F426382

General Info

Members Datasets Scaffolds Average Seq Length
373 262 746 135

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_10840567|Ga0207711_108405672
Length 153
Sequence LNGDRRSGGAPIFHLLLMSDLKLTLVVACALIDPDNRVLLAQRPPGKALAGLWEFPGGKLEPGERPEASLIRELDEELGITVREACLAPLTFASHAYETFHLLMPLYICRRWEGEVSAREGQQLAWVRPNKLRDYPMPPADIPLLPHLIDLLM

Samples

Sample ID Description Type Environment
1 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
38 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
39 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
40 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
80 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
81 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
82 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
90 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
198 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
203 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
204 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
207 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
208 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
209 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
210 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
220 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
226 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
235 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
236 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
237 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
238 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
239 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
240 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
241 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
242 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
243 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
244 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
245 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
246 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
247 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
248 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
249 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
250 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
251 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
252 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
253 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
254 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
255 2922425934
256 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
257 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
258 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
259 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
260 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
261 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
262 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 0
Isolates 7.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.91
Nodule 7.24
Rhizoplane 2.41
Rhizosphere 53.62
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207711_10840567 3300025941 Bacteria 854
2 JGI24739J22299_10014370 3300001989 Bacteria 2880
3 JGI24737J22298_10017377 3300001990 Bacteria 2318
4 JGI25165J46597_1000003 3300003214 Bacteria 694080
5 JGI25404J52841_10005411 3300003659 Bacteria 2639
6 JGI25404J52841_10012915 3300003659 Bacteria 1811
7 Ga0070676_11118367 3300005328 Bacteria 596
8 Ga0070666_10282448 3300005335 Bacteria 1180
9 Ga0070680_100566626 3300005336 Bacteria 974
10 Ga0070659_101427235 3300005366 Bacteria 616
11 Ga0070667_100360702 3300005367 Bacteria 1317
12 Ga0070714_100844649 3300005435 Bacteria 888
13 Ga0070711_100275020 3300005439 Unclassified 1330
14 Ga0070663_100042679 3300005455 Bacteria 3188
15 Ga0070662_100069796 3300005457 Bacteria 2588
16 Ga0070679_100461366 3300005530 Bacteria 1215
17 Ga0070679_101505009 3300005530 Bacteria 620
18 Ga0068853_100019834 3300005539 Bacteria 5585
19 Ga0070665_101678687 3300005548 Bacteria 643
20 Ga0068855_100019461 3300005563 Bacteria 8157
21 Ga0068855_101611552 3300005563 Bacteria 664
22 Ga0068857_100005806 3300005577 Bacteria 10549
23 Ga0068854_100003966 3300005578 Bacteria 9276
24 Ga0068856_100022753 3300005614 Bacteria 6094
25 Ga0068859_100550839 3300005617 Bacteria 1248
26 Ga0068851_10482676 3300005834 Bacteria 741
27 Ga0068858_100027108 3300005842 Bacteria 5323
28 Ga0068858_101264507 3300005842 Bacteria 726
29 Ga0068862_100307104 3300005844 Bacteria 1461
30 Ga0081455_10061026 3300005937 Bacteria 3175
31 Ga0081455_10286133 3300005937 Bacteria 1189
32 Ga0081540_1008966 3300005983 Bacteria 6923
33 Ga0081540_1071190 3300005983 Bacteria 1608
34 Ga0070717_10811925 3300006028 Bacteria 851
35 Ga0070717_11865667 3300006028 Bacteria 543
36 Ga0075365_10065079 3300006038 Bacteria 2443
37 Ga0075365_10068554 3300006038 Bacteria 2383
38 Ga0075365_10085999 3300006038 Bacteria 2136
39 Ga0075365_10220496 3300006038 Bacteria 1330
40 Ga0075365_10392126 3300006038 Bacteria 980
41 Ga0075368_10221723 3300006042 Bacteria 803
42 Ga0075363_100251150 3300006048 Bacteria 1018
43 Ga0075363_100571281 3300006048 Bacteria 676
44 Ga0075363_100921630 3300006048 Bacteria 536
45 Ga0075364_10108037 3300006051 Bacteria 1855
46 Ga0070712_100515771 3300006175 Bacteria 1004
47 Ga0075369_10145691 3300006186 Bacteria 1081
48 Ga0075370_10106625 3300006353 Bacteria 1625
49 Ga0097620_100550850 3300006931 Bacteria 1248
50 Ga0099825_1037668 3300006941 Bacteria 1585
51 Ga0099824_1011582 3300006942 Bacteria 9927
52 Ga0099822_1001321 3300006943 Bacteria 28451
53 Ga0099823_1032421 3300006944 Bacteria 4253
54 Ga0099794_10334612 3300007265 Bacteria 786
55 Ga0105240_10010949 3300009093 Bacteria 12707
56 Ga0111539_11159545 3300009094 Bacteria 898
57 Ga0105247_10486549 3300009101 Bacteria 896
58 Ga0105248_10331440 3300009177 Bacteria 1714
59 Ga0105248_10394502 3300009177 Bacteria 1558
60 Ga0105237_10076009 3300009545 Bacteria 3349
61 Ga0105237_10381534 3300009545 Bacteria 1414
62 Ga0105238_10004205 3300009551 Bacteria 14291
63 Ga0105238_10130331 3300009551 Bacteria 2493
64 Ga0105239_10024643 3300010375 Bacteria 6628
65 Ga0105239_10249799 3300010375 Bacteria 1992
66 Ga0105239_10520527 3300010375 Bacteria 1353
67 Ga0157371_10735848 3300013102 Bacteria 740
68 Ga0157370_10280221 3300013104 Bacteria 1540
69 Ga0163163_11138812 3300014325 Bacteria 843
70 Ga0157380_10129874 3300014326 Bacteria 2147
71 Ga0157380_10426239 3300014326 Bacteria 1267
72 Ga0213876_10157319 3300021384 Bacteria 1209
73 Ga0209148_1011122 3300025254 Bacteria 1682
74 Ga0209148_1034279 3300025254 Bacteria 737
75 Ga0209233_1003722 3300025261 Bacteria 5327
76 Ga0209455_1006163 3300025272 Bacteria 3585
77 Ga0209455_1008327 3300025272 Bacteria 2827
78 Ga0209025_1093002 3300025294 Bacteria 979
79 Ga0209564_1003384 3300025295 Bacteria 10997
80 Ga0209564_1022630 3300025295 Bacteria 2212
81 Ga0209758_1078960 3300025297 Bacteria 1003
82 Ga0207710_10062524 3300025900 Bacteria 1692
83 Ga0207680_10084917 3300025903 Bacteria 1999
84 Ga0207647_10001617 3300025904 Bacteria 17326
85 Ga0207647_10281948 3300025904 Bacteria 948
86 Ga0207695_10127509 3300025913 Bacteria 2505
87 Ga0207671_10046164 3300025914 Bacteria 3222
88 Ga0207671_10724413 3300025914 Bacteria 790
89 Ga0207652_10873405 3300025921 Bacteria 796
90 Ga0207694_10013304 3300025924 Bacteria 6195
91 Ga0207694_10083338 3300025924 Bacteria 2514
92 Ga0207706_10055040 3300025933 Bacteria 3510
93 Ga0207686_11274526 3300025934 Bacteria 603
94 Ga0207667_10002298 3300025949 Bacteria 24013
95 Ga0207667_11890580 3300025949 Bacteria 559
96 Ga0207668_10367217 3300025972 Bacteria 1208
97 Ga0207640_10005948 3300025981 Bacteria 6660
98 Ga0207658_10756903 3300025986 Bacteria 880
99 Ga0207677_10770306 3300026023 Bacteria 859
100 Ga0207703_10017425 3300026035 Bacteria 5607
101 Ga0207703_10595397 3300026035 Bacteria 1045
102 Ga0207639_10002667 3300026041 Bacteria 11978
103 Ga0207678_10052715 3300026067 Bacteria 3508
104 Ga0207678_10301710 3300026067 Bacteria 1376
105 Ga0207674_10007557 3300026116 Bacteria 12663
106 Ga0207698_10603105 3300026142 Bacteria 1083
107 Ga0207698_11472115 3300026142 Bacteria 696
108 Ga0209389_1000110 3300027296 Bacteria 72586
109 Ga0209589_1000026 3300027357 Bacteria 158154
110 Ga0209489_100046 3300027361 Bacteria 158154
111 Ga0209489_100524 3300027361 Bacteria 72457
112 Ga0209700_100047 3300027363 Bacteria 158154
113 Ga0209700_100334 3300027363 Bacteria 84979
114 Ga0268266_10368479 3300028379 Bacteria 1353
115 Ga0268266_10998166 3300028379 Bacteria 810
116 Ga0268266_11961534 3300028379 Bacteria 559
117 Ga0265337_1006676 3300028556 Bacteria 4407
118 Ga0265326_10009868 3300028558 Bacteria 2849
119 Ga0265319_1005328 3300028563 Bacteria 6174
120 Ga0265334_10001546 3300028573 Bacteria 11100
121 Ga0265318_10100686 3300028577 Bacteria 1063
122 Ga0265323_10001795 3300028653 Bacteria 10187
123 Ga0265322_10018937 3300028654 Bacteria 1976
124 Ga0265336_10002399 3300028666 Bacteria 7759
125 Ga0307517_10001290 3300028786 Bacteria 42017
126 Ga0307515_10012007 3300028794 Bacteria 16357
127 Ga0307515_10115369 3300028794 Bacteria 3095
128 Ga0265338_10000621 3300028800 Bacteria 61786
129 Ga0265338_10059849 3300028800 Bacteria 3353
130 Ga0265340_10076713 3300031247 Bacteria 1578
131 Ga0265339_10025421 3300031249 Bacteria 3398
132 Ga0265331_10264230 3300031250 Bacteria 771
133 Ga0265331_10409244 3300031250 Bacteria 608
134 Ga0265316_10399761 3300031344 Bacteria 990
135 Ga0265316_10469150 3300031344 Bacteria 902
136 Ga0316575_10067790 3300031665 Bacteria 1431
137 Ga0265314_10082159 3300031711 Bacteria 2120
138 Ga0265314_10148263 3300031711 Bacteria 1442
139 Ga0265314_10181168 3300031711 Bacteria 1262
140 Ga0307516_11022113 3300031730 Bacteria 500
141 Ga0307410_10915750 3300031852 Bacteria 752
142 Ga0307412_11156994 3300031911 Bacteria 691
143 Ga0307411_10553023 3300032005 Bacteria 982
144 Ga0373945_0014647 3300035116 Bacteria 2631
145 Ga0373943_0004304 3300035170 Bacteria 6462
146 Ga0373935_0007978 3300035692 Bacteria 6348
147 Ga0373927_0180934 3300035695 Bacteria 1383
148 Ga0373947_0013940 3300035725 Bacteria 4607
149 Ga0373925_0006026 3300037068 Bacteria 8973
150 Ga0436364_0040449 3300037853 Bacteria 880
151 Ga0436365_0679034 3300039437 Bacteria 1518
152 Ga0436365_1088908 3300039437 Bacteria 575
153 Ga0436365_1432156 3300039437 Bacteria 2010
154 Ga0436363_0291744 3300039450 Bacteria 527
155 Ga0451802_1297303 3300041460 Bacteria 560
156 Ga0451807_0289605 3300041486 Bacteria 1004
157 Ga0451845_0935202 3300041501 Bacteria 1167
158 Ga0466965_0361230 3300044683 Bacteria 797
159 Ga0495629_0417912 3300046459 Bacteria 910
160 Ga0495638_0019032 3300046460 Bacteria 4547
161 Ga0495638_0470058 3300046460 Bacteria 639
162 Ga0495580_0001477 3300046472 Bacteria 20624
163 Ga0495596_0180636 3300046500 Bacteria 820
164 Ga0495607_0111811 3300046501 Bacteria 1447
165 Ga0495607_0170271 3300046501 Bacteria 1100
166 Ga0495583_0043017 3300046506 Bacteria 2106
167 Ga0495606_0085276 3300046507 Bacteria 1954
168 Ga0495616_0032384 3300046513 Bacteria 2731
169 Ga0495616_0048982 3300046513 Bacteria 2120
170 Ga0495631_0012368 3300046518 Bacteria 4170
171 Ga0495631_0190586 3300046518 Bacteria 878
172 Ga0495631_0194351 3300046518 Bacteria 868
173 Ga0495643_0160646 3300046522 Bacteria 1106
174 Ga0495648_0063759 3300046524 Bacteria 2174
175 Ga0495648_0173256 3300046524 Bacteria 1104
176 Ga0495654_0134438 3300046530 Bacteria 1107
177 Ga0495645_0157873 3300046543 Bacteria 1570
178 Ga0495611_0261047 3300046648 Bacteria 802
179 Ga0495625_0205524 3300046660 Bacteria 1297
180 Ga0495635_0305724 3300046663 Unclassified 1066
181 Ga0495661_0029665 3300046665 Bacteria 3489
182 Ga0495661_0230074 3300046665 Bacteria 956
183 Ga0495658_0000497 3300046683 Bacteria 21583
184 Ga0495670_0004558 3300046691 Bacteria 6798
185 Ga0495671_0071408 3300046692 Bacteria 1705
186 Ga0495600_0092694 3300046809 Bacteria 1970
187 Ga0495660_0336724 3300046810 Bacteria 674
188 Ga0495672_0297970 3300047320 Bacteria 765
189 Ga0495676_0576516 3300047321 Bacteria 734
190 Ga0495684_0074220 3300047471 Bacteria 2584
191 Ga0495686_0029038 3300047472 Bacteria 3599
192 Ga0495686_0670507 3300047472 Bacteria 531
193 Ga0495602_0733558 3300048088 Bacteria 668
194 Ga0495626_0038232 3300048091 Bacteria 2276
195 Ga0496106_0020798 3300048909 Bacteria 4870
196 Ga0496111_0062155 3300048914 Bacteria 2708
197 Ga0496112_0276795 3300048915 Bacteria 1626
198 Ga0496113_0934777 3300048916 Bacteria 685
199 Ga0496114_0024895 3300048917 Bacteria 4887
200 Ga0496115_0612712 3300048918 Bacteria 864
201 Ga0496116_0009854 3300048919 Bacteria 8085
202 Ga0496117_0057484 3300048920 Bacteria 2701
203 Ga0496117_0073141 3300048920 Bacteria 2288
204 Ga0496117_0120351 3300048920 Bacteria 1614
205 Ga0496117_0153976 3300048920 Bacteria 1356
206 Ga0496118_0082022 3300048921 Bacteria 2261
207 Ga0496118_0106121 3300048921 Bacteria 1881
208 Ga0496118_0132831 3300048921 Bacteria 1594
209 Ga0496118_0256742 3300048921 Bacteria 989
210 Ga0496119_0243941 3300048922 Bacteria 909
211 Ga0496119_0329997 3300048922 Bacteria 744
212 Ga0496120_0045007 3300048923 Bacteria 2560
213 Ga0496121_0002554 3300048924 Bacteria 27574
214 Ga0496121_0488685 3300048924 Bacteria 784
215 Ga0496121_0533026 3300048924 Bacteria 738
216 Ga0496121_0626325 3300048924 Bacteria 659
217 Ga0496122_0042662 3300048925 Bacteria 3565
218 Ga0496122_0211866 3300048925 Bacteria 1121
219 Ga0496122_0365837 3300048925 Bacteria 746
220 Ga0496123_0020379 3300048926 Bacteria 5188
221 Ga0496123_0067505 3300048926 Bacteria 2258
222 Ga0496124_0016867 3300048927 Bacteria 6921
223 Ga0496124_0331638 3300048927 Bacteria 1085
224 Ga0496125_0000904 3300048928 Bacteria 46904
225 Ga0496125_0004420 3300048928 Bacteria 16237
226 Ga0496125_0022357 3300048928 Bacteria 5875
227 Ga0496125_0046908 3300048928 Bacteria 3619
228 Ga0496125_0101171 3300048928 Bacteria 2122
229 Ga0496126_0009773 3300048929 Bacteria 10155
230 Ga0496126_0024845 3300048929 Bacteria 5777
231 Ga0496126_0059273 3300048929 Bacteria 3447
232 Ga0496126_0070519 3300048929 Bacteria 3113
233 Ga0496126_0076086 3300048929 Bacteria 2978
234 Ga0496126_0117150 3300048929 Bacteria 2314
235 Ga0496126_0379736 3300048929 Bacteria 1150
236 Ga0496126_0915936 3300048929 Bacteria 664
237 Ga0496126_1206297 3300048929 Bacteria 556
238 Ga0501031_0234510 3300049568 Bacteria 1193
239 Ga0501031_0341716 3300049568 Bacteria 969
240 Ga0501031_0492468 3300049568 Bacteria 791
241 Ga0501031_0632402 3300049568 Bacteria 688
242 Ga0501032_0073218 3300049569 Bacteria 2282
243 Ga0501032_0153662 3300049569 Bacteria 1512
244 Ga0501032_1059815 3300049569 Bacteria 508
245 Ga0501033_0044626 3300049570 Bacteria 3299
246 Ga0501033_0189186 3300049570 Bacteria 1473
247 Ga0501034_0237750 3300049571 Bacteria 1768
248 Ga0501036_0033677 3300049572 Bacteria 4332
249 Ga0501036_0106298 3300049572 Bacteria 2373
250 Ga0501036_0110286 3300049572 Bacteria 2325
251 Ga0501036_0555848 3300049572 Bacteria 953
252 Ga0501037_0075779 3300049573 Bacteria 2443
253 Ga0501038_0001766 3300049574 Bacteria 20109
254 Ga0501039_0165548 3300049575 Bacteria 1738
255 Ga0501041_0899260 3300049577 Bacteria 569
256 Ga0501042_0110493 3300049578 Bacteria 1979
257 Ga0501043_0037026 3300049579 Bacteria 3838
258 Ga0501043_0058947 3300049579 Bacteria 3012
259 Ga0501043_0179435 3300049579 Bacteria 1650
260 Ga0501046_0108139 3300049580 Bacteria 2127
261 Ga0501046_0308876 3300049580 Bacteria 1153
262 Ga0501047_0005547 3300049581 Bacteria 11874
263 Ga0501047_0049101 3300049581 Bacteria 4074
264 Ga0501048_0216980 3300049582 Bacteria 1356
265 Ga0501067_0006865 3300049583 Bacteria 6313
266 Ga0501068_0421584 3300049584 Bacteria 862
267 Ga0501070_0029971 3300049586 Bacteria 4559
268 Ga0501070_0069582 3300049586 Bacteria 2914
269 Ga0501070_0146595 3300049586 Bacteria 1948
270 Ga0501071_0006592 3300049587 Bacteria 7542
271 Ga0501072_0032124 3300049588 Bacteria 4110
272 Ga0501072_0486634 3300049588 Bacteria 976
273 Ga0501074_0130682 3300049590 Bacteria 1796
274 Ga0501075_1182001 3300049591 Bacteria 580
275 Ga0501076_1585436 3300049592 Bacteria 537
276 Ga0501080_0774656 3300049742 Bacteria 842
277 Ga0501083_0005370 3300049744 Bacteria 9065
278 Ga0501083_0063106 3300049744 Bacteria 2471
279 Ga0501035_0073460 3300049822 Bacteria 3026
280 Ga0501035_0343910 3300049822 Bacteria 1249
281 Ga0501044_0013306 3300049823 Bacteria 8905
282 Ga0501044_0031852 3300049823 Bacteria 5546
283 Ga0501044_1191733 3300049823 Bacteria 629
284 nmdc:mga00v17_863539_c1 3300050491 Bacteria 574
285 nmdc:mga00v17_99520_c1 3300050491 Bacteria 1834
286 nmdc:mga0yw44_13913_c1 3300050492 Bacteria 4253
287 nmdc:mga0yw44_182507_c1 3300050492 Bacteria 1382
288 nmdc:mga0yw44_633490_c1 3300050492 Bacteria 727
289 nmdc:mga0yw44_79993_c1 3300050492 Bacteria 2046
290 nmdc:mga06z11_319078_c1 3300050494 Bacteria 926
291 nmdc:mga07m45_121900_c1 3300050496 Bacteria 1506
292 nmdc:mga08y16_1070280_c1 3300050511 Bacteria 783
293 nmdc:mga0sz30_190302_c1 3300050516 Bacteria 911
294 nmdc:mga0sz30_276011_c1 3300050516 Bacteria 749
295 Ga0500643_022242 3300053087 Bacteria 2044
296 Ga0500643_047058 3300053087 Bacteria 1244
297 Ga0500643_061180 3300053087 Bacteria 1057
298 Ga0500644_0050758 3300053088 Bacteria 1421
299 Ga0500644_0165442 3300053088 Bacteria 896
300 Ga0500581_031256 3300053089 Bacteria 2723
301 Ga0500646_0006123 3300053090 Bacteria 3057
302 Ga0500651_0051099 3300053093 Bacteria 2592
303 Ga0500651_0104089 3300053093 Bacteria 1738
304 Ga0500566_0013226 3300053094 Bacteria 4860
305 Ga0500641_0024716 3300053096 Bacteria 2318
306 Ga0500641_0047864 3300053096 Bacteria 1750
307 Ga0500650_0004684 3300053098 Bacteria 4985
308 Ga0500554_112461 3300053102 Bacteria 916
309 Ga0500555_044152 3300053103 Bacteria 1234
310 Ga0500556_0000019 3300053104 Bacteria 186017
311 Ga0500562_035293 3300053108 Bacteria 1324
312 Ga0500562_102876 3300053108 Bacteria 777
313 Ga0500569_000864 3300053109 Bacteria 5377
314 Ga0500572_000149 3300053111 Bacteria 24147
315 Ga0500592_017803 3300053116 Bacteria 1141
316 Ga0500594_0080083 3300053118 Bacteria 975
317 Ga0500642_0000039 3300053130 Bacteria 98235
318 Ga0500652_001066 3300053131 Bacteria 8907
319 Ga0500658_0009611 3300053134 Bacteria 3565
320 Ga0500559_0000749 3300053136 Bacteria 21314
321 Ga0500559_0005312 3300053136 Bacteria 5933
322 Ga0500559_0228348 3300053136 Bacteria 877
323 Ga0500568_0001467 3300053139 Bacteria 15123
324 Ga0500577_0321900 3300053142 Bacteria 675
325 Ga0500586_003367 3300053145 Bacteria 3770
326 Ga0500590_050884 3300053148 Bacteria 2106
327 Ga0500603_017782 3300053150 Bacteria 1704
328 Ga0500604_0025269 3300053151 Bacteria 1706
329 Ga0500616_0000059 3300053153 Bacteria 259741
330 Ga0500619_095764 3300053154 Bacteria 1005
331 Ga0500622_0015463 3300053156 Bacteria 4084
332 Ga0500627_0129535 3300053158 Bacteria 1139
333 Ga0500627_0210578 3300053158 Bacteria 869
334 Ga0500633_0149221 3300053160 Bacteria 876
335 Ga0500639_106555 3300053163 Bacteria 1370
336 Ga0500636_0007761 3300053177 Bacteria 6204
337 Ga0500636_0016432 3300053177 Bacteria 4364
338 Ga0500576_080148 3300053725 Bacteria 1381
339 Ga0500645_007378 3300053730 Bacteria 3837
340 Ga0500596_003036 3300053735 Bacteria 3235
341 Ga0501084_0541632 3300054114 Bacteria 983
342 Ga0501084_0669215 3300054114 Bacteria 876
343 Ga0501082_0005797 3300060353 Bacteria 10721
344 Ga0466962_0239193 3300061719 Bacteria 891
345 2513660714 2513237096 Bacteria 8722461
346 2513862517 2513237137 Bacteria 9558895
347 2513876951 2513237139 Bacteria 8737671
348 2513922510 2513237145 Bacteria 8979722
349 2515624007 2515154112 Bacteria 8294334
350 2517888452 2517572143 Bacteria 9484767
351 2523467575 2523231067 Bacteria 5230452
352 2603862314 2602042107 Bacteria 6226103
353 2617353231 2617270735 Bacteria 9163226
354 2805921254 2802429603 Bacteria 8777136
355 2824701175 2824696289 Bacteria 8335049
356 2847930732 2847930680 Bacteria 9342022
357 2847942657 2847939898 Bacteria 8606328
358 2857525798 2857524615 Bacteria 6615449
359 2879089874 2879083081 Bacteria 8587928
360 2893067911 2893066018 Bacteria 6158120
361 2904699259 2904690495 Bacteria 9412302
362 2906639345 2906635258 Bacteria 8601019
363 2906668440 2906660503 Bacteria 8595048
364 2908758858 2908756301 Bacteria 8864324
365 2919074340 2919073203 Bacteria 6531949
366 2922426008
367 2935982199 2935975950 Bacteria 8347125
368 8019623347 8019619141 Bacteria 9218857
369 8019629748 8019629233 Bacteria 8687553
370 8019640868 8019638758 Bacteria 9062356
371 8019676330 8019668869 Bacteria 8791617
372 8019679667 8019678201 Bacteria 8863603
373 8056693973 8056689827 Bacteria 6712655
374 Ga0207711_10840567
375 JGI24739J22299_10014370
376 JGI24737J22298_10017377
377 JGI25165J46597_1000003
378 JGI25404J52841_10005411
379 JGI25404J52841_10012915
380 Ga0070676_11118367
381 Ga0070666_10282448
382 Ga0070680_100566626
383 Ga0070659_101427235
384 Ga0070667_100360702
385 Ga0070714_100844649
386 Ga0070711_100275020
387 Ga0070663_100042679
388 Ga0070662_100069796
389 Ga0070679_100461366
390 Ga0070679_101505009
391 Ga0068853_100019834
392 Ga0070665_101678687
393 Ga0068855_100019461
394 Ga0068855_101611552
395 Ga0068857_100005806
396 Ga0068854_100003966
397 Ga0068856_100022753
398 Ga0068859_100550839
399 Ga0068851_10482676
400 Ga0068858_100027108
401 Ga0068858_101264507
402 Ga0068862_100307104
403 Ga0081455_10061026
404 Ga0081455_10286133
405 Ga0081540_1008966
406 Ga0081540_1071190
407 Ga0070717_10811925
408 Ga0070717_11865667
409 Ga0075365_10065079
410 Ga0075365_10068554
411 Ga0075365_10085999
412 Ga0075365_10220496
413 Ga0075365_10392126
414 Ga0075368_10221723
415 Ga0075363_100251150
416 Ga0075363_100571281
417 Ga0075363_100921630
418 Ga0075364_10108037
419 Ga0070712_100515771
420 Ga0075369_10145691
421 Ga0075370_10106625
422 Ga0097620_100550850
423 Ga0099825_1037668
424 Ga0099824_1011582
425 Ga0099822_1001321
426 Ga0099823_1032421
427 Ga0099794_10334612
428 Ga0105240_10010949
429 Ga0111539_11159545
430 Ga0105247_10486549
431 Ga0105248_10331440
432 Ga0105248_10394502
433 Ga0105237_10076009
434 Ga0105237_10381534
435 Ga0105238_10004205
436 Ga0105238_10130331
437 Ga0105239_10024643
438 Ga0105239_10249799
439 Ga0105239_10520527
440 Ga0157371_10735848
441 Ga0157370_10280221
442 Ga0163163_11138812
443 Ga0157380_10129874
444 Ga0157380_10426239
445 Ga0213876_10157319
446 Ga0209148_1011122
447 Ga0209148_1034279
448 Ga0209233_1003722
449 Ga0209455_1006163
450 Ga0209455_1008327
451 Ga0209025_1093002
452 Ga0209564_1003384
453 Ga0209564_1022630
454 Ga0209758_1078960
455 Ga0207710_10062524
456 Ga0207680_10084917
457 Ga0207647_10001617
458 Ga0207647_10281948
459 Ga0207695_10127509
460 Ga0207671_10046164
461 Ga0207671_10724413
462 Ga0207652_10873405
463 Ga0207694_10013304
464 Ga0207694_10083338
465 Ga0207706_10055040
466 Ga0207686_11274526
467 Ga0207667_10002298
468 Ga0207667_11890580
469 Ga0207668_10367217
470 Ga0207640_10005948
471 Ga0207658_10756903
472 Ga0207677_10770306
473 Ga0207703_10017425
474 Ga0207703_10595397
475 Ga0207639_10002667
476 Ga0207678_10052715
477 Ga0207678_10301710
478 Ga0207674_10007557
479 Ga0207698_10603105
480 Ga0207698_11472115
481 Ga0209389_1000110
482 Ga0209589_1000026
483 Ga0209489_100046
484 Ga0209489_100524
485 Ga0209700_100047
486 Ga0209700_100334
487 Ga0268266_10368479
488 Ga0268266_10998166
489 Ga0268266_11961534
490 Ga0265337_1006676
491 Ga0265326_10009868
492 Ga0265319_1005328
493 Ga0265334_10001546
494 Ga0265318_10100686
495 Ga0265323_10001795
496 Ga0265322_10018937
497 Ga0265336_10002399
498 Ga0307517_10001290
499 Ga0307515_10012007
500 Ga0307515_10115369
501 Ga0265338_10000621
502 Ga0265338_10059849
503 Ga0265340_10076713
504 Ga0265339_10025421
505 Ga0265331_10264230
506 Ga0265331_10409244
507 Ga0265316_10399761
508 Ga0265316_10469150
509 Ga0316575_10067790
510 Ga0265314_10082159
511 Ga0265314_10148263
512 Ga0265314_10181168
513 Ga0307516_11022113
514 Ga0307410_10915750
515 Ga0307412_11156994
516 Ga0307411_10553023
517 Ga0373945_0014647
518 Ga0373943_0004304
519 Ga0373935_0007978
520 Ga0373927_0180934
521 Ga0373947_0013940
522 Ga0373925_0006026
523 Ga0436364_0040449
524 Ga0436365_0679034
525 Ga0436365_1088908
526 Ga0436365_1432156
527 Ga0436363_0291744
528 Ga0451802_1297303
529 Ga0451807_0289605
530 Ga0451845_0935202
531 Ga0466965_0361230
532 Ga0495629_0417912
533 Ga0495638_0019032
534 Ga0495638_0470058
535 Ga0495580_0001477
536 Ga0495596_0180636
537 Ga0495607_0111811
538 Ga0495607_0170271
539 Ga0495583_0043017
540 Ga0495606_0085276
541 Ga0495616_0032384
542 Ga0495616_0048982
543 Ga0495631_0012368
544 Ga0495631_0190586
545 Ga0495631_0194351
546 Ga0495643_0160646
547 Ga0495648_0063759
548 Ga0495648_0173256
549 Ga0495654_0134438
550 Ga0495645_0157873
551 Ga0495611_0261047
552 Ga0495625_0205524
553 Ga0495635_0305724
554 Ga0495661_0029665
555 Ga0495661_0230074
556 Ga0495658_0000497
557 Ga0495670_0004558
558 Ga0495671_0071408
559 Ga0495600_0092694
560 Ga0495660_0336724
561 Ga0495672_0297970
562 Ga0495676_0576516
563 Ga0495684_0074220
564 Ga0495686_0029038
565 Ga0495686_0670507
566 Ga0495602_0733558
567 Ga0495626_0038232
568 Ga0496106_0020798
569 Ga0496111_0062155
570 Ga0496112_0276795
571 Ga0496113_0934777
572 Ga0496114_0024895
573 Ga0496115_0612712
574 Ga0496116_0009854
575 Ga0496117_0057484
576 Ga0496117_0073141
577 Ga0496117_0120351
578 Ga0496117_0153976
579 Ga0496118_0082022
580 Ga0496118_0106121
581 Ga0496118_0132831
582 Ga0496118_0256742
583 Ga0496119_0243941
584 Ga0496119_0329997
585 Ga0496120_0045007
586 Ga0496121_0002554
587 Ga0496121_0488685
588 Ga0496121_0533026
589 Ga0496121_0626325
590 Ga0496122_0042662
591 Ga0496122_0211866
592 Ga0496122_0365837
593 Ga0496123_0020379
594 Ga0496123_0067505
595 Ga0496124_0016867
596 Ga0496124_0331638
597 Ga0496125_0000904
598 Ga0496125_0004420
599 Ga0496125_0022357
600 Ga0496125_0046908
601 Ga0496125_0101171
602 Ga0496126_0009773
603 Ga0496126_0024845
604 Ga0496126_0059273
605 Ga0496126_0070519
606 Ga0496126_0076086
607 Ga0496126_0117150
608 Ga0496126_0379736
609 Ga0496126_0915936
610 Ga0496126_1206297
611 Ga0501031_0234510
612 Ga0501031_0341716
613 Ga0501031_0492468
614 Ga0501031_0632402
615 Ga0501032_0073218
616 Ga0501032_0153662
617 Ga0501032_1059815
618 Ga0501033_0044626
619 Ga0501033_0189186
620 Ga0501034_0237750
621 Ga0501036_0033677
622 Ga0501036_0106298
623 Ga0501036_0110286
624 Ga0501036_0555848
625 Ga0501037_0075779
626 Ga0501038_0001766
627 Ga0501039_0165548
628 Ga0501041_0899260
629 Ga0501042_0110493
630 Ga0501043_0037026
631 Ga0501043_0058947
632 Ga0501043_0179435
633 Ga0501046_0108139
634 Ga0501046_0308876
635 Ga0501047_0005547
636 Ga0501047_0049101
637 Ga0501048_0216980
638 Ga0501067_0006865
639 Ga0501068_0421584
640 Ga0501070_0029971
641 Ga0501070_0069582
642 Ga0501070_0146595
643 Ga0501071_0006592
644 Ga0501072_0032124
645 Ga0501072_0486634
646 Ga0501074_0130682
647 Ga0501075_1182001
648 Ga0501076_1585436
649 Ga0501080_0774656
650 Ga0501083_0005370
651 Ga0501083_0063106
652 Ga0501035_0073460
653 Ga0501035_0343910
654 Ga0501044_0013306
655 Ga0501044_0031852
656 Ga0501044_1191733
657 nmdc:mga00v17_863539_c1
658 nmdc:mga00v17_99520_c1
659 nmdc:mga0yw44_13913_c1
660 nmdc:mga0yw44_182507_c1
661 nmdc:mga0yw44_633490_c1
662 nmdc:mga0yw44_79993_c1
663 nmdc:mga06z11_319078_c1
664 nmdc:mga07m45_121900_c1
665 nmdc:mga08y16_1070280_c1
666 nmdc:mga0sz30_190302_c1
667 nmdc:mga0sz30_276011_c1
668 Ga0500643_022242
669 Ga0500643_047058
670 Ga0500643_061180
671 Ga0500644_0050758
672 Ga0500644_0165442
673 Ga0500581_031256
674 Ga0500646_0006123
675 Ga0500651_0051099
676 Ga0500651_0104089
677 Ga0500566_0013226
678 Ga0500641_0024716
679 Ga0500641_0047864
680 Ga0500650_0004684
681 Ga0500554_112461
682 Ga0500555_044152
683 Ga0500556_0000019
684 Ga0500562_035293
685 Ga0500562_102876
686 Ga0500569_000864
687 Ga0500572_000149
688 Ga0500592_017803
689 Ga0500594_0080083
690 Ga0500642_0000039
691 Ga0500652_001066
692 Ga0500658_0009611
693 Ga0500559_0000749
694 Ga0500559_0005312
695 Ga0500559_0228348
696 Ga0500568_0001467
697 Ga0500577_0321900
698 Ga0500586_003367
699 Ga0500590_050884
700 Ga0500603_017782
701 Ga0500604_0025269
702 Ga0500616_0000059
703 Ga0500619_095764
704 Ga0500622_0015463
705 Ga0500627_0129535
706 Ga0500627_0210578
707 Ga0500633_0149221
708 Ga0500639_106555
709 Ga0500636_0007761
710 Ga0500636_0016432
711 Ga0500576_080148
712 Ga0500645_007378
713 Ga0500596_003036
714 Ga0501084_0541632
715 Ga0501084_0669215
716 Ga0501082_0005797
717 Ga0466962_0239193
718 2513660714
719 2513862517
720 2513876951
721 2513922510
722 2515624007
723 2517888452
724 2523467575
725 2603862314
726 2617353231
727 2805921254
728 2824701175
729 2847930732
730 2847942657
731 2857525798
732 2879089874
733 2893067911
734 2904699259
735 2906639345
736 2906668440
737 2908758858
738 2919074340
739 2922426008
740 2935982199
741 8019623347
742 8019629748
743 8019640868
744 8019676330
745 8019679667
746 8056693973

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14815

NUDIX_4

NUDIX domain

27

147

0.89

PF00293

NUDIX

NUDIX domain

22

148

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9803 6 136
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.975 5 136
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9729 6 136
3r03-assembly1.cif.gz_B the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.9529 5 136
3hhj-assembly1.cif.gz_A crystal structure of mutator mutt from bartonella henselae 0.952 6 134
ID Description Score Start End Superfamily
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9742 5 136 3.90.79.10
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9518 5 136 3.90.79.10
3eesB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9342 6 134 3.90.79.10
af_P77788_1_135_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9316 5 135 3.90.79.10
af_Q54BB8_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9292 6 134 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A4R2H086-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9983 5 135 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A437M385-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.997 5 136 GO:0006260
GO:0006281
GO:0008413
GO:0016747
GO:0035539
GO:0044715
GO:0044716
AF-A0A5M6ISQ9-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9968 6 136 GO:0006260
GO:0006281
GO:0008413
GO:0016747
GO:0035539
GO:0044715
GO:0044716
AF-I4YM82-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9966 5 137 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
GO:0046872
AF-A0A1Q3V1T2-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9962 4 136 GO:0006260
GO:0006281
GO:0008413
GO:0016747
GO:0035539
GO:0044715
GO:0044716
GO:0046872

Map