F426369

General Info

Members Datasets Scaffolds Average Seq Length
373 200 746 427

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10014422|Ga0207643_100144222
Length 481
Sequence MRASGDRTDVAGSGRLPIGHPSVYFCAMQTTGGVLDELRWRGLVYQHTDGVPDALAAGALSAYIGFDPTGSSLHVGSLVPIMVLVHLQRHGHRPVALVGGGTGMIGDPSGKTSERQLLTTEQVAENARGIHAQLERFLEFTGPSAARMRDNAAWLTPLHLVDFLRDVGKHFTVNYMLQKESVRSRMDAGISFTEFTYMLLQAYDFLELRRRDGVTLQLGGSDQWGNITAGIELIRRVDAADAHALTMPLVTTSSGAKFGKTEAGAVWLDAERTSPYAFYQFWLGTEDADVGRYLRYYTLLARAEIESLDAETAAAPEKRTAQQALARDVTRRVHGEGALAAAEQVSTFFFGGLEASALSEDALLTQAGISRLIARLEALTDRPTRLAVAAERAVSRALGGSCSMPLAAHAAWHGDVLALDAAVGHPERRTAPLLRARQVGPVADERDAEALGRRAAGALLASGAAPYLAAAERLGASADPA

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.88
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10014422 3300025908 Bacteria 4292
2 Ga0070658_10005003 3300005327 Bacteria 10792
3 Ga0070658_10007259 3300005327 Bacteria 8946
4 Ga0070658_10157263 3300005327 Bacteria 1906
5 Ga0070676_10010077 3300005328 Bacteria 5119
6 Ga0070683_100002955 3300005329 Bacteria 13630
7 Ga0070683_100012369 3300005329 Bacteria 7414
8 Ga0070683_100022431 3300005329 Bacteria 5642
9 Ga0070683_100022635 3300005329 Bacteria 5619
10 Ga0070683_100028034 3300005329 Bacteria 5086
11 Ga0070683_100105783 3300005329 Bacteria 2652
12 Ga0070683_100131184 3300005329 Bacteria 2371
13 Ga0070683_100136061 3300005329 Bacteria 2327
14 Ga0070683_100219691 3300005329 Bacteria 1806
15 Ga0070690_100002368 3300005330 Bacteria 10131
16 Ga0070670_100087668 3300005331 Bacteria 2675
17 Ga0070677_10005803 3300005333 Bacteria 4085
18 Ga0068869_100000208 3300005334 Bacteria 30490
19 Ga0070680_100005138 3300005336 Bacteria 9889
20 Ga0070680_100006581 3300005336 Bacteria 8835
21 Ga0070680_100010446 3300005336 Bacteria 7159
22 Ga0070680_100016202 3300005336 Bacteria 5862
23 Ga0070680_100018865 3300005336 Bacteria 5456
24 Ga0070680_100021723 3300005336 Bacteria 5104
25 Ga0070680_100024838 3300005336 Bacteria 4789
26 Ga0070680_100234853 3300005336 Bacteria 1549
27 Ga0070682_100005406 3300005337 Bacteria 7111
28 Ga0070682_100016566 3300005337 Bacteria 4288
29 Ga0068868_100028285 3300005338 Bacteria 4284
30 Ga0070660_100083564 3300005339 Bacteria 2508
31 Ga0070661_100019664 3300005344 Bacteria 4812
32 Ga0070661_100229254 3300005344 Bacteria 1427
33 Ga0070668_100012490 3300005347 Bacteria 6326
34 Ga0070669_100004450 3300005353 Bacteria 10102
35 Ga0070675_100010529 3300005354 Bacteria 7224
36 Ga0070675_100015590 3300005354 Bacteria 6013
37 Ga0070671_100018707 3300005355 Bacteria 5629
38 Ga0070674_100105272 3300005356 Bacteria 2063
39 Ga0070659_100000186 3300005366 Bacteria 47629
40 Ga0070659_100032992 3300005366 Bacteria 4021
41 Ga0070667_100075195 3300005367 Bacteria 2883
42 Ga0070709_10008030 3300005434 Bacteria 5792
43 Ga0070714_100004522 3300005435 Bacteria 10486
44 Ga0070714_100040204 3300005435 Bacteria 3941
45 Ga0070708_100000005 3300005445 Bacteria 159112
46 Ga0070708_100000900 3300005445 Bacteria 22509
47 Ga0070663_100108097 3300005455 Bacteria 2086
48 Ga0070662_100064369 3300005457 Bacteria 2685
49 Ga0070681_10001031 3300005458 Bacteria 23626
50 Ga0070681_10008058 3300005458 Bacteria 10310
51 Ga0070681_10012906 3300005458 Bacteria 8297
52 Ga0070681_10015521 3300005458 Bacteria 7586
53 Ga0070681_10068527 3300005458 Bacteria 3514
54 Ga0070681_10102530 3300005458 Bacteria 2806
55 Ga0070681_10134589 3300005458 Bacteria 2402
56 Ga0070681_10271459 3300005458 Bacteria 1607
57 Ga0070685_10005730 3300005466 Bacteria 6310
58 Ga0070706_100037500 3300005467 Bacteria 4477
59 Ga0070706_100070033 3300005467 Bacteria 3244
60 Ga0070706_100195018 3300005467 Bacteria 1892
61 Ga0070707_100001035 3300005468 Bacteria 27552
62 Ga0070707_100108840 3300005468 Bacteria 2688
63 Ga0070698_100037988 3300005471 Bacteria 4963
64 Ga0070679_100000151 3300005530 Bacteria 56102
65 Ga0070679_100000574 3300005530 Bacteria 31165
66 Ga0070679_100004350 3300005530 Bacteria 13085
67 Ga0070679_100004664 3300005530 Bacteria 12649
68 Ga0070679_100011629 3300005530 Bacteria 8387
69 Ga0070679_100012388 3300005530 Bacteria 8148
70 Ga0070679_100062669 3300005530 Bacteria 3707
71 Ga0070679_100115730 3300005530 Bacteria 2666
72 Ga0070679_100124089 3300005530 Bacteria 2565
73 Ga0070684_100000453 3300005535 Bacteria 28005
74 Ga0070684_100019623 3300005535 Bacteria 5594
75 Ga0070684_100039463 3300005535 Bacteria 4061
76 Ga0070684_100039475 3300005535 Bacteria 4060
77 Ga0070684_100042545 3300005535 Bacteria 3922
78 Ga0070684_100091534 3300005535 Bacteria 2705
79 Ga0070684_100109937 3300005535 Bacteria 2471
80 Ga0070684_100212816 3300005535 Bacteria 1762
81 Ga0070697_100123104 3300005536 Bacteria 2170
82 Ga0068853_100151349 3300005539 Bacteria 2089
83 Ga0070672_100012720 3300005543 Bacteria 5922
84 Ga0070672_100048724 3300005543 Bacteria 3293
85 Ga0070686_100035297 3300005544 Bacteria 3087
86 Ga0070696_100000301 3300005546 Bacteria 29877
87 Ga0070696_100041436 3300005546 Bacteria 3181
88 Ga0070693_100000506 3300005547 Bacteria 17475
89 Ga0070693_100045208 3300005547 Bacteria 2495
90 Ga0068855_100038559 3300005563 Bacteria 5677
91 Ga0068855_100241162 3300005563 Bacteria 2020
92 Ga0068855_100310434 3300005563 Bacteria 1745
93 Ga0070664_100018775 3300005564 Bacteria 5687
94 Ga0070664_100045144 3300005564 Bacteria 3721
95 Ga0068857_100003270 3300005577 Bacteria 13465
96 Ga0068857_100039133 3300005577 Bacteria 4200
97 Ga0068857_100071639 3300005577 Bacteria 3088
98 Ga0068854_100090631 3300005578 Bacteria 2274
99 Ga0068856_100006995 3300005614 Bacteria 11021
100 Ga0068856_100019479 3300005614 Bacteria 6587
101 Ga0068856_100025675 3300005614 Bacteria 5745
102 Ga0068864_100041836 3300005618 Bacteria 3919
103 Ga0068866_10038034 3300005718 Bacteria 2367
104 Ga0068863_100016278 3300005841 Bacteria 7135
105 Ga0068858_100137227 3300005842 Bacteria 2295
106 Ga0068860_100060954 3300005843 Bacteria 3585
107 Ga0068860_100320745 3300005843 Bacteria 1521
108 Ga0070716_100000659 3300006173 Bacteria 14660
109 Ga0070716_100067764 3300006173 Bacteria 2086
110 Ga0068871_100069634 3300006358 Bacteria 2890
111 Ga0075431_100003669 3300006847 Bacteria 14899
112 Ga0068865_100030446 3300006881 Bacteria 3590
113 Ga0075436_100004747 3300006914 Bacteria 9326
114 Ga0097620_100045533 3300006931 Bacteria 4407
115 Ga0105240_10019993 3300009093 Bacteria 8939
116 Ga0105240_10267104 3300009093 Bacteria 1972
117 Ga0111539_10113605 3300009094 Bacteria 3176
118 Ga0105245_10001318 3300009098 Bacteria 22422
119 Ga0105245_10042259 3300009098 Bacteria 4067
120 Ga0114129_10017593 3300009147 Bacteria 10175
121 Ga0105241_10000597 3300009174 Bacteria 27165
122 Ga0105241_10003759 3300009174 Bacteria 11258
123 Ga0105241_10095393 3300009174 Bacteria 2355
124 Ga0105242_10002448 3300009176 Bacteria 14564
125 Ga0105242_10004910 3300009176 Bacteria 10350
126 Ga0105248_10018443 3300009177 Bacteria 7711
127 Ga0105248_10039521 3300009177 Bacteria 5285
128 Ga0105248_10204199 3300009177 Bacteria 2227
129 Ga0105248_10209404 3300009177 Bacteria 2197
130 Ga0105237_10015361 3300009545 Bacteria 7972
131 Ga0105238_10023480 3300009551 Bacteria 6285
132 Ga0105238_10416337 3300009551 Bacteria 1338
133 Ga0105249_10202428 3300009553 Bacteria 1943
134 Ga0105246_10013960 3300011119 Bacteria 5044
135 Ga0157373_10024070 3300013100 Bacteria 4413
136 Ga0157373_10026651 3300013100 Bacteria 4172
137 Ga0157373_10039613 3300013100 Bacteria 3373
138 Ga0157373_10059813 3300013100 Bacteria 2700
139 Ga0157373_10080854 3300013100 Bacteria 2291
140 Ga0157370_10003374 3300013104 Bacteria 18778
141 Ga0157370_10053788 3300013104 Bacteria 3838
142 Ga0157370_10079534 3300013104 Bacteria 3087
143 Ga0157369_10090303 3300013105 Bacteria 3270
144 Ga0157369_10104119 3300013105 Bacteria 3023
145 Ga0157369_10120140 3300013105 Bacteria 2789
146 Ga0157369_10124470 3300013105 Bacteria 2734
147 Ga0157369_10143523 3300013105 Bacteria 2525
148 Ga0157374_10050167 3300013296 Bacteria 3878
149 Ga0157374_10081826 3300013296 Bacteria 3064
150 Ga0157378_10041820 3300013297 Bacteria 4066
151 Ga0157378_10105088 3300013297 Bacteria 2582
152 Ga0157378_10208008 3300013297 Bacteria 1854
153 Ga0163162_10071980 3300013306 Bacteria 3511
154 Ga0163162_10334361 3300013306 Bacteria 1647
155 Ga0157372_10002072 3300013307 Bacteria 21773
156 Ga0157372_10018454 3300013307 Bacteria 7499
157 Ga0157372_10030056 3300013307 Bacteria 5940
158 Ga0157372_10031197 3300013307 Bacteria 5835
159 Ga0157372_10049311 3300013307 Bacteria 4682
160 Ga0157372_10078847 3300013307 Unclassified 3722
161 Ga0157372_10078957 3300013307 Bacteria 3720
162 Ga0157372_10090597 3300013307 Bacteria 3477
163 Ga0157372_10143336 3300013307 Bacteria 2755
164 Ga0157372_10158403 3300013307 Bacteria 2616
165 Ga0157372_10324231 3300013307 Bacteria 1793
166 Ga0157375_10007469 3300013308 Bacteria 9560
167 Ga0157375_10213085 3300013308 Bacteria 2089
168 Ga0163163_10012958 3300014325 Bacteria 7616
169 Ga0157377_10103901 3300014745 Bacteria 1698
170 Ga0157376_10041200 3300014969 Bacteria 3780
171 Ga0163161_10079584 3300017792 Bacteria 2410
172 Ga0207656_10061375 3300025321 Bacteria 1650
173 Ga0207682_10003437 3300025893 Bacteria 6884
174 Ga0207642_10051542 3300025899 Bacteria 1862
175 Ga0207699_10004219 3300025906 Bacteria 6876
176 Ga0207699_10061744 3300025906 Bacteria 2256
177 Ga0207645_10005330 3300025907 Bacteria 9348
178 Ga0207645_10012198 3300025907 Bacteria 5836
179 Ga0207645_10153874 3300025907 Bacteria 1502
180 Ga0207705_10004929 3300025909 Bacteria 10020
181 Ga0207705_10025799 3300025909 Bacteria 4193
182 Ga0207705_10054215 3300025909 Bacteria 2890
183 Ga0207684_10120839 3300025910 Bacteria 2246
184 Ga0207654_10000594 3300025911 Bacteria 20386
185 Ga0207654_10048498 3300025911 Bacteria 2431
186 Ga0207707_10000082 3300025912 Bacteria 95610
187 Ga0207707_10001523 3300025912 Bacteria 21375
188 Ga0207707_10001531 3300025912 Bacteria 21338
189 Ga0207707_10008968 3300025912 Bacteria 8690
190 Ga0207707_10011359 3300025912 Bacteria 7754
191 Ga0207707_10016088 3300025912 Bacteria 6525
192 Ga0207707_10191475 3300025912 Bacteria 1784
193 Ga0207707_10227207 3300025912 Bacteria 1624
194 Ga0207695_10014986 3300025913 Bacteria 9148
195 Ga0207695_10030559 3300025913 Bacteria 5928
196 Ga0207695_10081559 3300025913 Bacteria 3273
197 Ga0207671_10107662 3300025914 Bacteria 2118
198 Ga0207693_10160465 3300025915 Bacteria 1769
199 Ga0207660_10000238 3300025917 Bacteria 35589
200 Ga0207660_10002101 3300025917 Bacteria 13216
201 Ga0207660_10007632 3300025917 Bacteria 7003
202 Ga0207660_10014885 3300025917 Bacteria 5127
203 Ga0207660_10027864 3300025917 Bacteria 3860
204 Ga0207660_10069755 3300025917 Bacteria 2553
205 Ga0207662_10000997 3300025918 Bacteria 13218
206 Ga0207662_10031152 3300025918 Bacteria 3098
207 Ga0207657_10000921 3300025919 Bacteria 31122
208 Ga0207657_10029491 3300025919 Bacteria 4993
209 Ga0207657_10082764 3300025919 Bacteria 2693
210 Ga0207657_10215408 3300025919 Bacteria 1540
211 Ga0207649_10012881 3300025920 Bacteria 4657
212 Ga0207649_10113677 3300025920 Bacteria 1813
213 Ga0207652_10001245 3300025921 Bacteria 22724
214 Ga0207652_10002295 3300025921 Bacteria 16214
215 Ga0207652_10010425 3300025921 Bacteria 7480
216 Ga0207652_10018140 3300025921 Bacteria 5768
217 Ga0207652_10018871 3300025921 Bacteria 5661
218 Ga0207652_10021385 3300025921 Bacteria 5340
219 Ga0207652_10029602 3300025921 Bacteria 4581
220 Ga0207646_10003899 3300025922 Bacteria 16559
221 Ga0207646_10112794 3300025922 Bacteria 2440
222 Ga0207681_10114740 3300025923 Bacteria 1966
223 Ga0207681_10189366 3300025923 Bacteria 1573
224 Ga0207694_10022628 3300025924 Bacteria 4769
225 Ga0207650_10017515 3300025925 Bacteria 5019
226 Ga0207650_10034903 3300025925 Bacteria 3649
227 Ga0207650_10103464 3300025925 Bacteria 2196
228 Ga0207659_10001518 3300025926 Bacteria 13790
229 Ga0207659_10002571 3300025926 Bacteria 10803
230 Ga0207659_10034978 3300025926 Bacteria 3469
231 Ga0207700_10093609 3300025928 Bacteria 2378
232 Ga0207700_10098548 3300025928 Bacteria 2325
233 Ga0207664_10002343 3300025929 Bacteria 12524
234 Ga0207664_10056293 3300025929 Bacteria 3123
235 Ga0207690_10011890 3300025932 Bacteria 5205
236 Ga0207706_10043828 3300025933 Bacteria 3964
237 Ga0207706_10093567 3300025933 Bacteria 2643
238 Ga0207686_10020793 3300025934 Bacteria 3755
239 Ga0207704_10024589 3300025938 Bacteria 3270
240 Ga0207665_10000392 3300025939 Bacteria 29995
241 Ga0207665_10015538 3300025939 Bacteria 4996
242 Ga0207691_10033852 3300025940 Bacteria 4757
243 Ga0207691_10107270 3300025940 Bacteria 2487
244 Ga0207711_10045487 3300025941 Bacteria 3751
245 Ga0207689_10000181 3300025942 Bacteria 54883
246 Ga0207661_10002310 3300025944 Bacteria 13131
247 Ga0207661_10009563 3300025944 Bacteria 6958
248 Ga0207661_10013378 3300025944 Bacteria 5993
249 Ga0207661_10022347 3300025944 Bacteria 4762
250 Ga0207661_10045903 3300025944 Bacteria 3462
251 Ga0207661_10089879 3300025944 Bacteria 2556
252 Ga0207661_10098408 3300025944 Bacteria 2451
253 Ga0207679_10014004 3300025945 Bacteria 5260
254 Ga0207679_10124043 3300025945 Bacteria 2061
255 Ga0207667_10047345 3300025949 Bacteria 4551
256 Ga0207667_10053847 3300025949 Bacteria 4233
257 Ga0207667_10135901 3300025949 Bacteria 2532
258 Ga0207651_10013589 3300025960 Bacteria 4665
259 Ga0207651_10159180 3300025960 Bacteria 1768
260 Ga0207668_10109351 3300025972 Bacteria 2070
261 Ga0207703_10018692 3300026035 Bacteria 5413
262 Ga0207703_10085845 3300026035 Bacteria 2635
263 Ga0207639_10019832 3300026041 Bacteria 4803
264 Ga0207639_10116307 3300026041 Bacteria 2189
265 Ga0207678_10075042 3300026067 Bacteria 2897
266 Ga0207702_10007329 3300026078 Bacteria 9422
267 Ga0207702_10112646 3300026078 Bacteria 2421
268 Ga0207702_10144204 3300026078 Bacteria 2159
269 Ga0207641_10066667 3300026088 Bacteria 3081
270 Ga0207648_10008059 3300026089 Bacteria 10266
271 Ga0207676_10002114 3300026095 Bacteria 14397
272 Ga0207674_10000081 3300026116 Bacteria 101724
273 Ga0207674_10002983 3300026116 Bacteria 20995
274 Ga0207674_10007250 3300026116 Bacteria 12931
275 Ga0207674_10062063 3300026116 Bacteria 3775
276 Ga0207683_10157532 3300026121 Bacteria 2051
277 Ga0207698_10188690 3300026142 Bacteria 1834
278 Ga0268264_10036275 3300028381 Bacteria 4061
279 Ga0268264_10103410 3300028381 Bacteria 2480
280 Ga0307405_10001645 3300031731 Bacteria 9501
281 Ga0307413_10012119 3300031824 Bacteria 4276
282 Ga0307410_10005792 3300031852 Bacteria 6588
283 Ga0307406_10002067 3300031901 Bacteria 10964
284 Ga0307412_10027518 3300031911 Bacteria 3546
285 Ga0307409_100026259 3300031995 Bacteria 4103
286 Ga0307416_100048720 3300032002 Bacteria 3363
287 Ga0307414_10031961 3300032004 Bacteria 3459
288 Ga0307411_10004298 3300032005 Bacteria 6798
289 Ga0307415_100046652 3300032126 Bacteria 2911
290 Ga0373931_0058782 3300035691 Bacteria 2066
291 Ga0373927_0038995 3300035695 Bacteria 3083
292 Ga0373927_0099242 3300035695 Bacteria 1893
293 Ga0373933_0020837 3300035724 Bacteria 3718
294 Ga0373947_0013542 3300035725 Bacteria 4673
295 Ga0373937_0159945 3300036401 Bacteria 2111
296 Ga0373925_0120395 3300037068 Bacteria 2037
297 Ga0395899_0168884 3300037312 Bacteria 1541
298 Ga0395900_0064733 3300037418 Bacteria 3756
299 Ga0395905_0065109 3300037471 Bacteria 3412
300 Ga0395905_0139772 3300037471 Bacteria 2279
301 Ga0395901_0006266 3300038443 Bacteria 12057
302 Ga0436365_0471460 3300039437 Bacteria 5484
303 Ga0436365_0856179 3300039437 Bacteria 2455
304 Ga0436365_1369088 3300039437 Bacteria 2428
305 Ga0439446_0013901 3300042156 Bacteria 2215
306 Ga0451577_0002770 3300042876 Bacteria 20275
307 Ga0451577_0064712 3300042876 Bacteria 3260
308 Ga0466966_0043167 3300044684 Bacteria 2891
309 Ga0453684_0000282 3300044712 Bacteria 219571
310 Ga0466959_0023372 3300045049 Bacteria 4574
311 Ga0466967_0037169 3300045976 Bacteria 4164
312 Ga0466967_0037579 3300045976 Bacteria 4145
313 Ga0495592_0178173 3300046454 Bacteria 1450
314 Ga0495629_0004135 3300046459 Bacteria 10883
315 Ga0495651_0002183 3300046462 Bacteria 15113
316 Ga0495651_0063497 3300046462 Bacteria 2823
317 Ga0495653_0012599 3300046463 Bacteria 6906
318 Ga0495580_0003270 3300046472 Bacteria 13867
319 Ga0495664_0013962 3300046477 Bacteria 4551
320 Ga0495594_0017761 3300046499 Bacteria 3762
321 Ga0495628_0046433 3300046516 Bacteria 3449
322 Ga0495630_0014681 3300046517 Bacteria 5710
323 Ga0495630_0058907 3300046517 Bacteria 2880
324 Ga0495630_0075908 3300046517 Bacteria 2532
325 Ga0495666_0098654 3300046526 Bacteria 1377
326 Ga0495652_0056787 3300046529 Bacteria 3323
327 Ga0495652_0118153 3300046529 Bacteria 2119
328 Ga0495665_0013363 3300046531 Bacteria 4441
329 Ga0495665_0109336 3300046531 Bacteria 1450
330 Ga0495586_0004729 3300046535 Bacteria 7278
331 Ga0495586_0017694 3300046535 Bacteria 3791
332 Ga0495587_0000740 3300046536 Bacteria 21858
333 Ga0495587_0008985 3300046536 Bacteria 6413
334 Ga0495645_0000080 3300046543 Bacteria 66039
335 Ga0495645_0016457 3300046543 Bacteria 5280
336 Ga0495667_0003463 3300046559 Bacteria 10577
337 Ga0495599_0000259 3300046678 Bacteria 33415
338 Ga0495623_0016612 3300046679 Bacteria 4752
339 Ga0495646_0061018 3300046680 Bacteria 2247
340 Ga0495613_0035547 3300046689 Bacteria 3697
341 Ga0495613_0060089 3300046689 Bacteria 2785
342 Ga0495600_0049537 3300046809 Bacteria 2741
343 Ga0495581_0009007 3300047315 Bacteria 5777
344 Ga0495604_0042484 3300047317 Bacteria 3562
345 Ga0495604_0128190 3300047317 Bacteria 1826
346 Ga0495674_0158456 3300047319 Bacteria 1895
347 Ga0495675_0012063 3300047444 Bacteria 5432
348 Ga0495675_0023060 3300047444 Bacteria 3967
349 Ga0495684_0031283 3300047471 Bacteria 4086
350 Ga0495684_0053290 3300047471 Bacteria 3086
351 Ga0496107_0057479 3300048910 Bacteria 2812
352 Ga0496108_0101864 3300048911 Bacteria 2450
353 Ga0496112_0000769 3300048915 Bacteria 22559
354 Ga0496112_0002473 3300048915 Bacteria 14909
355 Ga0496113_0016709 3300048916 Bacteria 5074
356 Ga0496114_0026706 3300048917 Bacteria 4729
357 Ga0496115_0002537 3300048918 Bacteria 13132
358 Ga0501032_0101029 3300049569 Bacteria 1911
359 Ga0501042_0021127 3300049578 Bacteria 4533
360 Ga0501043_0192466 3300049579 Bacteria 1586
361 Ga0501070_0003163 3300049586 Bacteria 14321
362 Ga0501075_0033140 3300049591 Bacteria 3842
363 Ga0501076_0087962 3300049592 Bacteria 2497
364 Ga0501077_0081256 3300049593 Bacteria 2053
365 Ga0501079_0118545 3300049741 Bacteria 2058
366 Ga0501081_0060807 3300049743 Bacteria 2618
367 Ga0501044_0038501 3300049823 Bacteria 4993
368 nmdc:mga06r32_10723_c1 3300050510 Bacteria 8254
369 nmdc:mga0rr50_129379_c1 3300050513 Unclassified 2019
370 nmdc:mga08x19_3964_c1 3300050514 Bacteria 8809
371 Ga0495612_0010555 3300053078 Bacteria 3734
372 Ga0495619_0021612 3300053085 Bacteria 4109
373 Ga0501082_0057176 3300060353 Bacteria 3361
374 Ga0207643_10014422
375 Ga0070658_10005003
376 Ga0070658_10007259
377 Ga0070658_10157263
378 Ga0070676_10010077
379 Ga0070683_100002955
380 Ga0070683_100012369
381 Ga0070683_100022431
382 Ga0070683_100022635
383 Ga0070683_100028034
384 Ga0070683_100105783
385 Ga0070683_100131184
386 Ga0070683_100136061
387 Ga0070683_100219691
388 Ga0070690_100002368
389 Ga0070670_100087668
390 Ga0070677_10005803
391 Ga0068869_100000208
392 Ga0070680_100005138
393 Ga0070680_100006581
394 Ga0070680_100010446
395 Ga0070680_100016202
396 Ga0070680_100018865
397 Ga0070680_100021723
398 Ga0070680_100024838
399 Ga0070680_100234853
400 Ga0070682_100005406
401 Ga0070682_100016566
402 Ga0068868_100028285
403 Ga0070660_100083564
404 Ga0070661_100019664
405 Ga0070661_100229254
406 Ga0070668_100012490
407 Ga0070669_100004450
408 Ga0070675_100010529
409 Ga0070675_100015590
410 Ga0070671_100018707
411 Ga0070674_100105272
412 Ga0070659_100000186
413 Ga0070659_100032992
414 Ga0070667_100075195
415 Ga0070709_10008030
416 Ga0070714_100004522
417 Ga0070714_100040204
418 Ga0070708_100000005
419 Ga0070708_100000900
420 Ga0070663_100108097
421 Ga0070662_100064369
422 Ga0070681_10001031
423 Ga0070681_10008058
424 Ga0070681_10012906
425 Ga0070681_10015521
426 Ga0070681_10068527
427 Ga0070681_10102530
428 Ga0070681_10134589
429 Ga0070681_10271459
430 Ga0070685_10005730
431 Ga0070706_100037500
432 Ga0070706_100070033
433 Ga0070706_100195018
434 Ga0070707_100001035
435 Ga0070707_100108840
436 Ga0070698_100037988
437 Ga0070679_100000151
438 Ga0070679_100000574
439 Ga0070679_100004350
440 Ga0070679_100004664
441 Ga0070679_100011629
442 Ga0070679_100012388
443 Ga0070679_100062669
444 Ga0070679_100115730
445 Ga0070679_100124089
446 Ga0070684_100000453
447 Ga0070684_100019623
448 Ga0070684_100039463
449 Ga0070684_100039475
450 Ga0070684_100042545
451 Ga0070684_100091534
452 Ga0070684_100109937
453 Ga0070684_100212816
454 Ga0070697_100123104
455 Ga0068853_100151349
456 Ga0070672_100012720
457 Ga0070672_100048724
458 Ga0070686_100035297
459 Ga0070696_100000301
460 Ga0070696_100041436
461 Ga0070693_100000506
462 Ga0070693_100045208
463 Ga0068855_100038559
464 Ga0068855_100241162
465 Ga0068855_100310434
466 Ga0070664_100018775
467 Ga0070664_100045144
468 Ga0068857_100003270
469 Ga0068857_100039133
470 Ga0068857_100071639
471 Ga0068854_100090631
472 Ga0068856_100006995
473 Ga0068856_100019479
474 Ga0068856_100025675
475 Ga0068864_100041836
476 Ga0068866_10038034
477 Ga0068863_100016278
478 Ga0068858_100137227
479 Ga0068860_100060954
480 Ga0068860_100320745
481 Ga0070716_100000659
482 Ga0070716_100067764
483 Ga0068871_100069634
484 Ga0075431_100003669
485 Ga0068865_100030446
486 Ga0075436_100004747
487 Ga0097620_100045533
488 Ga0105240_10019993
489 Ga0105240_10267104
490 Ga0111539_10113605
491 Ga0105245_10001318
492 Ga0105245_10042259
493 Ga0114129_10017593
494 Ga0105241_10000597
495 Ga0105241_10003759
496 Ga0105241_10095393
497 Ga0105242_10002448
498 Ga0105242_10004910
499 Ga0105248_10018443
500 Ga0105248_10039521
501 Ga0105248_10204199
502 Ga0105248_10209404
503 Ga0105237_10015361
504 Ga0105238_10023480
505 Ga0105238_10416337
506 Ga0105249_10202428
507 Ga0105246_10013960
508 Ga0157373_10024070
509 Ga0157373_10026651
510 Ga0157373_10039613
511 Ga0157373_10059813
512 Ga0157373_10080854
513 Ga0157370_10003374
514 Ga0157370_10053788
515 Ga0157370_10079534
516 Ga0157369_10090303
517 Ga0157369_10104119
518 Ga0157369_10120140
519 Ga0157369_10124470
520 Ga0157369_10143523
521 Ga0157374_10050167
522 Ga0157374_10081826
523 Ga0157378_10041820
524 Ga0157378_10105088
525 Ga0157378_10208008
526 Ga0163162_10071980
527 Ga0163162_10334361
528 Ga0157372_10002072
529 Ga0157372_10018454
530 Ga0157372_10030056
531 Ga0157372_10031197
532 Ga0157372_10049311
533 Ga0157372_10078847
534 Ga0157372_10078957
535 Ga0157372_10090597
536 Ga0157372_10143336
537 Ga0157372_10158403
538 Ga0157372_10324231
539 Ga0157375_10007469
540 Ga0157375_10213085
541 Ga0163163_10012958
542 Ga0157377_10103901
543 Ga0157376_10041200
544 Ga0163161_10079584
545 Ga0207656_10061375
546 Ga0207682_10003437
547 Ga0207642_10051542
548 Ga0207699_10004219
549 Ga0207699_10061744
550 Ga0207645_10005330
551 Ga0207645_10012198
552 Ga0207645_10153874
553 Ga0207705_10004929
554 Ga0207705_10025799
555 Ga0207705_10054215
556 Ga0207684_10120839
557 Ga0207654_10000594
558 Ga0207654_10048498
559 Ga0207707_10000082
560 Ga0207707_10001523
561 Ga0207707_10001531
562 Ga0207707_10008968
563 Ga0207707_10011359
564 Ga0207707_10016088
565 Ga0207707_10191475
566 Ga0207707_10227207
567 Ga0207695_10014986
568 Ga0207695_10030559
569 Ga0207695_10081559
570 Ga0207671_10107662
571 Ga0207693_10160465
572 Ga0207660_10000238
573 Ga0207660_10002101
574 Ga0207660_10007632
575 Ga0207660_10014885
576 Ga0207660_10027864
577 Ga0207660_10069755
578 Ga0207662_10000997
579 Ga0207662_10031152
580 Ga0207657_10000921
581 Ga0207657_10029491
582 Ga0207657_10082764
583 Ga0207657_10215408
584 Ga0207649_10012881
585 Ga0207649_10113677
586 Ga0207652_10001245
587 Ga0207652_10002295
588 Ga0207652_10010425
589 Ga0207652_10018140
590 Ga0207652_10018871
591 Ga0207652_10021385
592 Ga0207652_10029602
593 Ga0207646_10003899
594 Ga0207646_10112794
595 Ga0207681_10114740
596 Ga0207681_10189366
597 Ga0207694_10022628
598 Ga0207650_10017515
599 Ga0207650_10034903
600 Ga0207650_10103464
601 Ga0207659_10001518
602 Ga0207659_10002571
603 Ga0207659_10034978
604 Ga0207700_10093609
605 Ga0207700_10098548
606 Ga0207664_10002343
607 Ga0207664_10056293
608 Ga0207690_10011890
609 Ga0207706_10043828
610 Ga0207706_10093567
611 Ga0207686_10020793
612 Ga0207704_10024589
613 Ga0207665_10000392
614 Ga0207665_10015538
615 Ga0207691_10033852
616 Ga0207691_10107270
617 Ga0207711_10045487
618 Ga0207689_10000181
619 Ga0207661_10002310
620 Ga0207661_10009563
621 Ga0207661_10013378
622 Ga0207661_10022347
623 Ga0207661_10045903
624 Ga0207661_10089879
625 Ga0207661_10098408
626 Ga0207679_10014004
627 Ga0207679_10124043
628 Ga0207667_10047345
629 Ga0207667_10053847
630 Ga0207667_10135901
631 Ga0207651_10013589
632 Ga0207651_10159180
633 Ga0207668_10109351
634 Ga0207703_10018692
635 Ga0207703_10085845
636 Ga0207639_10019832
637 Ga0207639_10116307
638 Ga0207678_10075042
639 Ga0207702_10007329
640 Ga0207702_10112646
641 Ga0207702_10144204
642 Ga0207641_10066667
643 Ga0207648_10008059
644 Ga0207676_10002114
645 Ga0207674_10000081
646 Ga0207674_10002983
647 Ga0207674_10007250
648 Ga0207674_10062063
649 Ga0207683_10157532
650 Ga0207698_10188690
651 Ga0268264_10036275
652 Ga0268264_10103410
653 Ga0307405_10001645
654 Ga0307413_10012119
655 Ga0307410_10005792
656 Ga0307406_10002067
657 Ga0307412_10027518
658 Ga0307409_100026259
659 Ga0307416_100048720
660 Ga0307414_10031961
661 Ga0307411_10004298
662 Ga0307415_100046652
663 Ga0373931_0058782
664 Ga0373927_0038995
665 Ga0373927_0099242
666 Ga0373933_0020837
667 Ga0373947_0013542
668 Ga0373937_0159945
669 Ga0373925_0120395
670 Ga0395899_0168884
671 Ga0395900_0064733
672 Ga0395905_0065109
673 Ga0395905_0139772
674 Ga0395901_0006266
675 Ga0436365_0471460
676 Ga0436365_0856179
677 Ga0436365_1369088
678 Ga0439446_0013901
679 Ga0451577_0002770
680 Ga0451577_0064712
681 Ga0466966_0043167
682 Ga0453684_0000282
683 Ga0466959_0023372
684 Ga0466967_0037169
685 Ga0466967_0037579
686 Ga0495592_0178173
687 Ga0495629_0004135
688 Ga0495651_0002183
689 Ga0495651_0063497
690 Ga0495653_0012599
691 Ga0495580_0003270
692 Ga0495664_0013962
693 Ga0495594_0017761
694 Ga0495628_0046433
695 Ga0495630_0014681
696 Ga0495630_0058907
697 Ga0495630_0075908
698 Ga0495666_0098654
699 Ga0495652_0056787
700 Ga0495652_0118153
701 Ga0495665_0013363
702 Ga0495665_0109336
703 Ga0495586_0004729
704 Ga0495586_0017694
705 Ga0495587_0000740
706 Ga0495587_0008985
707 Ga0495645_0000080
708 Ga0495645_0016457
709 Ga0495667_0003463
710 Ga0495599_0000259
711 Ga0495623_0016612
712 Ga0495646_0061018
713 Ga0495613_0035547
714 Ga0495613_0060089
715 Ga0495600_0049537
716 Ga0495581_0009007
717 Ga0495604_0042484
718 Ga0495604_0128190
719 Ga0495674_0158456
720 Ga0495675_0012063
721 Ga0495675_0023060
722 Ga0495684_0031283
723 Ga0495684_0053290
724 Ga0496107_0057479
725 Ga0496108_0101864
726 Ga0496112_0000769
727 Ga0496112_0002473
728 Ga0496113_0016709
729 Ga0496114_0026706
730 Ga0496115_0002537
731 Ga0501032_0101029
732 Ga0501042_0021127
733 Ga0501043_0192466
734 Ga0501070_0003163
735 Ga0501075_0033140
736 Ga0501076_0087962
737 Ga0501077_0081256
738 Ga0501079_0118545
739 Ga0501081_0060807
740 Ga0501044_0038501
741 nmdc:mga06r32_10723_c1
742 nmdc:mga0rr50_129379_c1
743 nmdc:mga08x19_3964_c1
744 Ga0495612_0010555
745 Ga0495619_0021612
746 Ga0501082_0057176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

56

351

0.97

PF03900

Porphobil_deamC

Porphobilinogen deaminase, C-terminal domain

385

461

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tya-assembly1.cif.gz_E-2 structural analysis of a series of mutants of tyrosyl-trna synthetase: enhancement of catalysis by hydrophobic interactions 0.8721 5 317
2ts1-assembly1.cif.gz_A structure of tyrosyl-t/rna synthetase refined at 2.3 angstroms resolution. interaction of the enzyme with the tyrosyl adenylate intermediate 0.8718 5 317
1tyc-assembly1.cif.gz_A-2 structural analysis of a series of mutants of tyrosyl-trna synthetase: enhancement of catalysis by hydrophobic interactions 0.8715 5 317
1tyd-assembly1.cif.gz_E-2 structure of tyrosyl-trna synthetase refined at 2.3 angstroms resolution. interaction of the enzyme with the tyrosyl adenylate intermediate 0.8713 5 317
1jil-assembly1.cif.gz_A crystal structure of s. aureus tyrrs in complex with sb284485 0.8708 3 322
ID Description Score Start End Superfamily
4ts1B02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.987 222 310 1.10.240.10
2pidB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9705 237 319 1.10.240.10
2pidA02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.967 238 319 1.10.240.10
af_Q54WD9_272_382_1.10.240.10 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9656 222 323 1.10.240.10
4ts1B02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9655 222 310 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A269XEI3-F1-model_v4 Tyrosine--tRNA ligase 0.9959 222 314 GO:0004831
GO:0005524
GO:0005829
GO:0006418
AF-A0A5D0IME9-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9813 180 298 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A376YA39-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9798 173 283 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A800JYW0-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9778 169 281 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A269XEI3-F1-model_v4 Tyrosine--tRNA ligase 0.975 222 314 GO:0004831
GO:0005524
GO:0005829
GO:0006418

Map