F426274

General Info

Members Datasets Scaffolds Average Seq Length
373 228 746 87

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_11325502|Ga0070681_113255021
Length 95
Sequence MADVHLPSTLSPLFPGLPRQLDVQADTVSELIDHLEREWPGLRDRLCEPGPMLRRHIHVYVNQERAKLDTRLADQSRVDVIAAISGGAGPGHLAP

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
58 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
59 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 2.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 11.8
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 19.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_11325502 3300005458 Unclassified 643
2 Ga0070683_100131712 3300005329 Bacteria 2366
3 Ga0070683_100133383 3300005329 Bacteria 2350
4 Ga0070683_100825532 3300005329 Unclassified 889
5 Ga0070683_100920710 3300005329 Unclassified 839
6 Ga0070680_100011868 3300005336 Bacteria 6757
7 Ga0070682_100194070 3300005337 Bacteria 1428
8 Ga0070660_100050468 3300005339 Bacteria 3201
9 Ga0070691_10195612 3300005341 Bacteria 1060
10 Ga0070691_10221363 3300005341 Bacteria 1003
11 Ga0070661_100068128 3300005344 Bacteria 2616
12 Ga0070668_100917383 3300005347 Bacteria 784
13 Ga0070668_101267463 3300005347 Bacteria 669
14 Ga0070675_100341548 3300005354 Unclassified 1326
15 Ga0070675_100466546 3300005354 Bacteria 1134
16 Ga0070674_100044931 3300005356 Bacteria 3015
17 Ga0070674_100467738 3300005356 Unclassified 1044
18 Ga0070673_100698584 3300005364 Bacteria 931
19 Ga0070673_101464357 3300005364 Bacteria 643
20 Ga0070688_100158982 3300005365 Unclassified 1551
21 Ga0070659_100440369 3300005366 Bacteria 1104
22 Ga0070667_102172168 3300005367 Unclassified 523
23 Ga0070709_10067225 3300005434 Unclassified 2301
24 Ga0070709_10209173 3300005434 Bacteria 1386
25 Ga0070714_100051384 3300005435 Bacteria 3513
26 Ga0070714_100776790 3300005435 Bacteria 927
27 Ga0070714_100923472 3300005435 Bacteria 848
28 Ga0070714_101336275 3300005435 Bacteria 700
29 Ga0070714_102236730 3300005435 Bacteria 532
30 Ga0070713_100058244 3300005436 Bacteria 3221
31 Ga0070713_100525901 3300005436 Bacteria 1118
32 Ga0070711_100290818 3300005439 Bacteria 1296
33 Ga0070708_101814940 3300005445 Bacteria 566
34 Ga0070708_102274616 3300005445 Unclassified 500
35 Ga0070681_10005563 3300005458 Bacteria 12170
36 Ga0070681_10558260 3300005458 Bacteria 1059
37 Ga0068867_100047283 3300005459 Bacteria 3163
38 Ga0070685_10299447 3300005466 Unclassified 1083
39 Ga0070706_100244060 3300005467 Bacteria 1677
40 Ga0070698_100849090 3300005471 Unclassified 858
41 Ga0074259_10434679 3300005507 Bacteria 505
42 Ga0070699_100560996 3300005518 Bacteria 1040
43 Ga0070679_100005979 3300005530 Bacteria 11312
44 Ga0070684_100111175 3300005535 Bacteria 2457
45 Ga0070684_100111572 3300005535 Bacteria 2452
46 Ga0070684_100446297 3300005535 Bacteria 1195
47 Ga0070684_100934597 3300005535 Bacteria 813
48 Ga0070672_100416781 3300005543 Unclassified 1153
49 Ga0070672_100627242 3300005543 Bacteria 938
50 Ga0070696_100334526 3300005546 Bacteria 1169
51 Ga0070704_101659626 3300005549 Bacteria 590
52 Ga0068855_100144957 3300005563 Bacteria 2704
53 Ga0068855_101153752 3300005563 Bacteria 808
54 Ga0068855_101906758 3300005563 Unclassified 602
55 Ga0068854_100108576 3300005578 Bacteria 2090
56 Ga0068854_100695900 3300005578 Bacteria 877
57 Ga0068854_102042107 3300005578 Unclassified 529
58 Ga0068856_100069339 3300005614 Bacteria 3486
59 Ga0068856_101195714 3300005614 Bacteria 777
60 Ga0070702_100079399 3300005615 Bacteria 1961
61 Ga0068861_100611212 3300005719 Bacteria 1002
62 Ga0068858_100310484 3300005842 Unclassified 1506
63 Ga0068860_100275167 3300005843 Bacteria 1644
64 Ga0068862_100213530 3300005844 Bacteria 1744
65 Ga0081455_10020753 3300005937 Bacteria 6177
66 Ga0070717_10047365 3300006028 Bacteria 3522
67 Ga0070717_10541333 3300006028 Bacteria 1054
68 Ga0070717_10733793 3300006028 Unclassified 898
69 Ga0070717_11341195 3300006028 Bacteria 650
70 Ga0075365_11088433 3300006038 Bacteria 563
71 Ga0070716_100131236 3300006173 Bacteria 1584
72 Ga0070712_100854749 3300006175 Bacteria 783
73 Ga0075434_101340725 3300006871 Bacteria 726
74 Ga0068865_100657105 3300006881 Bacteria 892
75 Ga0075436_100115904 3300006914 Bacteria 1872
76 Ga0105240_10044112 3300009093 Bacteria 5669
77 Ga0105240_10926920 3300009093 Bacteria 936
78 Ga0105245_10021635 3300009098 Bacteria 5644
79 Ga0114129_11501968 3300009147 Bacteria 828
80 Ga0105243_11145548 3300009148 Bacteria 788
81 Ga0105242_10442179 3300009176 Bacteria 1223
82 Ga0105242_11417661 3300009176 Bacteria 723
83 Ga0105242_11683023 3300009176 Bacteria 670
84 Ga0105242_12257255 3300009176 Bacteria 590
85 Ga0105248_10110364 3300009177 Bacteria 3101
86 Ga0105248_11959046 3300009177 Bacteria 665
87 Ga0105238_12015441 3300009551 Unclassified 611
88 Ga0105249_10106700 3300009553 Bacteria 2643
89 Ga0105239_10156724 3300010375 Bacteria 2543
90 Ga0105239_12035439 3300010375 Unclassified 667
91 Ga0105239_12164333 3300010375 Bacteria 647
92 Ga0105246_10750004 3300011119 Bacteria 861
93 Ga0105246_10812753 3300011119 Bacteria 830
94 Ga0157320_1018165 3300012481 Bacteria 619
95 Ga0157321_1019400 3300012487 Bacteria 610
96 Ga0157327_1035277 3300012512 Unclassified 646
97 Ga0157373_10977822 3300013100 Bacteria 631
98 Ga0157370_10023626 3300013104 Bacteria 6101
99 Ga0157370_10198315 3300013104 Bacteria 1862
100 Ga0157369_10079013 3300013105 Bacteria 3524
101 Ga0157369_10252900 3300013105 Bacteria 1838
102 Ga0157369_10481829 3300013105 Bacteria 1284
103 Ga0163162_10076224 3300013306 Bacteria 3415
104 Ga0157375_10912607 3300013308 Unclassified 1022
105 Ga0157375_11662687 3300013308 Bacteria 756
106 Ga0163163_10646113 3300014325 Bacteria 1121
107 Ga0163163_10979822 3300014325 Bacteria 909
108 Ga0163163_11707994 3300014325 Bacteria 690
109 Ga0163163_11861306 3300014325 Bacteria 662
110 Ga0157380_11422431 3300014326 Bacteria 744
111 Ga0157380_12397639 3300014326 Unclassified 593
112 Ga0157379_10636595 3300014968 Unclassified 997
113 Ga0157379_10899716 3300014968 Bacteria 840
114 Ga0197907_10434324 3300020069 Unclassified 973
115 Ga0197907_10465623 3300020069 Bacteria 1788
116 Ga0206356_11372788 3300020070 Bacteria 2370
117 Ga0206352_11312522 3300020078 Unclassified 739
118 Ga0206354_11549897 3300020081 Bacteria 1366
119 Ga0206353_11523222 3300020082 Bacteria 6379
120 Ga0206353_11769988 3300020082 Archaea 505
121 Ga0224712_10054154 3300022467 Bacteria 1573
122 Ga0224712_10072449 3300022467 Bacteria 1402
123 Ga0207692_10818242 3300025898 Unclassified 610
124 Ga0207688_10090539 3300025901 Bacteria 1756
125 Ga0207699_10089991 3300025906 Unclassified 1925
126 Ga0207699_10211708 3300025906 Bacteria 1319
127 Ga0207643_10214594 3300025908 Bacteria 1176
128 Ga0207705_10090402 3300025909 Bacteria 2241
129 Ga0207705_10530759 3300025909 Unclassified 915
130 Ga0207684_10756725 3300025910 Bacteria 823
131 Ga0207707_10070608 3300025912 Bacteria 3043
132 Ga0207707_10400398 3300025912 Bacteria 1178
133 Ga0207695_10129780 3300025913 Bacteria 2479
134 Ga0207693_10096857 3300025915 Unclassified 2313
135 Ga0207693_11036512 3300025915 Bacteria 625
136 Ga0207663_10263807 3300025916 Bacteria 1273
137 Ga0207663_11621627 3300025916 Bacteria 521
138 Ga0207660_10727233 3300025917 Bacteria 810
139 Ga0207660_11021435 3300025917 Unclassified 674
140 Ga0207657_10000054 3300025919 Bacteria 106767
141 Ga0207649_10039292 3300025920 Bacteria 2868
142 Ga0207652_10135715 3300025921 Bacteria 2197
143 Ga0207646_10546870 3300025922 Bacteria 1041
144 Ga0207694_11545826 3300025924 Unclassified 560
145 Ga0207659_10919090 3300025926 Unclassified 752
146 Ga0207687_10086506 3300025927 Bacteria 2276
147 Ga0207700_10220250 3300025928 Bacteria 1608
148 Ga0207700_10466431 3300025928 Bacteria 1115
149 Ga0207664_10115711 3300025929 Bacteria 2236
150 Ga0207664_10157829 3300025929 Unclassified 1932
151 Ga0207664_10897200 3300025929 Bacteria 796
152 Ga0207690_11122539 3300025932 Unclassified 656
153 Ga0207706_10684457 3300025933 Bacteria 877
154 Ga0207686_10267611 3300025934 Bacteria 1256
155 Ga0207686_10679501 3300025934 Unclassified 817
156 Ga0207686_11720636 3300025934 Unclassified 519
157 Ga0207709_10027570 3300025935 Bacteria 3274
158 Ga0207669_10271883 3300025937 Bacteria 1273
159 Ga0207669_10402404 3300025937 Unclassified 1073
160 Ga0207704_10184698 3300025938 Bacteria 1510
161 Ga0207665_10234259 3300025939 Bacteria 1350
162 Ga0207691_10387108 3300025940 Unclassified 1193
163 Ga0207711_10771996 3300025941 Bacteria 895
164 Ga0207689_11220643 3300025942 Bacteria 633
165 Ga0207661_10058628 3300025944 Bacteria 3099
166 Ga0207661_10086391 3300025944 Bacteria 2603
167 Ga0207661_10440972 3300025944 Unclassified 1185
168 Ga0207661_12037397 3300025944 Unclassified 520
169 Ga0207667_10429265 3300025949 Bacteria 1344
170 Ga0207667_10998227 3300025949 Bacteria 824
171 Ga0207667_11591042 3300025949 Unclassified 622
172 Ga0207651_10387402 3300025960 Bacteria 1186
173 Ga0207651_10735855 3300025960 Bacteria 871
174 Ga0207712_10219454 3300025961 Bacteria 1519
175 Ga0207668_11274205 3300025972 Bacteria 661
176 Ga0207640_10110815 3300025981 Bacteria 1945
177 Ga0207658_11304469 3300025986 Unclassified 664
178 Ga0207677_10391763 3300026023 Bacteria 1175
179 Ga0207639_11650089 3300026041 Bacteria 601
180 Ga0207708_10096791 3300026075 Unclassified 2281
181 Ga0207708_10390750 3300026075 Bacteria 1148
182 Ga0207702_10117296 3300026078 Bacteria 2377
183 Ga0207702_10268236 3300026078 Bacteria 1609
184 Ga0207702_11246574 3300026078 Bacteria 738
185 Ga0207648_10283907 3300026089 Bacteria 1481
186 Ga0207648_11005098 3300026089 Bacteria 781
187 Ga0207675_101978552 3300026118 Bacteria 601
188 Ga0207683_10790898 3300026121 Bacteria 880
189 Ga0207698_10444943 3300026142 Bacteria 1249
190 Ga0268265_10818480 3300028380 Bacteria 909
191 Ga0268264_10480344 3300028381 Bacteria 1209
192 Ga0265336_10019559 3300028666 Bacteria 2184
193 Ga0265338_10017007 3300028800 Bacteria 7866
194 Ga0265332_10008679 3300031238 Unclassified 4556
195 Ga0265325_10067502 3300031241 Bacteria 1802
196 Ga0265325_10277616 3300031241 Bacteria 752
197 Ga0265340_10091650 3300031247 Unclassified 1420
198 Ga0265339_10002601 3300031249 Bacteria 12877
199 Ga0265327_10068147 3300031251 Bacteria 1791
200 Ga0265327_10072863 3300031251 Bacteria 1715
201 Ga0265316_10068157 3300031344 Bacteria 2750
202 Ga0307408_100889669 3300031548 Bacteria 814
203 Ga0265313_10030584 3300031595 Unclassified 2770
204 Ga0265313_10055036 3300031595 Bacteria 1886
205 Ga0265314_10019069 3300031711 Bacteria 5322
206 Ga0265314_10104756 3300031711 Bacteria 1811
207 Ga0265342_10084637 3300031712 Unclassified 1826
208 Ga0307405_10092653 3300031731 Bacteria 2005
209 Ga0307406_11475256 3300031901 Unclassified 598
210 Ga0307412_10480628 3300031911 Bacteria 1030
211 Ga0307409_100640091 3300031995 Bacteria 1056
212 Ga0307416_100431241 3300032002 Bacteria 1365
213 Ga0307415_101234970 3300032126 Bacteria 705
214 Ga0373956_0206717 3300035119 Bacteria 931
215 Ga0373955_0342614 3300035172 Unclassified 905
216 Ga0373935_0734104 3300035692 Bacteria 727
217 Ga0373937_0886043 3300036401 Bacteria 841
218 Ga0373925_1674332 3300037068 Bacteria 520
219 Ga0395899_0208004 3300037312 Bacteria 1361
220 Ga0395899_0362506 3300037312 Unclassified 967
221 Ga0395900_0055281 3300037418 Bacteria 4088
222 Ga0395900_0079235 3300037418 Bacteria 3375
223 Ga0395900_0183978 3300037418 Bacteria 2122
224 Ga0395900_0307861 3300037418 Bacteria 1568
225 Ga0395900_0453671 3300037418 Bacteria 1238
226 Ga0395900_0529135 3300037418 Bacteria 1126
227 Ga0395900_1214285 3300037418 Bacteria 669
228 Ga0395898_0050847 3300037466 Bacteria 4054
229 Ga0395898_0297094 3300037466 Bacteria 1541
230 Ga0395898_0455368 3300037466 Bacteria 1218
231 Ga0395898_1228621 3300037466 Unclassified 680
232 Ga0395898_1253085 3300037466 Bacteria 672
233 Ga0395898_1787499 3300037466 Unclassified 536
234 Ga0395905_0011128 3300037471 Bacteria 8701
235 Ga0395905_0351781 3300037471 Bacteria 1365
236 Ga0395905_0749466 3300037471 Bacteria 879
237 Ga0395905_1282190 3300037471 Unclassified 636
238 Ga0395901_0005934 3300038443 Bacteria 12369
239 Ga0395901_0631780 3300038443 Bacteria 1076
240 Ga0395901_1172753 3300038443 Bacteria 735
241 Ga0395901_1402211 3300038443 Unclassified 657
242 Ga0436362_0166436 3300039453 Bacteria 624
243 Ga0451795_0968486 3300041456 Bacteria 576
244 Ga0451800_0768410 3300041459 Bacteria 738
245 Ga0451802_0916547 3300041460 Bacteria 974
246 Ga0451845_0989064 3300041501 Bacteria 576
247 Ga0451847_0452846 3300041503 Bacteria 531
248 Ga0451849_0049785 3300041505 Bacteria 582
249 Ga0451853_2968548 3300041512 Bacteria 1000
250 Ga0439431_0182024 3300041997 Unclassified 607
251 Ga0466969_0072782 3300044656 Bacteria 1650
252 Ga0466972_0228044 3300044658 Bacteria 872
253 Ga0466966_0009197 3300044684 Bacteria 6541
254 Ga0466966_0279311 3300044684 Bacteria 1004
255 Ga0466961_0005636 3300044693 Bacteria 7913
256 Ga0466961_0386938 3300044693 Unclassified 849
257 Ga0466963_0030683 3300044694 Bacteria 3470
258 Ga0466963_0159193 3300044694 Bacteria 1571
259 Ga0466963_0217383 3300044694 Bacteria 1338
260 Ga0466963_0539308 3300044694 Bacteria 824
261 Ga0466971_0012360 3300044719 Bacteria 3739
262 Ga0466968_0359984 3300044735 Bacteria 708
263 Ga0466970_0364246 3300044765 Bacteria 821
264 Ga0466957_0010894 3300044842 Bacteria 5230
265 Ga0466957_0042190 3300044842 Bacteria 2759
266 Ga0466957_0080795 3300044842 Bacteria 2024
267 Ga0466959_0058838 3300045049 Bacteria 2799
268 Ga0466959_0104658 3300045049 Bacteria 2024
269 Ga0466959_0177933 3300045049 Unclassified 1489
270 Ga0466958_0010574 3300045836 Bacteria 5171
271 Ga0466958_0095450 3300045836 Bacteria 1844
272 Ga0466958_0233703 3300045836 Bacteria 1174
273 Ga0466967_0125319 3300045976 Bacteria 2378
274 Ga0466967_0164524 3300045976 Bacteria 2084
275 Ga0466967_0277426 3300045976 Bacteria 1607
276 Ga0466967_0501517 3300045976 Bacteria 1191
277 Ga0466967_1021510 3300045976 Bacteria 823
278 Ga0466967_1146374 3300045976 Bacteria 775
279 Ga0466967_1241357 3300045976 Bacteria 742
280 Ga0466967_2410083 3300045976 Bacteria 521
281 Ga0495592_0144851 3300046454 Unclassified 1648
282 Ga0495651_0088568 3300046462 Bacteria 2326
283 Ga0495653_0479198 3300046463 Bacteria 779
284 Ga0495653_0581168 3300046463 Bacteria 690
285 Ga0495582_0523976 3300046473 Unclassified 685
286 Ga0495662_0240584 3300046476 Unclassified 892
287 Ga0495664_0063511 3300046477 Bacteria 2201
288 Ga0495608_0056012 3300046511 Bacteria 2605
289 Ga0495618_0019626 3300046514 Bacteria 4161
290 Ga0495628_0628473 3300046516 Bacteria 764
291 Ga0495630_0572834 3300046517 Bacteria 866
292 Ga0495644_0113283 3300046523 Bacteria 1030
293 Ga0495652_0420809 3300046529 Unclassified 941
294 Ga0495652_0884672 3300046529 Bacteria 590
295 Ga0495665_0229586 3300046531 Bacteria 958
296 Ga0495586_0010916 3300046535 Bacteria 4826
297 Ga0495587_0230906 3300046536 Bacteria 1043
298 Ga0495645_0561657 3300046543 Bacteria 706
299 Ga0495634_0096514 3300046642 Bacteria 1914
300 Ga0495634_0765439 3300046642 Bacteria 552
301 Ga0495611_0292078 3300046648 Bacteria 752
302 Ga0495635_0229765 3300046663 Bacteria 1253
303 Ga0495599_0110529 3300046678 Bacteria 1712
304 Ga0495646_0422388 3300046680 Bacteria 691
305 Ga0495646_0481320 3300046680 Bacteria 639
306 Ga0495613_0048288 3300046689 Bacteria 3143
307 Ga0495613_0297520 3300046689 Unclassified 1118
308 Ga0495589_0050121 3300046794 Bacteria 2066
309 Ga0495589_0282395 3300046794 Bacteria 772
310 Ga0495604_0177944 3300047317 Bacteria 1490
311 Ga0495674_0169732 3300047319 Bacteria 1821
312 Ga0495674_0703242 3300047319 Bacteria 793
313 Ga0495676_0629907 3300047321 Bacteria 697
314 Ga0495684_0018569 3300047471 Bacteria 5357
315 Ga0495602_0924599 3300048088 Bacteria 579
316 Ga0496100_0640613 3300048903 Bacteria 827
317 Ga0496100_0657129 3300048903 Unclassified 816
318 Ga0496101_0005954 3300048904 Bacteria 7814
319 Ga0496101_0439185 3300048904 Bacteria 1029
320 Ga0496101_1578242 3300048904 Unclassified 510
321 Ga0496102_0012042 3300048905 Bacteria 7475
322 Ga0496102_0100349 3300048905 Bacteria 2688
323 Ga0496102_0368467 3300048905 Bacteria 1352
324 Ga0496103_0227740 3300048906 Bacteria 1199
325 Ga0496103_0290759 3300048906 Bacteria 1051
326 Ga0496104_0250590 3300048907 Bacteria 1683
327 Ga0496104_0434368 3300048907 Unclassified 1225
328 Ga0496104_1187275 3300048907 Unclassified 666
329 Ga0496105_0027226 3300048908 Bacteria 4668
330 Ga0496105_1390472 3300048908 Bacteria 509
331 Ga0496106_0001631 3300048909 Bacteria 16842
332 Ga0496106_0038625 3300048909 Bacteria 3574
333 Ga0496106_1010273 3300048909 Unclassified 654
334 Ga0496106_1155927 3300048909 Unclassified 605
335 Ga0496107_0006988 3300048910 Bacteria 7775
336 Ga0496107_0095851 3300048910 Bacteria 2171
337 Ga0496108_0071258 3300048911 Bacteria 2932
338 Ga0496108_0564466 3300048911 Bacteria 992
339 Ga0496108_1390741 3300048911 Bacteria 587
340 Ga0496109_0080601 3300048912 Unclassified 2999
341 Ga0496109_0083202 3300048912 Bacteria 2951
342 Ga0496109_0194649 3300048912 Bacteria 1905
343 Ga0496109_1906109 3300048912 Bacteria 527
344 Ga0496110_0091182 3300048913 Bacteria 2726
345 Ga0496110_0538405 3300048913 Bacteria 1062
346 Ga0496111_0089740 3300048914 Bacteria 2251
347 Ga0496112_0034036 3300048915 Bacteria 4957
348 Ga0496112_0078570 3300048915 Bacteria 3263
349 Ga0496112_0334920 3300048915 Bacteria 1457
350 Ga0496112_0696434 3300048915 Bacteria 944
351 Ga0496112_1158952 3300048915 Unclassified 690
352 Ga0496113_0987565 3300048916 Bacteria 663
353 Ga0496114_0013327 3300048917 Bacteria 6590
354 Ga0496114_0134960 3300048917 Bacteria 2133
355 Ga0496114_0272563 3300048917 Unclassified 1491
356 Ga0496115_0569475 3300048918 Bacteria 903
357 Ga0501040_0172133 3300049576 Bacteria 1533
358 Ga0501067_0583157 3300049583 Unclassified 627
359 Ga0501072_0987996 3300049588 Unclassified 656
360 Ga0501074_0417099 3300049590 Bacteria 952
361 Ga0501081_0165079 3300049743 Bacteria 1597
362 Ga0501045_0182010 3300049824 Bacteria 1566
363 nmdc:mga05p37_1096267_c1 3300050507 Bacteria 834
364 nmdc:mga0n895_1808113_c1 3300050512 Bacteria 571
365 nmdc:mga08x19_104620_c1 3300050514 Bacteria 1881
366 nmdc:mga08x19_890864_c1 3300050514 Unclassified 632
367 Ga0495601_0168347 3300053077 Bacteria 1432
368 Ga0495601_0308556 3300053077 Bacteria 1030
369 Ga0495612_0237674 3300053078 Unclassified 809
370 Ga0495595_0199677 3300053084 Bacteria 995
371 Ga0495619_0035187 3300053085 Bacteria 3257
372 Ga0466962_0006338 3300061719 Bacteria 5678
373 Ga0530510_0602087 3300061734 Bacteria 836
374 Ga0070681_11325502
375 Ga0070683_100131712
376 Ga0070683_100133383
377 Ga0070683_100825532
378 Ga0070683_100920710
379 Ga0070680_100011868
380 Ga0070682_100194070
381 Ga0070660_100050468
382 Ga0070691_10195612
383 Ga0070691_10221363
384 Ga0070661_100068128
385 Ga0070668_100917383
386 Ga0070668_101267463
387 Ga0070675_100341548
388 Ga0070675_100466546
389 Ga0070674_100044931
390 Ga0070674_100467738
391 Ga0070673_100698584
392 Ga0070673_101464357
393 Ga0070688_100158982
394 Ga0070659_100440369
395 Ga0070667_102172168
396 Ga0070709_10067225
397 Ga0070709_10209173
398 Ga0070714_100051384
399 Ga0070714_100776790
400 Ga0070714_100923472
401 Ga0070714_101336275
402 Ga0070714_102236730
403 Ga0070713_100058244
404 Ga0070713_100525901
405 Ga0070711_100290818
406 Ga0070708_101814940
407 Ga0070708_102274616
408 Ga0070681_10005563
409 Ga0070681_10558260
410 Ga0068867_100047283
411 Ga0070685_10299447
412 Ga0070706_100244060
413 Ga0070698_100849090
414 Ga0074259_10434679
415 Ga0070699_100560996
416 Ga0070679_100005979
417 Ga0070684_100111175
418 Ga0070684_100111572
419 Ga0070684_100446297
420 Ga0070684_100934597
421 Ga0070672_100416781
422 Ga0070672_100627242
423 Ga0070696_100334526
424 Ga0070704_101659626
425 Ga0068855_100144957
426 Ga0068855_101153752
427 Ga0068855_101906758
428 Ga0068854_100108576
429 Ga0068854_100695900
430 Ga0068854_102042107
431 Ga0068856_100069339
432 Ga0068856_101195714
433 Ga0070702_100079399
434 Ga0068861_100611212
435 Ga0068858_100310484
436 Ga0068860_100275167
437 Ga0068862_100213530
438 Ga0081455_10020753
439 Ga0070717_10047365
440 Ga0070717_10541333
441 Ga0070717_10733793
442 Ga0070717_11341195
443 Ga0075365_11088433
444 Ga0070716_100131236
445 Ga0070712_100854749
446 Ga0075434_101340725
447 Ga0068865_100657105
448 Ga0075436_100115904
449 Ga0105240_10044112
450 Ga0105240_10926920
451 Ga0105245_10021635
452 Ga0114129_11501968
453 Ga0105243_11145548
454 Ga0105242_10442179
455 Ga0105242_11417661
456 Ga0105242_11683023
457 Ga0105242_12257255
458 Ga0105248_10110364
459 Ga0105248_11959046
460 Ga0105238_12015441
461 Ga0105249_10106700
462 Ga0105239_10156724
463 Ga0105239_12035439
464 Ga0105239_12164333
465 Ga0105246_10750004
466 Ga0105246_10812753
467 Ga0157320_1018165
468 Ga0157321_1019400
469 Ga0157327_1035277
470 Ga0157373_10977822
471 Ga0157370_10023626
472 Ga0157370_10198315
473 Ga0157369_10079013
474 Ga0157369_10252900
475 Ga0157369_10481829
476 Ga0163162_10076224
477 Ga0157375_10912607
478 Ga0157375_11662687
479 Ga0163163_10646113
480 Ga0163163_10979822
481 Ga0163163_11707994
482 Ga0163163_11861306
483 Ga0157380_11422431
484 Ga0157380_12397639
485 Ga0157379_10636595
486 Ga0157379_10899716
487 Ga0197907_10434324
488 Ga0197907_10465623
489 Ga0206356_11372788
490 Ga0206352_11312522
491 Ga0206354_11549897
492 Ga0206353_11523222
493 Ga0206353_11769988
494 Ga0224712_10054154
495 Ga0224712_10072449
496 Ga0207692_10818242
497 Ga0207688_10090539
498 Ga0207699_10089991
499 Ga0207699_10211708
500 Ga0207643_10214594
501 Ga0207705_10090402
502 Ga0207705_10530759
503 Ga0207684_10756725
504 Ga0207707_10070608
505 Ga0207707_10400398
506 Ga0207695_10129780
507 Ga0207693_10096857
508 Ga0207693_11036512
509 Ga0207663_10263807
510 Ga0207663_11621627
511 Ga0207660_10727233
512 Ga0207660_11021435
513 Ga0207657_10000054
514 Ga0207649_10039292
515 Ga0207652_10135715
516 Ga0207646_10546870
517 Ga0207694_11545826
518 Ga0207659_10919090
519 Ga0207687_10086506
520 Ga0207700_10220250
521 Ga0207700_10466431
522 Ga0207664_10115711
523 Ga0207664_10157829
524 Ga0207664_10897200
525 Ga0207690_11122539
526 Ga0207706_10684457
527 Ga0207686_10267611
528 Ga0207686_10679501
529 Ga0207686_11720636
530 Ga0207709_10027570
531 Ga0207669_10271883
532 Ga0207669_10402404
533 Ga0207704_10184698
534 Ga0207665_10234259
535 Ga0207691_10387108
536 Ga0207711_10771996
537 Ga0207689_11220643
538 Ga0207661_10058628
539 Ga0207661_10086391
540 Ga0207661_10440972
541 Ga0207661_12037397
542 Ga0207667_10429265
543 Ga0207667_10998227
544 Ga0207667_11591042
545 Ga0207651_10387402
546 Ga0207651_10735855
547 Ga0207712_10219454
548 Ga0207668_11274205
549 Ga0207640_10110815
550 Ga0207658_11304469
551 Ga0207677_10391763
552 Ga0207639_11650089
553 Ga0207708_10096791
554 Ga0207708_10390750
555 Ga0207702_10117296
556 Ga0207702_10268236
557 Ga0207702_11246574
558 Ga0207648_10283907
559 Ga0207648_11005098
560 Ga0207675_101978552
561 Ga0207683_10790898
562 Ga0207698_10444943
563 Ga0268265_10818480
564 Ga0268264_10480344
565 Ga0265336_10019559
566 Ga0265338_10017007
567 Ga0265332_10008679
568 Ga0265325_10067502
569 Ga0265325_10277616
570 Ga0265340_10091650
571 Ga0265339_10002601
572 Ga0265327_10068147
573 Ga0265327_10072863
574 Ga0265316_10068157
575 Ga0307408_100889669
576 Ga0265313_10030584
577 Ga0265313_10055036
578 Ga0265314_10019069
579 Ga0265314_10104756
580 Ga0265342_10084637
581 Ga0307405_10092653
582 Ga0307406_11475256
583 Ga0307412_10480628
584 Ga0307409_100640091
585 Ga0307416_100431241
586 Ga0307415_101234970
587 Ga0373956_0206717
588 Ga0373955_0342614
589 Ga0373935_0734104
590 Ga0373937_0886043
591 Ga0373925_1674332
592 Ga0395899_0208004
593 Ga0395899_0362506
594 Ga0395900_0055281
595 Ga0395900_0079235
596 Ga0395900_0183978
597 Ga0395900_0307861
598 Ga0395900_0453671
599 Ga0395900_0529135
600 Ga0395900_1214285
601 Ga0395898_0050847
602 Ga0395898_0297094
603 Ga0395898_0455368
604 Ga0395898_1228621
605 Ga0395898_1253085
606 Ga0395898_1787499
607 Ga0395905_0011128
608 Ga0395905_0351781
609 Ga0395905_0749466
610 Ga0395905_1282190
611 Ga0395901_0005934
612 Ga0395901_0631780
613 Ga0395901_1172753
614 Ga0395901_1402211
615 Ga0436362_0166436
616 Ga0451795_0968486
617 Ga0451800_0768410
618 Ga0451802_0916547
619 Ga0451845_0989064
620 Ga0451847_0452846
621 Ga0451849_0049785
622 Ga0451853_2968548
623 Ga0439431_0182024
624 Ga0466969_0072782
625 Ga0466972_0228044
626 Ga0466966_0009197
627 Ga0466966_0279311
628 Ga0466961_0005636
629 Ga0466961_0386938
630 Ga0466963_0030683
631 Ga0466963_0159193
632 Ga0466963_0217383
633 Ga0466963_0539308
634 Ga0466971_0012360
635 Ga0466968_0359984
636 Ga0466970_0364246
637 Ga0466957_0010894
638 Ga0466957_0042190
639 Ga0466957_0080795
640 Ga0466959_0058838
641 Ga0466959_0104658
642 Ga0466959_0177933
643 Ga0466958_0010574
644 Ga0466958_0095450
645 Ga0466958_0233703
646 Ga0466967_0125319
647 Ga0466967_0164524
648 Ga0466967_0277426
649 Ga0466967_0501517
650 Ga0466967_1021510
651 Ga0466967_1146374
652 Ga0466967_1241357
653 Ga0466967_2410083
654 Ga0495592_0144851
655 Ga0495651_0088568
656 Ga0495653_0479198
657 Ga0495653_0581168
658 Ga0495582_0523976
659 Ga0495662_0240584
660 Ga0495664_0063511
661 Ga0495608_0056012
662 Ga0495618_0019626
663 Ga0495628_0628473
664 Ga0495630_0572834
665 Ga0495644_0113283
666 Ga0495652_0420809
667 Ga0495652_0884672
668 Ga0495665_0229586
669 Ga0495586_0010916
670 Ga0495587_0230906
671 Ga0495645_0561657
672 Ga0495634_0096514
673 Ga0495634_0765439
674 Ga0495611_0292078
675 Ga0495635_0229765
676 Ga0495599_0110529
677 Ga0495646_0422388
678 Ga0495646_0481320
679 Ga0495613_0048288
680 Ga0495613_0297520
681 Ga0495589_0050121
682 Ga0495589_0282395
683 Ga0495604_0177944
684 Ga0495674_0169732
685 Ga0495674_0703242
686 Ga0495676_0629907
687 Ga0495684_0018569
688 Ga0495602_0924599
689 Ga0496100_0640613
690 Ga0496100_0657129
691 Ga0496101_0005954
692 Ga0496101_0439185
693 Ga0496101_1578242
694 Ga0496102_0012042
695 Ga0496102_0100349
696 Ga0496102_0368467
697 Ga0496103_0227740
698 Ga0496103_0290759
699 Ga0496104_0250590
700 Ga0496104_0434368
701 Ga0496104_1187275
702 Ga0496105_0027226
703 Ga0496105_1390472
704 Ga0496106_0001631
705 Ga0496106_0038625
706 Ga0496106_1010273
707 Ga0496106_1155927
708 Ga0496107_0006988
709 Ga0496107_0095851
710 Ga0496108_0071258
711 Ga0496108_0564466
712 Ga0496108_1390741
713 Ga0496109_0080601
714 Ga0496109_0083202
715 Ga0496109_0194649
716 Ga0496109_1906109
717 Ga0496110_0091182
718 Ga0496110_0538405
719 Ga0496111_0089740
720 Ga0496112_0034036
721 Ga0496112_0078570
722 Ga0496112_0334920
723 Ga0496112_0696434
724 Ga0496112_1158952
725 Ga0496113_0987565
726 Ga0496114_0013327
727 Ga0496114_0134960
728 Ga0496114_0272563
729 Ga0496115_0569475
730 Ga0501040_0172133
731 Ga0501067_0583157
732 Ga0501072_0987996
733 Ga0501074_0417099
734 Ga0501081_0165079
735 Ga0501045_0182010
736 nmdc:mga05p37_1096267_c1
737 nmdc:mga0n895_1808113_c1
738 nmdc:mga08x19_104620_c1
739 nmdc:mga08x19_890864_c1
740 Ga0495601_0168347
741 Ga0495601_0308556
742 Ga0495612_0237674
743 Ga0495595_0199677
744 Ga0495619_0035187
745 Ga0466962_0006338
746 Ga0530510_0602087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

13

87

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8804 1 84
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8666 1 87
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8575 1 87
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8433 1 84
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8262 3 82
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8666 1 87 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8575 1 87 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8262 3 82 3.10.20.30
af_Q9VN82_366_475_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8174 59 80 2.60.200.20
4wwmB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8075 3 82 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A529I7N5-F1-model_v4 MoaD/ThiS family protein 0.9806 2 75
AF-A0A0A0D3P6-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9778 3 73
AF-A0A5C7NWK1-F1-model_v4 deleted 0.9735 2 87
AF-A0A541C2T2-F1-model_v4 MoaD/ThiS family protein 0.9712 2 87
AF-A0A5S9PX83-F1-model_v4 Sulfur carrier protein CysO 0.9703 2 87

Map