga0496119_0329997 | 3300048922 | Bacteria | 744 |
| 212 | Ga0496120_0045007 | 3300048923 | Bacteria | 2560 |
| 213 | Ga0496121_0002554 | 3300048924 | Bacteria | 27574 |
| 214 | Ga0496121_0488685 | 3300048924 | Bacteria | 784 |
| 215 | Ga0496121_0533026 | 3300048924 | Bacteria | 738 |
| 216 | Ga0496121_0626325 | 3300048924 | Bacteria | 659 |
| 217 | Ga0496122_0042662 | 3300048925 | Bacteria | 3565 |
| 218 | Ga0496122_0211866 | 3300048925 | Bacteria | 1121 |
| 219 | Ga0496122_0365837 | 3300048925 | Bacteria | 746 |
| 220 | Ga0496123_0020379 | 3300048926 | Bacteria | 5188 |
| 221 | Ga0496123_0067505 | 3300048926 | Bacteria | 2258 |
| 222 | Ga0496124_0016867 | 3300048927 | Bacteria | 6921 |
| 223 | Ga0496124_0331638 | 3300048927 | Bacteria | 1085 |
| 224 | Ga0496125_0000904 | 3300048928 | Bacteria | 46904 |
| 225 | Ga0496125_0004420 | 3300048928 | Bacteria | 16237 |
| 226 | Ga0496125_0022357 | 3300048928 | Bacteria | 5875 |
| 227 | Ga0496125_0046908 | 3300048928 | Bacteria | 3619 |
| 228 | Ga0496125_0101171 | 3300048928 | Bacteria | 2122 |
| 229 | Ga0496126_0009773 | 3300048929 | Bacteria | 10155 |
| 230 | Ga0496126_0024845 | 3300048929 | Bacteria | 5777 |
| 231 | Ga0496126_0059273 | 3300048929 | Bacteria | 3447 |
| 232 | Ga0496126_0070519 | 3300048929 | Bacteria | 3113 |
| 233 | Ga0496126_0076086 | 3300048929 | Bacteria | 2978 |
| 234 | Ga0496126_0117150 | 3300048929 | Bacteria | 2314 |
| 235 | Ga0496126_0379736 | 3300048929 | Bacteria | 1150 |
| 236 | Ga0496126_0915936 | 3300048929 | Bacteria | 664 |
| 237 | Ga0496126_1206297 | 3300048929 | Bacteria | 556 |
| 238 | Ga0501031_0234510 | 3300049568 | Bacteria | 1193 |
| 239 | Ga0501031_0341716 | 3300049568 | Bacteria | 969 |
| 240 | Ga0501031_0492468 | 3300049568 | Bacteria | 791 |
| 241 | Ga0501031_0632402 | 3300049568 | Bacteria | 688 |
| 242 | Ga0501032_0073218 | 3300049569 | Bacteria | 2282 |
| 243 | Ga0501032_0153662 | 3300049569 | Bacteria | 1512 |
| 244 | Ga0501032_1059815 | 3300049569 | Bacteria | 508 |
| 245 | Ga0501033_0044626 | 3300049570 | Bacteria | 3299 |
| 246 | Ga0501033_0189186 | 3300049570 | Bacteria | 1473 |
| 247 | Ga0501034_0237750 | 3300049571 | Bacteria | 1768 |
| 248 | Ga0501036_0033677 | 3300049572 | Bacteria | 4332 |
| 249 | Ga0501036_0106298 | 3300049572 | Bacteria | 2373 |
| 250 | Ga0501036_0110286 | 3300049572 | Bacteria | 2325 |
| 251 | Ga0501036_0555848 | 3300049572 | Bacteria | 953 |
| 252 | Ga0501037_0075779 | 3300049573 | Bacteria | 2443 |
| 253 | Ga0501038_0001766 | 3300049574 | Bacteria | 20109 |
| 254 | Ga0501039_0165548 | 3300049575 | Bacteria | 1738 |
| 255 | Ga0501041_0899260 | 3300049577 | Bacteria | 569 |
| 256 | Ga0501042_0110493 | 3300049578 | Bacteria | 1979 |
| 257 | Ga0501043_0037026 | 3300049579 | Bacteria | 3838 |
| 258 | Ga0501043_0058947 | 3300049579 | Bacteria | 3012 |
| 259 | Ga0501043_0179435 | 3300049579 | Bacteria | 1650 |
| 260 | Ga0501046_0108139 | 3300049580 | Bacteria | 2127 |
| 261 | Ga0501046_0308876 | 3300049580 | Bacteria | 1153 |
| 262 | Ga0501047_0005547 | 3300049581 | Bacteria | 11874 |
| 263 | Ga0501047_0049101 | 3300049581 | Bacteria | 4074 |
| 264 | Ga0501048_0216980 | 3300049582 | Bacteria | 1356 |
| 265 | Ga0501067_0006865 | 3300049583 | Bacteria | 6313 |
| 266 | Ga0501068_0421584 | 3300049584 | Bacteria | 862 |
| 267 | Ga0501070_0029971 | 3300049586 | Bacteria | 4559 |
| 268 | Ga0501070_0069582 | 3300049586 | Bacteria | 2914 |
| 269 | Ga0501070_0146595 | 3300049586 | Bacteria | 1948 |
| 270 | Ga0501071_0006592 | 3300049587 | Bacteria | 7542 |
| 271 | Ga0501072_0032124 | 3300049588 | Bacteria | 4110 |
| 272 | Ga0501072_0486634 | 3300049588 | Bacteria | 976 |
| 273 | Ga0501074_0130682 | 3300049590 | Bacteria | 1796 |
| 274 | Ga0501075_1182001 | 3300049591 | Bacteria | 580 |
| 275 | Ga0501076_1585436 | 3300049592 | Bacteria | 537 |
| 276 | Ga0501080_0774656 | 3300049742 | Bacteria | 842 |
| 277 | Ga0501083_0005370 | 3300049744 | Bacteria | 9065 |
| 278 | Ga0501083_0063106 | 3300049744 | Bacteria | 2471 |
| 279 | Ga0501035_0073460 | 3300049822 | Bacteria | 3026 |
| 280 | Ga0501035_0343910 | 3300049822 | Bacteria | 1249 |
| 281 | Ga0501044_0013306 | 3300049823 | Bacteria | 8905 |
| 282 | Ga0501044_0031852 | 3300049823 | Bacteria | 5546 |
| 283 | Ga0501044_1191733 | 3300049823 | Bacteria | 629 |
| 284 | nmdc:mga00v17_863539_c1 | 3300050491 | Bacteria | 574 |
| 285 | nmdc:mga00v17_99520_c1 | 3300050491 | Bacteria | 1834 |
| 286 | nmdc:mga0yw44_13913_c1 | 3300050492 | Bacteria | 4253 |
| 287 | nmdc:mga0yw44_182507_c1 | 3300050492 | Bacteria | 1382 |
| 288 | nmdc:mga0yw44_633490_c1 | 3300050492 | Bacteria | 727 |
| 289 | nmdc:mga0yw44_79993_c1 | 3300050492 | Bacteria | 2046 |
| 290 | nmdc:mga06z11_319078_c1 | 3300050494 | Bacteria | 926 |
| 291 | nmdc:mga07m45_121900_c1 | 3300050496 | Bacteria | 1506 |
| 292 | nmdc:mga08y16_1070280_c1 | 3300050511 | Bacteria | 783 |
| 293 | nmdc:mga0sz30_190302_c1 | 3300050516 | Bacteria | 911 |
| 294 | nmdc:mga0sz30_276011_c1 | 3300050516 | Bacteria | 749 |
| 295 | Ga0500643_022242 | 3300053087 | Bacteria | 2044 |
| 296 | Ga0500643_047058 | 3300053087 | Bacteria | 1244 |
| 297 | Ga0500643_061180 | 3300053087 | Bacteria | 1057 |
| 298 | Ga0500644_0050758 | 3300053088 | Bacteria | 1421 |
| 299 | Ga0500644_0165442 | 3300053088 | Bacteria | 896 |
| 300 | Ga0500581_031256 | 3300053089 | Bacteria | 2723 |
| 301 | Ga0500646_0006123 | 3300053090 | Bacteria | 3057 |
| 302 | Ga0500651_0051099 | 3300053093 | Bacteria | 2592 |
| 303 | Ga0500651_0104089 | 3300053093 | Bacteria | 1738 |
| 304 | Ga0500566_0013226 | 3300053094 | Bacteria | 4860 |
| 305 | Ga0500641_0024716 | 3300053096 | Bacteria | 2318 |
| 306 | Ga0500641_0047864 | 3300053096 | Bacteria | 1750 |
| 307 | Ga0500650_0004684 | 3300053098 | Bacteria | 4985 |
| 308 | Ga0500554_112461 | 3300053102 | Bacteria | 916 |
| 309 | Ga0500555_044152 | 3300053103 | Bacteria | 1234 |
| 310 | Ga0500556_0000019 | 3300053104 | Bacteria | 186017 |
| 311 | Ga0500562_035293 | 3300053108 | Bacteria | 1324 |
| 312 | Ga0500562_102876 | 3300053108 | Bacteria | 777 |
| 313 | Ga0500569_000864 | 3300053109 | Bacteria | 5377 |
| 314 | Ga0500572_000149 | 3300053111 | Bacteria | 24147 |
| 315 | Ga0500592_017803 | 3300053116 | Bacteria | 1141 |
| 316 | Ga0500594_0080083 | 3300053118 | Bacteria | 975 |
| 317 | Ga0500642_0000039 | 3300053130 | Bacteria | 98235 |
| 318 | Ga0500652_001066 | 3300053131 | Bacteria | 8907 |
| 319 | Ga0500658_0009611 | 3300053134 | Bacteria | 3565 |
| 320 | Ga0500559_0000749 | 3300053136 | Bacteria | 21314 |
| 321 | Ga0500559_0005312 | 3300053136 | Bacteria | 5933 |
| 322 | Ga0500559_0228348 | 3300053136 | Bacteria | 877 |
| 323 | Ga0500568_0001467 | 3300053139 | Bacteria | 15123 |
| 324 | Ga0500577_0321900 | 3300053142 | Bacteria | 675 |
| 325 | Ga0500586_003367 | 3300053145 | Bacteria | 3770 |
| 326 | Ga0500590_050884 | 3300053148 | Bacteria | 2106 |
| 327 | Ga0500603_017782 | 3300053150 | Bacteria | 1704 |
| 328 | Ga0500604_0025269 | 3300053151 | Bacteria | 1706 |
| 329 | Ga0500616_0000059 | 3300053153 | Bacteria | 259741 |
| 330 | Ga0500619_095764 | 3300053154 | Bacteria | 1005 |
| 331 | Ga0500622_0015463 | 3300053156 | Bacteria | 4084 |
| 332 | Ga0500627_0129535 | 3300053158 | Bacteria | 1139 |
| 333 | Ga0500627_0210578 | 3300053158 | Bacteria | 869 |
| 334 | Ga0500633_0149221 | 3300053160 | Bacteria | 876 |
| 335 | Ga0500639_106555 | 3300053163 | Bacteria | 1370 |
| 336 | Ga0500636_0007761 | 3300053177 | Bacteria | 6204 |
| 337 | Ga0500636_0016432 | 3300053177 | Bacteria | 4364 |
| 338 | Ga0500576_080148 | 3300053725 | Bacteria | 1381 |
| 339 | Ga0500645_007378 | 3300053730 | Bacteria | 3837 |
| 340 | Ga0500596_003036 | 3300053735 | Bacteria | 3235 |
| 341 | Ga0501084_0541632 | 3300054114 | Bacteria | 983 |
| 342 | Ga0501084_0669215 | 3300054114 | Bacteria | 876 |
| 343 | Ga0501082_0005797 | 3300060353 | Bacteria | 10721 |
| 344 | Ga0466962_0239193 | 3300061719 | Bacteria | 891 |
| 345 | 2513660714 | 2513237096 | Bacteria | 8722461 |
| 346 | 2513862517 | 2513237137 | Bacteria | 9558895 |
| 347 | 2513876951 | 2513237139 | Bacteria | 8737671 |
| 348 | 2513922510 | 2513237145 | Bacteria | 8979722 |
| 349 | 2515624007 | 2515154112 | Bacteria | 8294334 |
| 350 | 2517888452 | 2517572143 | Bacteria | 9484767 |
| 351 | 2523467575 | 2523231067 | Bacteria | 5230452 |
| 352 | 2603862314 | 2602042107 | Bacteria | 6226103 |
| 353 | 2617353231 | 2617270735 | Bacteria | 9163226 |
| 354 | 2805921254 | 2802429603 | Bacteria | 8777136 |
| 355 | 2824701175 | 2824696289 | Bacteria | 8335049 |
| 356 | 2847930732 | 2847930680 | Bacteria | 9342022 |
| 357 | 2847942657 | 2847939898 | Bacteria | 8606328 |
| 358 | 2857525798 | 2857524615 | Bacteria | 6615449 |
| 359 | 2879089874 | 2879083081 | Bacteria | 8587928 |
| 360 | 2893067911 | 2893066018 | Bacteria | 6158120 |
| 361 | 2904699259 | 2904690495 | Bacteria | 9412302 |
| 362 | 2906639345 | 2906635258 | Bacteria | 8601019 |
| 363 | 2906668440 | 2906660503 | Bacteria | 8595048 |
| 364 | 2908758858 | 2908756301 | Bacteria | 8864324 |
| 365 | 2919074340 | 2919073203 | Bacteria | 6531949 |
| 366 | 2922426008 | |||
| 367 | 2935982199 | 2935975950 | Bacteria | 8347125 |
| 368 | 8019623347 | 8019619141 | Bacteria | 9218857 |
| 369 | 8019629748 | 8019629233 | Bacteria | 8687553 |
| 370 | 8019640868 | 8019638758 | Bacteria | 9062356 |
| 371 | 8019676330 | 8019668869 | Bacteria | 8791617 |
| 372 | 8019679667 | 8019678201 | Bacteria | 8863603 |
| 373 | 8056693973 | 8056689827 | Bacteria | 6712655 |
| 374 | Ga0207711_10840567 | |||
| 375 | JGI24739J22299_10014370 | |||
| 376 | JGI24737J22298_10017377 | |||
| 377 | JGI25165J46597_1000003 | |||
| 378 | JGI25404J52841_10005411 | |||
| 379 | JGI25404J52841_10012915 | |||
| 380 | Ga0070676_11118367 | |||
| 381 | Ga0070666_10282448 | |||
| 382 | Ga0070680_100566626 | |||
| 383 | Ga0070659_101427235 | |||
| 384 | Ga0070667_100360702 | |||
| 385 | Ga0070714_100844649 | |||
| 386 | Ga0070711_100275020 | |||
| 387 | Ga0070663_100042679 | |||
| 388 | Ga0070662_100069796 | |||
| 389 | Ga0070679_100461366 | |||
| 390 | Ga0070679_101505009 | |||
| 391 | Ga0068853_100019834 | |||
| 392 | Ga0070665_101678687 | |||
| 393 | Ga0068855_100019461 | |||
| 394 | Ga0068855_101611552 | |||
| 395 | Ga0068857_100005806 | |||
| 396 | Ga0068854_100003966 | |||
| 397 | Ga0068856_100022753 | |||
| 398 | Ga0068859_100550839 | |||
| 399 | Ga0068851_10482676 | |||
| 400 | Ga0068858_100027108 | |||
| 401 | Ga0068858_101264507 | |||
| 402 | Ga0068862_100307104 | |||
| 403 | Ga0081455_10061026 | |||
| 404 | Ga0081455_10286133 | |||
| 405 | Ga0081540_1008966 | |||
| 406 | Ga0081540_1071190 | |||
| 407 | Ga0070717_10811925 | |||
| 408 | Ga0070717_11865667 | |||
| 409 | Ga0075365_10065079 | |||
| 410 | Ga0075365_10068554 | |||
| 411 | Ga0075365_10085999 | |||
| 412 | Ga0075365_10220496 | |||
| 413 | Ga0075365_10392126 | |||
| 414 | Ga0075368_10221723 | |||
| 415 | Ga0075363_100251150 | |||
| 416 | Ga0075363_100571281 | |||
| 417 | Ga0075363_100921630 | |||
| 418 | Ga0075364_10108037 | |||
| 419 | Ga0070712_100515771 | |||
| 420 | Ga0075369_10145691 | |||
| 421 | Ga0075370_10106625 | |||
| 422 | Ga0097620_100550850 | |||
| 423 | Ga0099825_1037668 | |||
| 424 | Ga0099824_1011582 | |||
| 425 | Ga0099822_1001321 | |||
| 426 | Ga0099823_1032421 | |||
| 427 | Ga0099794_10334612 | |||
| 428 | Ga0105240_10010949 | |||
| 429 | Ga0111539_11159545 | |||
| 430 | Ga0105247_10486549 | |||
| 431 | Ga0105248_10331440 | |||
| 432 | Ga0105248_10394502 | |||
| 433 | Ga0105237_10076009 | |||
| 434 | Ga0105237_10381534 | |||
| 435 | Ga0105238_10004205 | |||
| 436 | Ga0105238_10130331 | |||
| 437 | Ga0105239_10024643 | |||
| 438 | Ga0105239_10249799 | |||
| 439 | Ga0105239_10520527 | |||
| 440 | Ga0157371_10735848 | |||
| 441 | Ga0157370_10280221 | |||
| 442 | Ga0163163_11138812 | |||
| 443 | Ga0157380_10129874 | |||
| 444 | Ga0157380_10426239 | |||
| 445 | Ga0213876_10157319 | |||
| 446 | Ga0209148_1011122 | |||
| 447 | Ga0209148_1034279 | |||
| 448 | Ga0209233_1003722 | |||
| 449 | Ga0209455_1006163 | |||
| 450 | Ga0209455_1008327 | |||
| 451 | Ga0209025_1093002 | |||
| 452 | Ga0209564_1003384 | |||
| 453 | Ga0209564_1022630 | |||
| 454 | Ga0209758_1078960 | |||
| 455 | Ga0207710_10062524 | |||
| 456 | Ga0207680_10084917 | |||
| 457 | Ga0207647_10001617 | |||
| 458 | Ga0207647_10281948 | |||
| 459 | Ga0207695_10127509 | |||
| 460 | Ga0207671_10046164 | |||
| 461 | Ga0207671_10724413 | |||
| 462 | Ga0207652_10873405 | |||
| 463 | Ga0207694_10013304 | |||
| 464 | Ga0207694_10083338 | |||
| 465 | Ga0207706_10055040 | |||
| 466 | Ga0207686_11274526 | |||
| 467 | Ga0207667_10002298 | |||
| 468 | Ga0207667_11890580 | |||
| 469 | Ga0207668_10367217 | |||
| 470 | Ga0207640_10005948 | |||
| 471 | Ga0207658_10756903 | |||
| 472 | Ga0207677_10770306 | |||
| 473 | Ga0207703_10017425 | |||
| 474 | Ga0207703_10595397 | |||
| 475 | Ga0207639_10002667 | |||
| 476 | Ga0207678_10052715 | |||
| 477 | Ga0207678_10301710 | |||
| 478 | Ga0207674_10007557 | |||
| 479 | Ga0207698_10603105 | |||
| 480 | Ga0207698_11472115 | |||
| 481 | Ga0209389_1000110 | |||
| 482 | Ga0209589_1000026 | |||
| 483 | Ga0209489_100046 | |||
| 484 | Ga0209489_100524 | |||
| 485 | Ga0209700_100047 | |||
| 486 | Ga0209700_100334 | |||
| 487 | Ga0268266_10368479 | |||
| 488 | Ga0268266_10998166 | |||
| 489 | Ga0268266_11961534 | |||
| 490 | Ga0265337_1006676 | |||
| 491 | Ga0265326_10009868 | |||
| 492 | Ga0265319_1005328 | |||
| 493 | Ga0265334_10001546 | |||
| 494 | Ga0265318_10100686 | |||
| 495 | Ga0265323_10001795 | |||
| 496 | Ga0265322_10018937 | |||
| 497 | Ga0265336_10002399 | |||
| 498 | Ga0307517_10001290 | |||
| 499 | Ga0307515_10012007 | |||
| 500 | Ga0307515_10115369 | |||
| 501 | Ga0265338_10000621 | |||
| 502 | Ga0265338_10059849 | |||
| 503 | Ga0265340_10076713 | |||
| 504 | Ga0265339_10025421 | |||
| 505 | Ga0265331_10264230 | |||
| 506 | Ga0265331_10409244 | |||
| 507 | Ga0265316_10399761 | |||
| 508 | Ga0265316_10469150 | |||
| 509 | Ga0316575_10067790 | |||
| 510 | Ga0265314_10082159 | |||
| 511 | Ga0265314_10148263 | |||
| 512 | Ga0265314_10181168 | |||
| 513 | Ga0307516_11022113 | |||
| 514 | Ga0307410_10915750 | |||
| 515 | Ga0307412_11156994 | |||
| 516 | Ga0307411_10553023 | |||
| 517 | Ga0373945_0014647 | |||
| 518 | Ga0373943_0004304 | |||
| 519 | Ga0373935_0007978 | |||
| 520 | Ga0373927_0180934 | |||
| 521 | Ga0373947_0013940 | |||
| 522 | Ga0373925_0006026 | |||
| 523 | Ga0436364_0040449 | |||
| 524 | Ga0436365_0679034 | |||
| 525 | Ga0436365_1088908 | |||
| 526 | Ga0436365_1432156 | |||
| 527 | Ga0436363_0291744 | |||
| 528 | Ga0451802_1297303 | |||
| 529 | Ga0451807_0289605 | |||
| 530 | Ga0451845_0935202 | |||
| 531 | Ga0466965_0361230 | |||
| 532 | Ga0495629_0417912 | |||
| 533 | Ga0495638_0019032 | |||
| 534 | Ga0495638_0470058 | |||
| 535 | Ga0495580_0001477 | |||
| 536 | Ga0495596_0180636 | |||
| 537 | Ga0495607_0111811 | |||
| 538 | Ga0495607_0170271 | |||
| 539 | Ga0495583_0043017 | |||
| 540 | Ga0495606_0085276 | |||
| 541 | Ga0495616_0032384 | |||
| 542 | Ga0495616_0048982 | |||
| 543 | Ga0495631_0012368 | |||
| 544 | Ga0495631_0190586 | |||
| 545 | Ga0495631_0194351 | |||
| 546 | Ga0495643_0160646 | |||
| 547 | Ga0495648_0063759 | |||
| 548 | Ga0495648_0173256 | |||
| 549 | Ga0495654_0134438 | |||
| 550 | Ga0495645_0157873 | |||
| 551 | Ga0495611_0261047 | |||
| 552 | Ga0495625_0205524 | |||
| 553 | Ga0495635_0305724 | |||
| 554 | Ga0495661_0029665 | |||
| 555 | Ga0495661_0230074 | |||
| 556 | Ga0495658_0000497 | |||
| 557 | Ga0495670_0004558 | |||
| 558 | Ga0495671_0071408 | |||
| 559 | Ga0495600_0092694 | |||
| 560 | Ga0495660_0336724 | |||
| 561 | Ga0495672_0297970 | |||
| 562 | Ga0495676_0576516 | |||
| 563 | Ga0495684_0074220 | |||
| 564 | Ga0495686_0029038 | |||
| 565 | Ga0495686_0670507 | |||
| 566 | Ga0495602_0733558 | |||
| 567 | Ga0495626_0038232 | |||
| 568 | Ga0496106_0020798 | |||
| 569 | Ga0496111_0062155 | |||
| 570 | Ga0496112_0276795 | |||
| 571 | Ga0496113_0934777 | |||
| 572 | Ga0496114_0024895 | |||
| 573 | Ga0496115_0612712 | |||
| 574 | Ga0496116_0009854 | |||
| 575 | Ga0496117_0057484 | |||
| 576 | Ga0496117_0073141 | |||
| 577 | Ga0496117_0120351 | |||
| 578 | Ga0496117_0153976 | |||
| 579 | Ga0496118_0082022 | |||
| 580 | Ga0496118_0106121 | |||
| 581 | Ga0496118_0132831 | |||
| 582 | Ga0496118_0256742 | |||
| 583 | Ga0496119_0243941 | |||
| 584 | Ga0496119_0329997 | |||
| 585 | Ga0496120_0045007 | |||
| 586 | Ga0496121_0002554 | |||
| 587 | Ga0496121_0488685 | |||
| 588 | Ga0496121_0533026 | |||
| 589 | Ga0496121_0626325 | |||
| 590 | Ga0496122_0042662 | |||
| 591 | Ga0496122_0211866 | |||
| 592 | Ga0496122_0365837 | |||
| 593 | Ga0496123_0020379 | |||
| 594 | Ga0496123_0067505 | |||
| 595 | Ga0496124_0016867 | |||
| 596 | Ga0496124_0331638 | |||
| 597 | Ga0496125_0000904 | |||
| 598 | Ga0496125_0004420 | |||
| 599 | Ga0496125_0022357 | |||
| 600 | Ga0496125_0046908 | |||
| 601 | Ga0496125_0101171 | |||
| 602 | Ga0496126_0009773 | |||
| 603 | Ga0496126_0024845 | |||
| 604 | Ga0496126_0059273 | |||
| 605 | Ga0496126_0070519 | |||
| 606 | Ga0496126_0076086 | |||
| 607 | Ga0496126_0117150 | |||
| 608 | Ga0496126_0379736 | |||
| 609 | Ga0496126_0915936 | |||
| 610 | Ga0496126_1206297 | |||
| 611 | Ga0501031_0234510 | |||
| 612 | Ga0501031_0341716 | |||
| 613 | Ga0501031_0492468 | |||
| 614 | Ga0501031_0632402 | |||
| 615 | Ga0501032_0073218 | |||
| 616 | Ga0501032_0153662 | |||
| 617 | Ga0501032_1059815 | |||
| 618 | Ga0501033_0044626 | |||
| 619 | Ga0501033_0189186 | |||
| 620 | Ga0501034_0237750 | |||
| 621 | Ga0501036_0033677 | |||
| 622 | Ga0501036_0106298 | |||
| 623 | Ga0501036_0110286 | |||
| 624 | Ga0501036_0555848 | |||
| 625 | Ga0501037_0075779 | |||
| 626 | Ga0501038_0001766 | |||
| 627 | Ga0501039_0165548 | |||
| 628 | Ga0501041_0899260 | |||
| 629 | Ga0501042_0110493 | |||
| 630 | Ga0501043_0037026 | |||
| 631 | Ga0501043_0058947 | |||
| 632 | Ga0501043_0179435 | |||
| 633 | Ga0501046_0108139 | |||
| 634 | Ga0501046_0308876 | |||
| 635 | Ga0501047_0005547 | |||
| 636 | Ga0501047_0049101 | |||
| 637 | Ga0501048_0216980 | |||
| 638 | Ga0501067_0006865 | |||
| 639 | Ga0501068_0421584 | |||
| 640 | Ga0501070_0029971 | |||
| 641 | Ga0501070_0069582 | |||
| 642 | Ga0501070_0146595 | |||
| 643 | Ga0501071_0006592 | |||
| 644 | Ga0501072_0032124 | |||
| 645 | Ga0501072_0486634 | |||
| 646 | Ga0501074_0130682 | |||
| 647 | Ga0501075_1182001 | |||
| 648 | Ga0501076_1585436 | |||
| 649 | Ga0501080_0774656 | |||
| 650 | Ga0501083_0005370 | |||
| 651 | Ga0501083_0063106 | |||
| 652 | Ga0501035_0073460 | |||
| 653 | Ga0501035_0343910 | |||
| 654 | Ga0501044_0013306 | |||
| 655 | Ga0501044_0031852 | |||
| 656 | Ga0501044_1191733 | |||
| 657 | nmdc:mga00v17_863539_c1 | |||
| 658 | nmdc:mga00v17_99520_c1 | |||
| 659 | nmdc:mga0yw44_13913_c1 | |||
| 660 | nmdc:mga0yw44_182507_c1 | |||
| 661 | nmdc:mga0yw44_633490_c1 | |||
| 662 | nmdc:mga0yw44_79993_c1 | |||
| 663 | nmdc:mga06z11_319078_c1 | |||
| 664 | nmdc:mga07m45_121900_c1 | |||
| 665 | nmdc:mga08y16_1070280_c1 | |||
| 666 | nmdc:mga0sz30_190302_c1 | |||
| 667 | nmdc:mga0sz30_276011_c1 | |||
| 668 | Ga0500643_022242 | |||
| 669 | Ga0500643_047058 | |||
| 670 | Ga0500643_061180 | |||
| 671 | Ga0500644_0050758 | |||
| 672 | Ga0500644_0165442 | |||
| 673 | Ga0500581_031256 | |||
| 674 | Ga0500646_0006123 | |||
| 675 | Ga0500651_0051099 | |||
| 676 | Ga0500651_0104089 | |||
| 677 | Ga0500566_0013226 | |||
| 678 | Ga0500641_0024716 | |||
| 679 | Ga0500641_0047864 | |||
| 680 | Ga0500650_0004684 | |||
| 681 | Ga0500554_112461 | |||
| 682 | Ga0500555_044152 | |||
| 683 | Ga0500556_0000019 | |||
| 684 | Ga0500562_035293 | |||
| 685 | Ga0500562_102876 | |||
| 686 | Ga0500569_000864 | |||
| 687 | Ga0500572_000149 | |||
| 688 | Ga0500592_017803 | |||
| 689 | Ga0500594_0080083 | |||
| 690 | Ga0500642_0000039 | |||
| 691 | Ga0500652_001066 | |||
| 692 | Ga0500658_0009611 | |||
| 693 | Ga0500559_0000749 | |||
| 694 | Ga0500559_0005312 | |||
| 695 | Ga0500559_0228348 | |||
| 696 | Ga0500568_0001467 | |||
| 697 | Ga0500577_0321900 | |||
| 698 | Ga0500586_003367 | |||
| 699 | Ga0500590_050884 | |||
| 700 | Ga0500603_017782 | |||
| 701 | Ga0500604_0025269 | |||
| 702 | Ga0500616_0000059 | |||
| 703 | Ga0500619_095764 | |||
| 704 | Ga0500622_0015463 | |||
| 705 | Ga0500627_0129535 | |||
| 706 | Ga0500627_0210578 | |||
| 707 | Ga0500633_0149221 | |||
| 708 | Ga0500639_106555 | |||
| 709 | Ga0500636_0007761 | |||
| 710 | Ga0500636_0016432 | |||
| 711 | Ga0500576_080148 | |||
| 712 | Ga0500645_007378 | |||
| 713 | Ga0500596_003036 | |||
| 714 | Ga0501084_0541632 | |||
| 715 | Ga0501084_0669215 | |||
| 716 | Ga0501082_0005797 | |||
| 717 | Ga0466962_0239193 | |||
| 718 | 2513660714 | |||
| 719 | 2513862517 | |||
| 720 | 2513876951 | |||
| 721 | 2513922510 | |||
| 722 | 2515624007 | |||
| 723 | 2517888452 | |||
| 724 | 2523467575 | |||
| 725 | 2603862314 | |||
| 726 | 2617353231 | |||
| 727 | 2805921254 | |||
| 728 | 2824701175 | |||
| 729 | 2847930732 | |||
| 730 | 2847942657 | |||
| 731 | 2857525798 | |||
| 732 | 2879089874 | |||
| 733 | 2893067911 | |||
| 734 | 2904699259 | |||
| 735 | 2906639345 | |||
| 736 | 2906668440 | |||
| 737 | 2908758858 | |||
| 738 | 2919074340 | |||
| 739 | 2922426008 | |||
| 740 | 2935982199 | |||
| 741 | 8019623347 | |||
| 742 | 8019629748 | |||
| 743 | 8019640868 | |||
| 744 | 8019676330 | |||
| 745 | 8019679667 | |||
| 746 | 8056693973 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r03-assembly1.cif.gz_A | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9803 | 6 | 136 |
| 3r03-assembly1.cif.gz_B | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.975 | 5 | 136 |
| 3r03-assembly1.cif.gz_A | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9729 | 6 | 136 |
| 3r03-assembly1.cif.gz_B | the crystal structure of nudix hydrolase from rhodospirillum rubrum | 0.9529 | 5 | 136 |
| 3hhj-assembly1.cif.gz_A | crystal structure of mutator mutt from bartonella henselae | 0.952 | 6 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r03B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9742 | 5 | 136 | 3.90.79.10 |
| 3r03B00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9518 | 5 | 136 | 3.90.79.10 |
| 3eesB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9342 | 6 | 134 | 3.90.79.10 |
| af_P77788_1_135_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9316 | 5 | 135 | 3.90.79.10 |
| af_Q54BB8_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9292 | 6 | 134 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R2H086-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9983 | 5 | 135 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A437M385-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.997 | 5 | 136 |
GO:0006260
GO:0006281 GO:0008413 GO:0016747 GO:0035539 GO:0044715 GO:0044716 |
| AF-A0A5M6ISQ9-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9968 | 6 | 136 |
GO:0006260
GO:0006281 GO:0008413 GO:0016747 GO:0035539 GO:0044715 GO:0044716 |
| AF-I4YM82-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9966 | 5 | 137 |
GO:0006260
GO:0006281 GO:0008413 GO:0035539 GO:0044715 GO:0044716 GO:0046872 |
| AF-A0A1Q3V1T2-F1-model_v4 | 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) | 0.9962 | 4 | 136 |
GO:0006260
GO:0006281 GO:0008413 GO:0016747 GO:0035539 GO:0044715 GO:0044716 GO:0046872 |