F426282

General Info

Members Datasets Scaffolds Average Seq Length
373 178 746 302

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100426470|Ga0070684_1004264702
Length 332
Sequence MPKSLYESLGVSKNASQDELKKAYRKLVREVHPDKNPGDAEAEARFKEVQSAYDVLSDPKKRKQYDTMGSANGRTAPAGAGGTTFDFGDFDLGDIFGGMFNRGGRAQQQPRGQRGNDVEVEVRVSFEDALKGVQTTVGVQLELACHTCHGTGAAPGTACDGSGVVATSQGLFALQQPCPRXXGMGSIVRERRMKRYTVKIPAGVKDGTRIKLKGKGEAGYGGAPAGDLYVVTRVEPSKIYERRGDDLVVQVPVSYPTAALGGSIEVPTPDGPVSLKVPAGTEDGKLLRIKGRGVAHLKGAGQGDVLARIRIQVPKKLSKKQRELLEQLEKAR

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 2.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.58
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100426470 3300005535 Bacteria 1224
2 Ga0070658_10010566 3300005327 Bacteria 7398
3 Ga0070658_10054618 3300005327 Bacteria 3243
4 Ga0070683_100020861 3300005329 Bacteria 5839
5 Ga0070683_100035502 3300005329 Bacteria 4557
6 Ga0070683_100119976 3300005329 Bacteria 2484
7 Ga0070680_100042923 3300005336 Bacteria 3671
8 Ga0070680_100134849 3300005336 Bacteria 2067
9 Ga0070660_100006980 3300005339 Bacteria 7837
10 Ga0070660_100007606 3300005339 Bacteria 7552
11 Ga0070660_100028060 3300005339 Bacteria 4208
12 Ga0070660_100030097 3300005339 Bacteria 4071
13 Ga0070660_100054273 3300005339 Bacteria 3094
14 Ga0070660_100055171 3300005339 Bacteria 3070
15 Ga0070660_100105652 3300005339 Bacteria 2235
16 Ga0070661_100369064 3300005344 Bacteria 1129
17 Ga0070671_100084214 3300005355 Bacteria 2659
18 Ga0070659_100104186 3300005366 Bacteria 2285
19 Ga0070659_100120401 3300005366 Bacteria 2125
20 Ga0070667_100064158 3300005367 Bacteria 3116
21 Ga0070714_100052104 3300005435 Bacteria 3490
22 Ga0070713_100263967 3300005436 Bacteria 1574
23 Ga0070711_100176386 3300005439 Bacteria 1633
24 Ga0070681_10006998 3300005458 Bacteria 10979
25 Ga0070681_10013533 3300005458 Bacteria 8112
26 Ga0070681_10024853 3300005458 Bacteria 6027
27 Ga0070681_10045158 3300005458 Bacteria 4409
28 Ga0070681_10066283 3300005458 Bacteria 3579
29 Ga0070681_10067782 3300005458 Bacteria 3536
30 Ga0070681_10080242 3300005458 Bacteria 3219
31 Ga0070681_10096529 3300005458 Bacteria 2903
32 Ga0070681_10126293 3300005458 Bacteria 2490
33 Ga0070681_10204576 3300005458 Bacteria 1892
34 Ga0070679_100036849 3300005530 Bacteria 4855
35 Ga0070679_100063476 3300005530 Bacteria 3681
36 Ga0070679_100139021 3300005530 Bacteria 2409
37 Ga0070684_100023346 3300005535 Bacteria 5171
38 Ga0070684_100090522 3300005535 Bacteria 2721
39 Ga0070684_100102097 3300005535 Bacteria 2563
40 Ga0070684_100178614 3300005535 Bacteria 1930
41 Ga0070684_100336627 3300005535 Bacteria 1387
42 Ga0068853_100138128 3300005539 Bacteria 2186
43 Ga0070665_100036384 3300005548 Bacteria 4951
44 Ga0070665_100503762 3300005548 Bacteria 1222
45 Ga0068855_100003593 3300005563 Bacteria 18943
46 Ga0068855_100067439 3300005563 Bacteria 4168
47 Ga0068855_100103404 3300005563 Bacteria 3277
48 Ga0068855_100109013 3300005563 Bacteria 3180
49 Ga0068855_100180907 3300005563 Bacteria 2383
50 Ga0068855_100249391 3300005563 Bacteria 1980
51 Ga0068857_100070429 3300005577 Bacteria 3115
52 Ga0068857_100079532 3300005577 Bacteria 2926
53 Ga0068857_100084872 3300005577 Bacteria 2830
54 Ga0068856_100082109 3300005614 Bacteria 3198
55 Ga0068856_100106137 3300005614 Bacteria 2803
56 Ga0068856_100140383 3300005614 Bacteria 2423
57 Ga0068852_100003674 3300005616 Bacteria 10748
58 Ga0068852_100158192 3300005616 Bacteria 2113
59 Ga0068852_100259027 3300005616 Bacteria 1669
60 Ga0081455_10119327 3300005937 Bacteria 2080
61 Ga0081455_10134436 3300005937 Bacteria 1929
62 Ga0070717_10087186 3300006028 Bacteria 2628
63 Ga0075428_100081648 3300006844 Bacteria 3527
64 Ga0075433_10100505 3300006852 Bacteria 2561
65 Ga0075434_100096429 3300006871 Bacteria 2962
66 Ga0075436_100008094 3300006914 Bacteria 7196
67 Ga0105240_10109493 3300009093 Bacteria 3345
68 Ga0105240_10170099 3300009093 Bacteria 2582
69 Ga0105240_10265786 3300009093 Bacteria 1977
70 Ga0105240_10267522 3300009093 Bacteria 1970
71 Ga0105240_10434922 3300009093 Bacteria 1471
72 Ga0111539_10202088 3300009094 Bacteria 2317
73 Ga0105243_10302531 3300009148 Bacteria 1450
74 Ga0105242_10224224 3300009176 Bacteria 1681
75 Ga0105248_10139829 3300009177 Bacteria 2731
76 Ga0105237_10066776 3300009545 Bacteria 3591
77 Ga0105238_10050234 3300009551 Bacteria 4198
78 Ga0105239_10290005 3300010375 Bacteria 1843
79 Ga0157373_10031578 3300013100 Bacteria 3812
80 Ga0157370_10003010 3300013104 Bacteria 20004
81 Ga0157370_10111581 3300013104 Bacteria 2556
82 Ga0157369_10004869 3300013105 Bacteria 15753
83 Ga0157369_10015240 3300013105 Bacteria 8674
84 Ga0157369_10111383 3300013105 Bacteria 2909
85 Ga0157369_10124144 3300013105 Bacteria 2738
86 Ga0157369_10291287 3300013105 Bacteria 1699
87 Ga0157372_10146712 3300013307 Bacteria 2721
88 Ga0157372_10175057 3300013307 Bacteria 2483
89 Ga0157372_10435802 3300013307 Bacteria 1528
90 Ga0182008_10045355 3300014497 Bacteria 2186
91 Ga0182006_1014662 3300015261 Bacteria 3374
92 Ga0197907_10434847 3300020069 Bacteria 1548
93 Ga0206349_1809227 3300020075 Bacteria 1765
94 Ga0206350_11122351 3300020080 Bacteria 1796
95 Ga0206354_10976529 3300020081 Bacteria 2742
96 Ga0206353_10923009 3300020082 Bacteria 4460
97 Ga0206353_11136110 3300020082 Bacteria 3247
98 Ga0206353_11156406 3300020082 Bacteria 1223
99 Ga0206353_11442449 3300020082 Bacteria 2554
100 Ga0224712_10002014 3300022467 Bacteria 4925
101 Ga0224712_10008854 3300022467 Bacteria 3005
102 Ga0207705_10098748 3300025909 Bacteria 2146
103 Ga0207707_10003093 3300025912 Bacteria 14761
104 Ga0207707_10025270 3300025912 Bacteria 5196
105 Ga0207707_10067230 3300025912 Bacteria 3122
106 Ga0207707_10162950 3300025912 Bacteria 1949
107 Ga0207707_10224658 3300025912 Bacteria 1634
108 Ga0207707_10300418 3300025912 Bacteria 1388
109 Ga0207707_10366162 3300025912 Bacteria 1241
110 Ga0207695_10277829 3300025913 Bacteria 1569
111 Ga0207671_10162750 3300025914 Bacteria 1729
112 Ga0207663_10252637 3300025916 Unclassified 1298
113 Ga0207660_10043697 3300025917 Bacteria 3149
114 Ga0207657_10002919 3300025919 Bacteria 18353
115 Ga0207657_10010830 3300025919 Bacteria 9073
116 Ga0207657_10020735 3300025919 Bacteria 6202
117 Ga0207657_10028683 3300025919 Bacteria 5072
118 Ga0207657_10061328 3300025919 Bacteria 3225
119 Ga0207657_10225292 3300025919 Bacteria 1501
120 Ga0207649_10021794 3300025920 Bacteria 3696
121 Ga0207652_10092109 3300025921 Bacteria 2666
122 Ga0207652_10120049 3300025921 Bacteria 2338
123 Ga0207652_10263319 3300025921 Bacteria 1555
124 Ga0207652_10280835 3300025921 Bacteria 1502
125 Ga0207664_10080313 3300025929 Bacteria 2650
126 Ga0207664_10195244 3300025929 Bacteria 1744
127 Ga0207644_10013423 3300025931 Bacteria 5461
128 Ga0207690_10085905 3300025932 Bacteria 2210
129 Ga0207690_10370135 3300025932 Bacteria 1136
130 Ga0207711_10077447 3300025941 Bacteria 2898
131 Ga0207661_10058106 3300025944 Bacteria 3113
132 Ga0207661_10147943 3300025944 Bacteria 2028
133 Ga0207661_10180752 3300025944 Bacteria 1842
134 Ga0207667_10022509 3300025949 Bacteria 6959
135 Ga0207667_10133908 3300025949 Bacteria 2552
136 Ga0207667_10222762 3300025949 Bacteria 1932
137 Ga0207667_10369736 3300025949 Bacteria 1461
138 Ga0207658_10047104 3300025986 Bacteria 3153
139 Ga0207702_10058261 3300026078 Bacteria 3287
140 Ga0207702_10072774 3300026078 Bacteria 2963
141 Ga0207674_10034576 3300026116 Bacteria 5281
142 Ga0207698_10066991 3300026142 Bacteria 2830
143 Ga0207698_10142242 3300026142 Bacteria 2069
144 Ga0265338_10002640 3300028800 Bacteria 26412
145 Ga0265338_10012416 3300028800 Bacteria 9712
146 Ga0265338_10024899 3300028800 Bacteria 6096
147 Ga0265338_10061567 3300028800 Bacteria 3288
148 Ga0265338_10224261 3300028800 Bacteria 1402
149 Ga0265320_10074420 3300031240 Bacteria 1595
150 Ga0265325_10034373 3300031241 Bacteria 2697
151 Ga0265327_10009512 3300031251 Bacteria 6998
152 Ga0265316_10024282 3300031344 Bacteria 5085
153 Ga0265316_10042701 3300031344 Bacteria 3621
154 Ga0265313_10008162 3300031595 Bacteria 6997
155 Ga0265314_10004407 3300031711 Bacteria 13073
156 Ga0265314_10012572 3300031711 Bacteria 6895
157 Ga0265342_10035672 3300031712 Bacteria 3043
158 Ga0265342_10197004 3300031712 Bacteria 1096
159 Ga0307410_10043135 3300031852 Bacteria 2987
160 Ga0307407_10004145 3300031903 Bacteria 6107
161 Ga0307416_100260549 3300032002 Bacteria 1694
162 Ga0373944_0010385 3300035089 Bacteria 2538
163 Ga0373936_0005595 3300035113 Bacteria 4740
164 Ga0373945_0000271 3300035116 Bacteria 14603
165 Ga0373943_0003399 3300035170 Bacteria 7244
166 Ga0373943_0030088 3300035170 Bacteria 2568
167 Ga0373946_0004198 3300035171 Bacteria 5136
168 Ga0373935_0005188 3300035692 Bacteria 7670
169 Ga0373927_0055832 3300035695 Bacteria 2553
170 Ga0373947_0009352 3300035725 Bacteria 5631
171 Ga0373947_0010694 3300035725 Bacteria 5268
172 Ga0373937_0045765 3300036401 Bacteria 3999
173 Ga0373937_0310392 3300036401 Bacteria 1492
174 Ga0373925_0007482 3300037068 Bacteria 7967
175 Ga0373925_0033275 3300037068 Bacteria 3799
176 Ga0395899_0013402 3300037312 Bacteria 6272
177 Ga0395899_0150684 3300037312 Bacteria 1648
178 Ga0395900_0018798 3300037418 Bacteria 7047
179 Ga0395900_0074849 3300037418 Bacteria 3480
180 Ga0395898_0071451 3300037466 Bacteria 3353
181 Ga0395898_0089797 3300037466 Bacteria 2957
182 Ga0395898_0137664 3300037466 Bacteria 2338
183 Ga0395898_0222637 3300037466 Bacteria 1799
184 Ga0395898_0228036 3300037466 Bacteria 1776
185 Ga0395898_0268700 3300037466 Bacteria 1626
186 Ga0395898_0298747 3300037466 Bacteria 1536
187 Ga0395898_0334518 3300037466 Bacteria 1444
188 Ga0395905_0029597 3300037471 Bacteria 5160
189 Ga0395905_0222079 3300037471 Bacteria 1768
190 Ga0395905_0344585 3300037471 Bacteria 1381
191 Ga0395901_0004378 3300038443 Bacteria 14246
192 Ga0395901_0022039 3300038443 Bacteria 6529
193 Ga0395901_0076392 3300038443 Bacteria 3494
194 Ga0395901_0131745 3300038443 Bacteria 2627
195 Ga0395901_0205057 3300038443 Bacteria 2066
196 Ga0395901_0327722 3300038443 Bacteria 1583
197 Ga0436360_0899682 3300039438 Bacteria 3656
198 Ga0466969_0001587 3300044656 Bacteria 12160
199 Ga0466966_0100571 3300044684 Bacteria 1788
200 Ga0466961_0007471 3300044693 Bacteria 6952
201 Ga0466961_0009997 3300044693 Bacteria 6046
202 Ga0466963_0000045 3300044694 Bacteria 40813
203 Ga0466963_0000742 3300044694 Bacteria 16070
204 Ga0466963_0011111 3300044694 Bacteria 5475
205 Ga0466963_0049170 3300044694 Bacteria 2788
206 Ga0466963_0104396 3300044694 Bacteria 1942
207 Ga0466963_0151315 3300044694 Bacteria 1611
208 Ga0466964_0009378 3300044706 Bacteria 3684
209 Ga0466971_0004863 3300044719 Bacteria 5810
210 Ga0466968_0002788 3300044735 Bacteria 6453
211 Ga0466968_0008306 3300044735 Bacteria 3973
212 Ga0466970_0023606 3300044765 Bacteria 3213
213 Ga0466957_0000686 3300044842 Bacteria 17266
214 Ga0466957_0003129 3300044842 Bacteria 9010
215 Ga0466957_0045437 3300044842 Bacteria 2664
216 Ga0466957_0084944 3300044842 Bacteria 1976
217 Ga0466959_0043047 3300045049 Bacteria 3330
218 Ga0466959_0252767 3300045049 Bacteria 1215
219 Ga0451576_0248367 3300045051 Bacteria 1859
220 Ga0466958_0009485 3300045836 Bacteria 5426
221 Ga0466958_0028972 3300045836 Bacteria 3285
222 Ga0466958_0042155 3300045836 Bacteria 2747
223 Ga0466958_0083928 3300045836 Bacteria 1964
224 Ga0466958_0213582 3300045836 Bacteria 1230
225 Ga0466967_0000248 3300045976 Bacteria 23755
226 Ga0466967_0006707 3300045976 Bacteria 8191
227 Ga0466967_0026416 3300045976 Bacteria 4809
228 Ga0466967_0050450 3300045976 Bacteria 3644
229 Ga0466967_0056993 3300045976 Bacteria 3447
230 Ga0466967_0059530 3300045976 Bacteria 3381
231 Ga0466967_0098158 3300045976 Bacteria 2674
232 Ga0466967_0107360 3300045976 Bacteria 2560
233 Ga0466967_0148080 3300045976 Bacteria 2191
234 Ga0466967_0252794 3300045976 Bacteria 1684
235 Ga0466967_0290949 3300045976 Bacteria 1569
236 Ga0495592_0012566 3300046454 Bacteria 6434
237 Ga0495603_0082651 3300046455 Bacteria 1881
238 Ga0495629_0000607 3300046459 Bacteria 29151
239 Ga0495629_0065820 3300046459 Bacteria 2529
240 Ga0495641_0002588 3300046461 Bacteria 14178
241 Ga0495641_0022443 3300046461 Bacteria 3158
242 Ga0495641_0034823 3300046461 Bacteria 2378
243 Ga0495651_0000080 3300046462 Bacteria 70453
244 Ga0495651_0072012 3300046462 Bacteria 2626
245 Ga0495651_0175352 3300046462 Bacteria 1523
246 Ga0495653_0006383 3300046463 Bacteria 9669
247 Ga0495653_0098486 3300046463 Bacteria 2123
248 Ga0495653_0117621 3300046463 Bacteria 1899
249 Ga0495582_0005526 3300046473 Bacteria 7038
250 Ga0495639_0090555 3300046475 Bacteria 1435
251 Ga0495662_0009186 3300046476 Bacteria 4851
252 Ga0495662_0034985 3300046476 Bacteria 2424
253 Ga0495664_0112560 3300046477 Bacteria 1643
254 Ga0495594_0132461 3300046499 Bacteria 1412
255 Ga0495608_0041238 3300046511 Bacteria 3090
256 Ga0495618_0011918 3300046514 Bacteria 5276
257 Ga0495618_0045190 3300046514 Bacteria 2778
258 Ga0495628_0001647 3300046516 Bacteria 20433
259 Ga0495628_0163887 3300046516 Bacteria 1688
260 Ga0495630_0103434 3300046517 Bacteria 2155
261 Ga0495630_0124547 3300046517 Bacteria 1955
262 Ga0495630_0138159 3300046517 Bacteria 1852
263 Ga0495666_0012794 3300046526 Bacteria 4183
264 Ga0495652_0017232 3300046529 Bacteria 6449
265 Ga0495652_0086294 3300046529 Bacteria 2577
266 Ga0495652_0121877 3300046529 Bacteria 2078
267 Ga0495652_0200131 3300046529 Bacteria 1516
268 Ga0495652_0261818 3300046529 Bacteria 1276
269 Ga0495665_0000111 3300046531 Bacteria 38528
270 Ga0495640_0072149 3300046533 Bacteria 2314
271 Ga0495640_0098864 3300046533 Bacteria 1917
272 Ga0495640_0117716 3300046533 Bacteria 1729
273 Ga0495640_0118944 3300046533 Bacteria 1719
274 Ga0495586_0040436 3300046535 Bacteria 2508
275 Ga0495587_0000270 3300046536 Bacteria 37255
276 Ga0495645_0025737 3300046543 Bacteria 4272
277 Ga0495667_0019887 3300046559 Bacteria 4531
278 Ga0495667_0044353 3300046559 Bacteria 2945
279 Ga0495667_0059555 3300046559 Bacteria 2506
280 Ga0495667_0142258 3300046559 Bacteria 1546
281 Ga0495634_0040675 3300046642 Bacteria 3159
282 Ga0495634_0066651 3300046642 Bacteria 2383
283 Ga0495634_0140897 3300046642 Bacteria 1531
284 Ga0495635_0042027 3300046663 Bacteria 3158
285 Ga0495635_0084324 3300046663 Bacteria 2174
286 Ga0495588_0062598 3300046674 Bacteria 1929
287 Ga0495657_0008538 3300046675 Bacteria 7824
288 Ga0495657_0098818 3300046675 Bacteria 1862
289 Ga0495657_0157960 3300046675 Bacteria 1404
290 Ga0495599_0000142 3300046678 Bacteria 46621
291 Ga0495599_0071250 3300046678 Bacteria 2170
292 Ga0495599_0155169 3300046678 Bacteria 1417
293 Ga0495623_0021271 3300046679 Bacteria 4189
294 Ga0495646_0033947 3300046680 Bacteria 3171
295 Ga0495647_0027682 3300046681 Bacteria 2084
296 Ga0495658_0000330 3300046683 Bacteria 26505
297 Ga0495658_0222750 3300046683 Bacteria 1181
298 Ga0495613_0009542 3300046689 Bacteria 7206
299 Ga0495624_0004645 3300046690 Bacteria 10006
300 Ga0495600_0079549 3300046809 Bacteria 2140
301 Ga0495600_0099923 3300046809 Unclassified 1891
302 Ga0495581_0000303 3300047315 Bacteria 24088
303 Ga0495604_0005999 3300047317 Bacteria 9644
304 Ga0495604_0049561 3300047317 Bacteria 3262
305 Ga0495604_0068215 3300047317 Bacteria 2700
306 Ga0495674_0016398 3300047319 Bacteria 6909
307 Ga0495674_0045405 3300047319 Bacteria 3901
308 Ga0495674_0110144 3300047319 Bacteria 2335
309 Ga0495676_0000450 3300047321 Bacteria 33719
310 Ga0495680_0004431 3300047322 Bacteria 13416
311 Ga0495680_0028344 3300047322 Bacteria 4592
312 Ga0495675_0000896 3300047444 Bacteria 18216
313 Ga0495684_0028514 3300047471 Bacteria 4285
314 Ga0495684_0044809 3300047471 Bacteria 3385
315 Ga0495602_0021235 3300048088 Bacteria 6397
316 Ga0495602_0043405 3300048088 Bacteria 4089
317 Ga0496100_0177552 3300048903 Bacteria 1538
318 Ga0496101_0025055 3300048904 Bacteria 4135
319 Ga0496101_0044361 3300048904 Bacteria 3181
320 Ga0496101_0058788 3300048904 Bacteria 2785
321 Ga0496101_0160415 3300048904 Bacteria 1724
322 Ga0496102_0072123 3300048905 Bacteria 3172
323 Ga0496102_0088626 3300048905 Bacteria 2861
324 Ga0496102_0137575 3300048905 Bacteria 2289
325 Ga0496103_0009372 3300048906 Bacteria 5799
326 Ga0496103_0217044 3300048906 Bacteria 1230
327 Ga0496104_0080822 3300048907 Bacteria 3099
328 Ga0496105_0146327 3300048908 Bacteria 1943
329 Ga0496106_0122030 3300048909 Bacteria 2037
330 Ga0496107_0007299 3300048910 Bacteria 7617
331 Ga0496107_0093943 3300048910 Bacteria 2194
332 Ga0496108_0088475 3300048911 Bacteria 2631
333 Ga0496108_0223015 3300048911 Bacteria 1638
334 Ga0496109_0099918 3300048912 Bacteria 2691
335 Ga0496109_0124275 3300048912 Bacteria 2405
336 Ga0496109_0268470 3300048912 Bacteria 1607
337 Ga0496110_0539458 3300048913 Bacteria 1060
338 Ga0496111_0103011 3300048914 Bacteria 2099
339 Ga0496112_0019685 3300048915 Bacteria 6377
340 Ga0496112_0059037 3300048915 Bacteria 3779
341 Ga0496112_0062074 3300048915 Bacteria 3685
342 Ga0496112_0075275 3300048915 Bacteria 3339
343 Ga0496112_0090091 3300048915 Bacteria 3036
344 Ga0496114_0006225 3300048917 Bacteria 9398
345 Ga0496114_0015307 3300048917 Bacteria 6166
346 Ga0496114_0180525 3300048917 Bacteria 1843
347 Ga0496114_0233478 3300048917 Bacteria 1616
348 Ga0496115_0009421 3300048918 Bacteria 7256
349 Ga0501033_0214294 3300049570 Bacteria 1373
350 Ga0501047_0007514 3300049581 Bacteria 10258
351 Ga0501067_0001219 3300049583 Bacteria 13976
352 Ga0501067_0037672 3300049583 Bacteria 2686
353 Ga0501070_0046323 3300049586 Bacteria 3616
354 Ga0501070_0322832 3300049586 Bacteria 1255
355 Ga0501079_0040647 3300049741 Bacteria 3588
356 Ga0501079_0092872 3300049741 Bacteria 2338
357 Ga0501035_0156250 3300049822 Bacteria 1977
358 nmdc:mga0n895_34403_c2 3300050512 Bacteria 4232
359 nmdc:mga0rr50_72951_c1 3300050513 Bacteria 2623
360 nmdc:mga0a205_40190_c1 3300050515 Bacteria 4502
361 Ga0495601_0011114 3300053077 Bacteria 5378
362 Ga0495612_0021274 3300053078 Bacteria 2603
363 Ga0495612_0067524 3300053078 Bacteria 1487
364 Ga0495595_0005802 3300053084 Bacteria 4997
365 Ga0495595_0045682 3300053084 Bacteria 2015
366 Ga0495595_0115790 3300053084 Bacteria 1303
367 Ga0495619_0034186 3300053085 Bacteria 3304
368 Ga0495619_0072885 3300053085 Bacteria 2301
369 Ga0495619_0129481 3300053085 Bacteria 1734
370 Ga0466962_0005742 3300061719 Bacteria 5961
371 Ga0466962_0056746 3300061719 Bacteria 1870
372 Ga0530510_0031728 3300061734 Bacteria 3799
373 Ga0530510_0305008 3300061734 Bacteria 1192
374 Ga0070684_100426470
375 Ga0070658_10010566
376 Ga0070658_10054618
377 Ga0070683_100020861
378 Ga0070683_100035502
379 Ga0070683_100119976
380 Ga0070680_100042923
381 Ga0070680_100134849
382 Ga0070660_100006980
383 Ga0070660_100007606
384 Ga0070660_100028060
385 Ga0070660_100030097
386 Ga0070660_100054273
387 Ga0070660_100055171
388 Ga0070660_100105652
389 Ga0070661_100369064
390 Ga0070671_100084214
391 Ga0070659_100104186
392 Ga0070659_100120401
393 Ga0070667_100064158
394 Ga0070714_100052104
395 Ga0070713_100263967
396 Ga0070711_100176386
397 Ga0070681_10006998
398 Ga0070681_10013533
399 Ga0070681_10024853
400 Ga0070681_10045158
401 Ga0070681_10066283
402 Ga0070681_10067782
403 Ga0070681_10080242
404 Ga0070681_10096529
405 Ga0070681_10126293
406 Ga0070681_10204576
407 Ga0070679_100036849
408 Ga0070679_100063476
409 Ga0070679_100139021
410 Ga0070684_100023346
411 Ga0070684_100090522
412 Ga0070684_100102097
413 Ga0070684_100178614
414 Ga0070684_100336627
415 Ga0068853_100138128
416 Ga0070665_100036384
417 Ga0070665_100503762
418 Ga0068855_100003593
419 Ga0068855_100067439
420 Ga0068855_100103404
421 Ga0068855_100109013
422 Ga0068855_100180907
423 Ga0068855_100249391
424 Ga0068857_100070429
425 Ga0068857_100079532
426 Ga0068857_100084872
427 Ga0068856_100082109
428 Ga0068856_100106137
429 Ga0068856_100140383
430 Ga0068852_100003674
431 Ga0068852_100158192
432 Ga0068852_100259027
433 Ga0081455_10119327
434 Ga0081455_10134436
435 Ga0070717_10087186
436 Ga0075428_100081648
437 Ga0075433_10100505
438 Ga0075434_100096429
439 Ga0075436_100008094
440 Ga0105240_10109493
441 Ga0105240_10170099
442 Ga0105240_10265786
443 Ga0105240_10267522
444 Ga0105240_10434922
445 Ga0111539_10202088
446 Ga0105243_10302531
447 Ga0105242_10224224
448 Ga0105248_10139829
449 Ga0105237_10066776
450 Ga0105238_10050234
451 Ga0105239_10290005
452 Ga0157373_10031578
453 Ga0157370_10003010
454 Ga0157370_10111581
455 Ga0157369_10004869
456 Ga0157369_10015240
457 Ga0157369_10111383
458 Ga0157369_10124144
459 Ga0157369_10291287
460 Ga0157372_10146712
461 Ga0157372_10175057
462 Ga0157372_10435802
463 Ga0182008_10045355
464 Ga0182006_1014662
465 Ga0197907_10434847
466 Ga0206349_1809227
467 Ga0206350_11122351
468 Ga0206354_10976529
469 Ga0206353_10923009
470 Ga0206353_11136110
471 Ga0206353_11156406
472 Ga0206353_11442449
473 Ga0224712_10002014
474 Ga0224712_10008854
475 Ga0207705_10098748
476 Ga0207707_10003093
477 Ga0207707_10025270
478 Ga0207707_10067230
479 Ga0207707_10162950
480 Ga0207707_10224658
481 Ga0207707_10300418
482 Ga0207707_10366162
483 Ga0207695_10277829
484 Ga0207671_10162750
485 Ga0207663_10252637
486 Ga0207660_10043697
487 Ga0207657_10002919
488 Ga0207657_10010830
489 Ga0207657_10020735
490 Ga0207657_10028683
491 Ga0207657_10061328
492 Ga0207657_10225292
493 Ga0207649_10021794
494 Ga0207652_10092109
495 Ga0207652_10120049
496 Ga0207652_10263319
497 Ga0207652_10280835
498 Ga0207664_10080313
499 Ga0207664_10195244
500 Ga0207644_10013423
501 Ga0207690_10085905
502 Ga0207690_10370135
503 Ga0207711_10077447
504 Ga0207661_10058106
505 Ga0207661_10147943
506 Ga0207661_10180752
507 Ga0207667_10022509
508 Ga0207667_10133908
509 Ga0207667_10222762
510 Ga0207667_10369736
511 Ga0207658_10047104
512 Ga0207702_10058261
513 Ga0207702_10072774
514 Ga0207674_10034576
515 Ga0207698_10066991
516 Ga0207698_10142242
517 Ga0265338_10002640
518 Ga0265338_10012416
519 Ga0265338_10024899
520 Ga0265338_10061567
521 Ga0265338_10224261
522 Ga0265320_10074420
523 Ga0265325_10034373
524 Ga0265327_10009512
525 Ga0265316_10024282
526 Ga0265316_10042701
527 Ga0265313_10008162
528 Ga0265314_10004407
529 Ga0265314_10012572
530 Ga0265342_10035672
531 Ga0265342_10197004
532 Ga0307410_10043135
533 Ga0307407_10004145
534 Ga0307416_100260549
535 Ga0373944_0010385
536 Ga0373936_0005595
537 Ga0373945_0000271
538 Ga0373943_0003399
539 Ga0373943_0030088
540 Ga0373946_0004198
541 Ga0373935_0005188
542 Ga0373927_0055832
543 Ga0373947_0009352
544 Ga0373947_0010694
545 Ga0373937_0045765
546 Ga0373937_0310392
547 Ga0373925_0007482
548 Ga0373925_0033275
549 Ga0395899_0013402
550 Ga0395899_0150684
551 Ga0395900_0018798
552 Ga0395900_0074849
553 Ga0395898_0071451
554 Ga0395898_0089797
555 Ga0395898_0137664
556 Ga0395898_0222637
557 Ga0395898_0228036
558 Ga0395898_0268700
559 Ga0395898_0298747
560 Ga0395898_0334518
561 Ga0395905_0029597
562 Ga0395905_0222079
563 Ga0395905_0344585
564 Ga0395901_0004378
565 Ga0395901_0022039
566 Ga0395901_0076392
567 Ga0395901_0131745
568 Ga0395901_0205057
569 Ga0395901_0327722
570 Ga0436360_0899682
571 Ga0466969_0001587
572 Ga0466966_0100571
573 Ga0466961_0007471
574 Ga0466961_0009997
575 Ga0466963_0000045
576 Ga0466963_0000742
577 Ga0466963_0011111
578 Ga0466963_0049170
579 Ga0466963_0104396
580 Ga0466963_0151315
581 Ga0466964_0009378
582 Ga0466971_0004863
583 Ga0466968_0002788
584 Ga0466968_0008306
585 Ga0466970_0023606
586 Ga0466957_0000686
587 Ga0466957_0003129
588 Ga0466957_0045437
589 Ga0466957_0084944
590 Ga0466959_0043047
591 Ga0466959_0252767
592 Ga0451576_0248367
593 Ga0466958_0009485
594 Ga0466958_0028972
595 Ga0466958_0042155
596 Ga0466958_0083928
597 Ga0466958_0213582
598 Ga0466967_0000248
599 Ga0466967_0006707
600 Ga0466967_0026416
601 Ga0466967_0050450
602 Ga0466967_0056993
603 Ga0466967_0059530
604 Ga0466967_0098158
605 Ga0466967_0107360
606 Ga0466967_0148080
607 Ga0466967_0252794
608 Ga0466967_0290949
609 Ga0495592_0012566
610 Ga0495603_0082651
611 Ga0495629_0000607
612 Ga0495629_0065820
613 Ga0495641_0002588
614 Ga0495641_0022443
615 Ga0495641_0034823
616 Ga0495651_0000080
617 Ga0495651_0072012
618 Ga0495651_0175352
619 Ga0495653_0006383
620 Ga0495653_0098486
621 Ga0495653_0117621
622 Ga0495582_0005526
623 Ga0495639_0090555
624 Ga0495662_0009186
625 Ga0495662_0034985
626 Ga0495664_0112560
627 Ga0495594_0132461
628 Ga0495608_0041238
629 Ga0495618_0011918
630 Ga0495618_0045190
631 Ga0495628_0001647
632 Ga0495628_0163887
633 Ga0495630_0103434
634 Ga0495630_0124547
635 Ga0495630_0138159
636 Ga0495666_0012794
637 Ga0495652_0017232
638 Ga0495652_0086294
639 Ga0495652_0121877
640 Ga0495652_0200131
641 Ga0495652_0261818
642 Ga0495665_0000111
643 Ga0495640_0072149
644 Ga0495640_0098864
645 Ga0495640_0117716
646 Ga0495640_0118944
647 Ga0495586_0040436
648 Ga0495587_0000270
649 Ga0495645_0025737
650 Ga0495667_0019887
651 Ga0495667_0044353
652 Ga0495667_0059555
653 Ga0495667_0142258
654 Ga0495634_0040675
655 Ga0495634_0066651
656 Ga0495634_0140897
657 Ga0495635_0042027
658 Ga0495635_0084324
659 Ga0495588_0062598
660 Ga0495657_0008538
661 Ga0495657_0098818
662 Ga0495657_0157960
663 Ga0495599_0000142
664 Ga0495599_0071250
665 Ga0495599_0155169
666 Ga0495623_0021271
667 Ga0495646_0033947
668 Ga0495647_0027682
669 Ga0495658_0000330
670 Ga0495658_0222750
671 Ga0495613_0009542
672 Ga0495624_0004645
673 Ga0495600_0079549
674 Ga0495600_0099923
675 Ga0495581_0000303
676 Ga0495604_0005999
677 Ga0495604_0049561
678 Ga0495604_0068215
679 Ga0495674_0016398
680 Ga0495674_0045405
681 Ga0495674_0110144
682 Ga0495676_0000450
683 Ga0495680_0004431
684 Ga0495680_0028344
685 Ga0495675_0000896
686 Ga0495684_0028514
687 Ga0495684_0044809
688 Ga0495602_0021235
689 Ga0495602_0043405
690 Ga0496100_0177552
691 Ga0496101_0025055
692 Ga0496101_0044361
693 Ga0496101_0058788
694 Ga0496101_0160415
695 Ga0496102_0072123
696 Ga0496102_0088626
697 Ga0496102_0137575
698 Ga0496103_0009372
699 Ga0496103_0217044
700 Ga0496104_0080822
701 Ga0496105_0146327
702 Ga0496106_0122030
703 Ga0496107_0007299
704 Ga0496107_0093943
705 Ga0496108_0088475
706 Ga0496108_0223015
707 Ga0496109_0099918
708 Ga0496109_0124275
709 Ga0496109_0268470
710 Ga0496110_0539458
711 Ga0496111_0103011
712 Ga0496112_0019685
713 Ga0496112_0059037
714 Ga0496112_0062074
715 Ga0496112_0075275
716 Ga0496112_0090091
717 Ga0496114_0006225
718 Ga0496114_0015307
719 Ga0496114_0180525
720 Ga0496114_0233478
721 Ga0496115_0009421
722 Ga0501033_0214294
723 Ga0501047_0007514
724 Ga0501067_0001219
725 Ga0501067_0037672
726 Ga0501070_0046323
727 Ga0501070_0322832
728 Ga0501079_0040647
729 Ga0501079_0092872
730 Ga0501035_0156250
731 nmdc:mga0n895_34403_c2
732 nmdc:mga0rr50_72951_c1
733 nmdc:mga0a205_40190_c1
734 Ga0495601_0011114
735 Ga0495612_0021274
736 Ga0495612_0067524
737 Ga0495595_0005802
738 Ga0495595_0045682
739 Ga0495595_0115790
740 Ga0495619_0034186
741 Ga0495619_0072885
742 Ga0495619_0129481
743 Ga0466962_0005742
744 Ga0466962_0056746
745 Ga0530510_0031728
746 Ga0530510_0305008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

4

66

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

118

314

0.97

Map