F426265
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 373 | 232 | 373 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_101508561|Ga0070713_1015085612 |
| Length | 147 |
| Sequence | VSEGRLPRAVLLDTCAVIWLANGDPLAGSAAAAIVGAGLADGVFVSPVSAWEVGLLSKPKAGRTTAVRFMPDPKTWFARVMAGPAIKEAPLTSEIAIDASFLPGDLHGDPGDRLIVTTARHLGIPIVTRDRRIIACASEGHVDVIAC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 75 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 76 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 120 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 130 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 138 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 139 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 140 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 141 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 142 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 179 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 180 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 212 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 218 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 219 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 220 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 221 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 222 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 223 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 224 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 225 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 226 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 227 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 228 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 229 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.2 |
| Metatranscriptomes | 0.8 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.63 |
| Nodule | 0 |
| Rhizoplane | 2.41 |
| Rhizosphere | 85.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10016401 | 3300003203 | Bacteria | 3089 |
| 2 | rootH2_10128887 | 3300003320 | Bacteria | 3009 |
| 3 | Ga0058862_11684349 | 3300004803 | Bacteria | 902 |
| 4 | Ga0065707_10647718 | 3300005295 | Bacteria | 665 |
| 5 | Ga0070683_100082955 | 3300005329 | Bacteria | 3002 |
| 6 | Ga0070670_100015275 | 3300005331 | Bacteria | 6591 |
| 7 | Ga0070666_10475718 | 3300005335 | Unclassified | 904 |
| 8 | Ga0070680_100036145 | 3300005336 | Bacteria | 3990 |
| 9 | Ga0070680_100129153 | 3300005336 | Bacteria | 2113 |
| 10 | Ga0070680_100183802 | 3300005336 | Unclassified | 1761 |
| 11 | Ga0070660_100037769 | 3300005339 | Bacteria | 3661 |
| 12 | Ga0070661_100001149 | 3300005344 | Bacteria | 18629 |
| 13 | Ga0070661_100089357 | 3300005344 | Bacteria | 2281 |
| 14 | Ga0070669_101043183 | 3300005353 | Bacteria | 703 |
| 15 | Ga0070675_101347528 | 3300005354 | Unclassified | 658 |
| 16 | Ga0070671_100015403 | 3300005355 | Bacteria | 6177 |
| 17 | Ga0070671_100466460 | 3300005355 | Unclassified | 1084 |
| 18 | Ga0070674_101398914 | 3300005356 | Unclassified | 626 |
| 19 | Ga0070673_100044752 | 3300005364 | Bacteria | 3429 |
| 20 | Ga0070688_100050216 | 3300005365 | Bacteria | 2598 |
| 21 | Ga0070709_10061935 | 3300005434 | Bacteria | 2384 |
| 22 | Ga0070714_100037201 | 3300005435 | Bacteria | 4088 |
| 23 | Ga0070714_100113458 | 3300005435 | Unclassified | 2403 |
| 24 | Ga0070714_100489610 | 3300005435 | Bacteria | 1172 |
| 25 | Ga0070713_101508561 | 3300005436 | Unclassified | 652 |
| 26 | Ga0070710_10570532 | 3300005437 | Bacteria | 784 |
| 27 | Ga0070708_100803315 | 3300005445 | Unclassified | 884 |
| 28 | Ga0070662_100247874 | 3300005457 | Unclassified | 1431 |
| 29 | Ga0070681_10058506 | 3300005458 | Bacteria | 3834 |
| 30 | Ga0070681_10208389 | 3300005458 | Bacteria | 1871 |
| 31 | Ga0070681_10253939 | 3300005458 | Bacteria | 1670 |
| 32 | Ga0070681_10280427 | 3300005458 | Unclassified | 1577 |
| 33 | Ga0070681_10871566 | 3300005458 | Bacteria | 818 |
| 34 | Ga0070706_100235289 | 3300005467 | Unclassified | 1710 |
| 35 | Ga0070707_100093801 | 3300005468 | Archaea | 2906 |
| 36 | Ga0070698_100002647 | 3300005471 | Bacteria | 19740 |
| 37 | Ga0070699_100432953 | 3300005518 | Bacteria | 1192 |
| 38 | Ga0070679_100024929 | 3300005530 | Bacteria | 5864 |
| 39 | Ga0070679_100371523 | 3300005530 | Unclassified | 1377 |
| 40 | Ga0070679_100415295 | 3300005530 | Unclassified | 1291 |
| 41 | Ga0070679_100532802 | 3300005530 | Bacteria | 1118 |
| 42 | Ga0070684_100004374 | 3300005535 | Bacteria | 10739 |
| 43 | Ga0070697_100121118 | 3300005536 | Bacteria | 2188 |
| 44 | Ga0068853_100002720 | 3300005539 | Bacteria | 13352 |
| 45 | Ga0068853_100005433 | 3300005539 | Bacteria | 9987 |
| 46 | Ga0070695_100207843 | 3300005545 | Bacteria | 1403 |
| 47 | Ga0070665_100078222 | 3300005548 | Bacteria | 3314 |
| 48 | Ga0068855_100313086 | 3300005563 | Bacteria | 1736 |
| 49 | Ga0070664_100871817 | 3300005564 | Unclassified | 843 |
| 50 | Ga0068857_100235216 | 3300005577 | Bacteria | 1676 |
| 51 | Ga0068857_101432821 | 3300005577 | Unclassified | 672 |
| 52 | Ga0068856_100458787 | 3300005614 | Bacteria | 1295 |
| 53 | Ga0068856_101069163 | 3300005614 | Unclassified | 825 |
| 54 | Ga0068856_102135306 | 3300005614 | Unclassified | 569 |
| 55 | Ga0068856_102274294 | 3300005614 | Unclassified | 550 |
| 56 | Ga0068852_100153849 | 3300005616 | Bacteria | 2141 |
| 57 | Ga0068852_101373198 | 3300005616 | Bacteria | 728 |
| 58 | Ga0068851_10044736 | 3300005834 | Bacteria | 2236 |
| 59 | Ga0081455_10003187 | 3300005937 | Bacteria | 19036 |
| 60 | Ga0081539_10000240 | 3300005985 | Bacteria | 128629 |
| 61 | Ga0070717_10089185 | 3300006028 | Bacteria | 2601 |
| 62 | Ga0070717_10114118 | 3300006028 | Unclassified | 2307 |
| 63 | Ga0070717_10164715 | 3300006028 | Bacteria | 1925 |
| 64 | Ga0070715_10017572 | 3300006163 | Bacteria | 2710 |
| 65 | Ga0070716_100356896 | 3300006173 | Bacteria | 1037 |
| 66 | Ga0070712_100093298 | 3300006175 | Bacteria | 2209 |
| 67 | Ga0070712_101214396 | 3300006175 | Bacteria | 656 |
| 68 | Ga0070712_101498902 | 3300006175 | Unclassified | 589 |
| 69 | Ga0075367_10745082 | 3300006178 | Unclassified | 623 |
| 70 | Ga0075366_10198394 | 3300006195 | Bacteria | 1220 |
| 71 | Ga0097621_100127684 | 3300006237 | Bacteria | 2161 |
| 72 | Ga0068871_100102058 | 3300006358 | Bacteria | 2404 |
| 73 | Ga0068871_100650615 | 3300006358 | Unclassified | 962 |
| 74 | Ga0099794_10050066 | 3300007265 | Bacteria | 2009 |
| 75 | Ga0099794_10623609 | 3300007265 | Bacteria | 572 |
| 76 | Ga0105240_10001227 | 3300009093 | Bacteria | 44588 |
| 77 | Ga0105240_10039238 | 3300009093 | Bacteria | 6066 |
| 78 | Ga0105240_10699194 | 3300009093 | Bacteria | 1107 |
| 79 | Ga0105245_10373634 | 3300009098 | Unclassified | 1418 |
| 80 | Ga0105247_11766414 | 3300009101 | Unclassified | 513 |
| 81 | Ga0105241_10141012 | 3300009174 | Unclassified | 1962 |
| 82 | Ga0105241_10570307 | 3300009174 | Bacteria | 1019 |
| 83 | Ga0105242_10202748 | 3300009176 | Bacteria | 1763 |
| 84 | Ga0105242_10217027 | 3300009176 | Unclassified | 1707 |
| 85 | Ga0105248_10000009 | 3300009177 | Bacteria | 403549 |
| 86 | Ga0105248_10188536 | 3300009177 | Unclassified | 2323 |
| 87 | Ga0105237_10005387 | 3300009545 | Bacteria | 14457 |
| 88 | Ga0105237_10102629 | 3300009545 | Bacteria | 2852 |
| 89 | Ga0105237_11147100 | 3300009545 | Unclassified | 784 |
| 90 | Ga0105238_10114664 | 3300009551 | Bacteria | 2674 |
| 91 | Ga0105239_10092708 | 3300010375 | Bacteria | 3334 |
| 92 | Ga0105239_10666742 | 3300010375 | Bacteria | 1188 |
| 93 | Ga0105246_10527759 | 3300011119 | Bacteria | 1007 |
| 94 | Ga0157370_10200227 | 3300013104 | Bacteria | 1852 |
| 95 | Ga0157369_10133905 | 3300013105 | Bacteria | 2625 |
| 96 | Ga0157369_12027359 | 3300013105 | Unclassified | 584 |
| 97 | Ga0157378_12402862 | 3300013297 | Bacteria | 579 |
| 98 | Ga0157372_11050662 | 3300013307 | Bacteria | 943 |
| 99 | Ga0163163_10073055 | 3300014325 | Bacteria | 3420 |
| 100 | Ga0163163_10495516 | 3300014325 | Unclassified | 1283 |
| 101 | Ga0182008_10055425 | 3300014497 | Bacteria | 1960 |
| 102 | Ga0157379_11700175 | 3300014968 | Bacteria | 618 |
| 103 | Ga0157376_10157302 | 3300014969 | Bacteria | 2056 |
| 104 | Ga0182007_10331304 | 3300015262 | Unclassified | 567 |
| 105 | Ga0206356_11282669 | 3300020070 | Bacteria | 1699 |
| 106 | Ga0206353_10947098 | 3300020082 | Bacteria | 1096 |
| 107 | Ga0213874_10093263 | 3300021377 | Bacteria | 992 |
| 108 | Ga0213876_10000346 | 3300021384 | Bacteria | 40175 |
| 109 | Ga0213876_10101090 | 3300021384 | Bacteria | 1529 |
| 110 | Ga0213876_10491415 | 3300021384 | Unclassified | 653 |
| 111 | Ga0213875_10000025 | 3300021388 | Bacteria | 197787 |
| 112 | Ga0228598_1001437 | 3300024227 | Bacteria | 5242 |
| 113 | Ga0207656_10007821 | 3300025321 | Bacteria | 3914 |
| 114 | Ga0207682_10223174 | 3300025893 | Unclassified | 872 |
| 115 | Ga0207692_11193404 | 3300025898 | Unclassified | 505 |
| 116 | Ga0207680_10335674 | 3300025903 | Unclassified | 1059 |
| 117 | Ga0207685_10063951 | 3300025905 | Bacteria | 1468 |
| 118 | Ga0207699_10187728 | 3300025906 | Bacteria | 1393 |
| 119 | Ga0207684_10196867 | 3300025910 | Unclassified | 1738 |
| 120 | Ga0207707_10004473 | 3300025912 | Bacteria | 12303 |
| 121 | Ga0207707_10046465 | 3300025912 | Bacteria | 3782 |
| 122 | Ga0207707_10238352 | 3300025912 | Bacteria | 1582 |
| 123 | Ga0207707_10717112 | 3300025912 | Bacteria | 839 |
| 124 | Ga0207695_10008451 | 3300025913 | Bacteria | 12893 |
| 125 | Ga0207695_10093723 | 3300025913 | Bacteria | 3012 |
| 126 | Ga0207671_10146157 | 3300025914 | Unclassified | 1824 |
| 127 | Ga0207693_10101134 | 3300025915 | Bacteria | 2260 |
| 128 | Ga0207663_10492202 | 3300025916 | Unclassified | 951 |
| 129 | Ga0207663_10561086 | 3300025916 | Bacteria | 893 |
| 130 | Ga0207660_10021022 | 3300025917 | Bacteria | 4385 |
| 131 | Ga0207660_10554245 | 3300025917 | Bacteria | 935 |
| 132 | Ga0207660_11394553 | 3300025917 | Unclassified | 568 |
| 133 | Ga0207657_10004981 | 3300025919 | Bacteria | 13971 |
| 134 | Ga0207649_10010898 | 3300025920 | Bacteria | 4998 |
| 135 | Ga0207649_10117046 | 3300025920 | Bacteria | 1791 |
| 136 | Ga0207649_11240723 | 3300025920 | Unclassified | 589 |
| 137 | Ga0207652_10042013 | 3300025921 | Bacteria | 3889 |
| 138 | Ga0207652_10426411 | 3300025921 | Bacteria | 1196 |
| 139 | Ga0207646_10400570 | 3300025922 | Unclassified | 1239 |
| 140 | Ga0207694_10051823 | 3300025924 | Bacteria | 3180 |
| 141 | Ga0207650_10159604 | 3300025925 | Bacteria | 1786 |
| 142 | Ga0207659_10656465 | 3300025926 | Unclassified | 897 |
| 143 | Ga0207687_10243187 | 3300025927 | Unclassified | 1427 |
| 144 | Ga0207664_10030963 | 3300025929 | Bacteria | 4090 |
| 145 | Ga0207664_10261187 | 3300025929 | Bacteria | 1514 |
| 146 | Ga0207664_10891012 | 3300025929 | Unclassified | 799 |
| 147 | Ga0207644_10005879 | 3300025931 | Bacteria | 8001 |
| 148 | Ga0207706_10246412 | 3300025933 | Unclassified | 1561 |
| 149 | Ga0207686_10057396 | 3300025934 | Bacteria | 2451 |
| 150 | Ga0207669_11136084 | 3300025937 | Unclassified | 660 |
| 151 | Ga0207665_10061144 | 3300025939 | Bacteria | 2552 |
| 152 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 153 | Ga0207711_10000005 | 3300025941 | Bacteria | 822972 |
| 154 | Ga0207711_10000009 | 3300025941 | Bacteria | 580864 |
| 155 | Ga0207711_10000015 | 3300025941 | Bacteria | 494097 |
| 156 | Ga0207661_10175082 | 3300025944 | Bacteria | 1870 |
| 157 | Ga0207661_11875326 | 3300025944 | Unclassified | 545 |
| 158 | Ga0207667_10058126 | 3300025949 | Bacteria | 4058 |
| 159 | Ga0207651_10132578 | 3300025960 | Bacteria | 1910 |
| 160 | Ga0207639_10002122 | 3300026041 | Bacteria | 13359 |
| 161 | Ga0207639_10037304 | 3300026041 | Bacteria | 3609 |
| 162 | Ga0207702_10294105 | 3300026078 | Bacteria | 1539 |
| 163 | Ga0207674_10225991 | 3300026116 | Bacteria | 1820 |
| 164 | Ga0207674_11745655 | 3300026116 | Unclassified | 590 |
| 165 | Ga0207698_10011635 | 3300026142 | Bacteria | 5716 |
| 166 | Ga0207698_10380598 | 3300026142 | Bacteria | 1342 |
| 167 | Ga0268266_10066315 | 3300028379 | Bacteria | 3122 |
| 168 | Ga0265337_1003275 | 3300028556 | Bacteria | 7076 |
| 169 | Ga0265334_10002710 | 3300028573 | Bacteria | 8183 |
| 170 | Ga0265318_10000046 | 3300028577 | Bacteria | 126568 |
| 171 | Ga0265338_10014216 | 3300028800 | Bacteria | 8886 |
| 172 | Ga0265330_10060550 | 3300031235 | Bacteria | 1647 |
| 173 | Ga0265330_10066786 | 3300031235 | Bacteria | 1559 |
| 174 | Ga0265330_10109102 | 3300031235 | Bacteria | 1183 |
| 175 | Ga0265325_10041744 | 3300031241 | Bacteria | 2403 |
| 176 | Ga0265329_10163620 | 3300031242 | Unclassified | 724 |
| 177 | Ga0265340_10086291 | 3300031247 | Bacteria | 1472 |
| 178 | Ga0265339_10202333 | 3300031249 | Bacteria | 979 |
| 179 | Ga0265331_10047418 | 3300031250 | Bacteria | 2067 |
| 180 | Ga0265316_10915814 | 3300031344 | Unclassified | 612 |
| 181 | Ga0307408_100227221 | 3300031548 | Bacteria | 1526 |
| 182 | Ga0265313_10056783 | 3300031595 | Bacteria | 1850 |
| 183 | Ga0265313_10097864 | 3300031595 | Bacteria | 1306 |
| 184 | Ga0265314_10088508 | 3300031711 | Bacteria | 2022 |
| 185 | Ga0265314_10103310 | 3300031711 | Bacteria | 1827 |
| 186 | Ga0307416_101851342 | 3300032002 | Bacteria | 707 |
| 187 | Ga0307415_100371170 | 3300032126 | Bacteria | 1212 |
| 188 | Ga0373923_0127621 | 3300035111 | Bacteria | 1141 |
| 189 | Ga0373939_0003428 | 3300035114 | Bacteria | 3718 |
| 190 | Ga0373957_0280083 | 3300035120 | Bacteria | 705 |
| 191 | Ga0373955_0200471 | 3300035172 | Unclassified | 1188 |
| 192 | Ga0373955_0748357 | 3300035172 | Unclassified | 600 |
| 193 | Ga0373937_0245391 | 3300036401 | Unclassified | 1688 |
| 194 | Ga0373937_0462802 | 3300036401 | Bacteria | 1204 |
| 195 | Ga0373925_0393451 | 3300037068 | Unclassified | 1130 |
| 196 | Ga0373925_0681984 | 3300037068 | Bacteria | 847 |
| 197 | Ga0395905_0000314 | 3300037471 | Bacteria | 70335 |
| 198 | Ga0395905_0003221 | 3300037471 | Bacteria | 17559 |
| 199 | Ga0395905_0305954 | 3300037471 | Bacteria | 1478 |
| 200 | Ga0436364_0054996 | 3300037853 | Bacteria | 990 |
| 201 | Ga0436364_0206987 | 3300037853 | Bacteria | 14423 |
| 202 | Ga0436364_0307311 | 3300037853 | Bacteria | 1102 |
| 203 | Ga0436364_0347576 | 3300037853 | Bacteria | 2066 |
| 204 | Ga0436364_0897161 | 3300037853 | Bacteria | 2813 |
| 205 | Ga0436365_0069647 | 3300039437 | Bacteria | 2521 |
| 206 | Ga0436365_0798167 | 3300039437 | Bacteria | 89850 |
| 207 | Ga0436365_1171056 | 3300039437 | Bacteria | 3413 |
| 208 | Ga0436365_1747629 | 3300039437 | Unclassified | 586 |
| 209 | Ga0436360_0884335 | 3300039438 | Bacteria | 1135 |
| 210 | Ga0436360_1107637 | 3300039438 | Bacteria | 955 |
| 211 | Ga0436361_0550608 | 3300039447 | Bacteria | 1320 |
| 212 | Ga0436363_0487079 | 3300039450 | Bacteria | 807 |
| 213 | Ga0436363_1283927 | 3300039450 | Bacteria | 996 |
| 214 | Ga0436362_1180665 | 3300039453 | Bacteria | 764 |
| 215 | Ga0436362_1249986 | 3300039453 | Bacteria | 4528 |
| 216 | Ga0439453_0001435 | 3300041408 | Bacteria | 3060 |
| 217 | Ga0439435_0012866 | 3300042436 | Unclassified | 2037 |
| 218 | Ga0466967_0099940 | 3300045976 | Bacteria | 2650 |
| 219 | Ga0466967_0677558 | 3300045976 | Bacteria | 1021 |
| 220 | Ga0495592_0051533 | 3300046454 | Bacteria | 3057 |
| 221 | Ga0495592_0294635 | 3300046454 | Unclassified | 1056 |
| 222 | Ga0495592_0655273 | 3300046454 | Bacteria | 635 |
| 223 | Ga0495629_0156273 | 3300046459 | Bacteria | 1585 |
| 224 | Ga0495638_0007769 | 3300046460 | Bacteria | 7658 |
| 225 | Ga0495651_0120270 | 3300046462 | Bacteria | 1930 |
| 226 | Ga0495580_0597286 | 3300046472 | Unclassified | 730 |
| 227 | Ga0495662_0563173 | 3300046476 | Bacteria | 558 |
| 228 | Ga0495618_0337544 | 3300046514 | Bacteria | 931 |
| 229 | Ga0495628_0173760 | 3300046516 | Bacteria | 1632 |
| 230 | Ga0495630_0125020 | 3300046517 | Bacteria | 1952 |
| 231 | Ga0495630_0379413 | 3300046517 | Unclassified | 1083 |
| 232 | Ga0495630_0959908 | 3300046517 | Bacteria | 650 |
| 233 | Ga0495643_0472576 | 3300046522 | Bacteria | 543 |
| 234 | Ga0495652_0484592 | 3300046529 | Unclassified | 860 |
| 235 | Ga0495640_0110141 | 3300046533 | Unclassified | 1800 |
| 236 | Ga0495587_0344670 | 3300046536 | Bacteria | 831 |
| 237 | Ga0495587_0678635 | 3300046536 | Bacteria | 565 |
| 238 | Ga0495634_0446266 | 3300046642 | Bacteria | 764 |
| 239 | Ga0495635_0384912 | 3300046663 | Bacteria | 933 |
| 240 | Ga0495635_0596350 | 3300046663 | Unclassified | 721 |
| 241 | Ga0495599_0039964 | 3300046678 | Bacteria | 2947 |
| 242 | Ga0495646_0373861 | 3300046680 | Bacteria | 744 |
| 243 | Ga0495613_0181217 | 3300046689 | Bacteria | 1492 |
| 244 | Ga0495600_0056936 | 3300046809 | Bacteria | 2554 |
| 245 | Ga0495674_0226483 | 3300047319 | Bacteria | 1544 |
| 246 | Ga0495672_0016664 | 3300047320 | Bacteria | 4940 |
| 247 | Ga0495680_0035260 | 3300047322 | Bacteria | 4031 |
| 248 | Ga0495680_0047600 | 3300047322 | Bacteria | 3372 |
| 249 | Ga0495686_0230207 | 3300047472 | Bacteria | 1050 |
| 250 | Ga0495593_0427041 | 3300047673 | Unclassified | 663 |
| 251 | Ga0495602_0102814 | 3300048088 | Bacteria | 2340 |
| 252 | Ga0496104_0194639 | 3300048907 | Unclassified | 1939 |
| 253 | Ga0496108_0162806 | 3300048911 | Bacteria | 1929 |
| 254 | Ga0496110_0392157 | 3300048913 | Unclassified | 1266 |
| 255 | Ga0496112_0034052 | 3300048915 | Bacteria | 4956 |
| 256 | Ga0496112_0402743 | 3300048915 | Unclassified | 1308 |
| 257 | Ga0496113_0106443 | 3300048916 | Unclassified | 2179 |
| 258 | Ga0496114_0307604 | 3300048917 | Bacteria | 1400 |
| 259 | Ga0496115_0025721 | 3300048918 | Bacteria | 4587 |
| 260 | Ga0496115_0694792 | 3300048918 | Unclassified | 800 |
| 261 | Ga0496120_0462847 | 3300048923 | Bacteria | 550 |
| 262 | Ga0496121_0002742 | 3300048924 | Bacteria | 26192 |
| 263 | Ga0496122_0050785 | 3300048925 | Bacteria | 3159 |
| 264 | Ga0496123_0281486 | 3300048926 | Bacteria | 803 |
| 265 | Ga0496123_0417869 | 3300048926 | Bacteria | 605 |
| 266 | Ga0496124_0547399 | 3300048927 | Unclassified | 765 |
| 267 | Ga0496126_1287427 | 3300048929 | Unclassified | 533 |
| 268 | Ga0495682_0017082 | 3300049460 | Bacteria | 2743 |
| 269 | Ga0495682_0199237 | 3300049460 | Unclassified | 710 |
| 270 | Ga0501031_0039008 | 3300049568 | Bacteria | 3098 |
| 271 | Ga0501031_0614760 | 3300049568 | Bacteria | 699 |
| 272 | Ga0501032_0154179 | 3300049569 | Bacteria | 1509 |
| 273 | Ga0501032_0156064 | 3300049569 | Bacteria | 1499 |
| 274 | Ga0501033_0203214 | 3300049570 | Bacteria | 1414 |
| 275 | Ga0501033_0563248 | 3300049570 | Bacteria | 784 |
| 276 | Ga0501033_1059827 | 3300049570 | Unclassified | 540 |
| 277 | Ga0501034_0004140 | 3300049571 | Bacteria | 16237 |
| 278 | Ga0501034_0071618 | 3300049571 | Bacteria | 3476 |
| 279 | Ga0501034_0121903 | 3300049571 | Bacteria | 2593 |
| 280 | Ga0501034_1301219 | 3300049571 | Bacteria | 604 |
| 281 | Ga0501036_0230931 | 3300049572 | Bacteria | 1553 |
| 282 | Ga0501036_0249849 | 3300049572 | Bacteria | 1486 |
| 283 | Ga0501037_0076748 | 3300049573 | Bacteria | 2425 |
| 284 | Ga0501037_0139042 | 3300049573 | Bacteria | 1738 |
| 285 | Ga0501038_0087372 | 3300049574 | Bacteria | 2618 |
| 286 | Ga0501038_0119468 | 3300049574 | Bacteria | 2175 |
| 287 | Ga0501039_0036547 | 3300049575 | Bacteria | 3791 |
| 288 | Ga0501039_0221757 | 3300049575 | Bacteria | 1486 |
| 289 | Ga0501040_0128488 | 3300049576 | Bacteria | 1781 |
| 290 | Ga0501040_0484537 | 3300049576 | Unclassified | 891 |
| 291 | Ga0501043_0160283 | 3300049579 | Bacteria | 1758 |
| 292 | Ga0501043_0214880 | 3300049579 | Bacteria | 1489 |
| 293 | Ga0501043_0315491 | 3300049579 | Bacteria | 1192 |
| 294 | Ga0501046_0168180 | 3300049580 | Bacteria | 1646 |
| 295 | Ga0501046_0354968 | 3300049580 | Unclassified | 1064 |
| 296 | Ga0501047_0104918 | 3300049581 | Bacteria | 2707 |
| 297 | Ga0501047_0248452 | 3300049581 | Bacteria | 1628 |
| 298 | Ga0501047_0420042 | 3300049581 | Unclassified | 1169 |
| 299 | Ga0501047_0436732 | 3300049581 | Unclassified | 1139 |
| 300 | Ga0501047_0488392 | 3300049581 | Bacteria | 1059 |
| 301 | Ga0501048_0100420 | 3300049582 | Bacteria | 2041 |
| 302 | Ga0501069_0269447 | 3300049585 | Bacteria | 995 |
| 303 | Ga0501070_0000345 | 3300049586 | Bacteria | 42150 |
| 304 | Ga0501070_0059339 | 3300049586 | Bacteria | 3172 |
| 305 | Ga0501070_0254710 | 3300049586 | Bacteria | 1435 |
| 306 | Ga0501070_0260930 | 3300049586 | Unclassified | 1416 |
| 307 | Ga0501070_0283168 | 3300049586 | Bacteria | 1352 |
| 308 | Ga0501070_0312121 | 3300049586 | Unclassified | 1280 |
| 309 | Ga0501071_0043354 | 3300049587 | Unclassified | 3226 |
| 310 | Ga0501072_0018663 | 3300049588 | Bacteria | 5347 |
| 311 | Ga0501072_0022232 | 3300049588 | Bacteria | 4920 |
| 312 | Ga0501073_0020511 | 3300049589 | Bacteria | 4767 |
| 313 | Ga0501073_0119740 | 3300049589 | Bacteria | 1824 |
| 314 | Ga0501074_0019587 | 3300049590 | Bacteria | 4911 |
| 315 | Ga0501074_0121433 | 3300049590 | Bacteria | 1869 |
| 316 | Ga0501074_0858743 | 3300049590 | Bacteria | 639 |
| 317 | Ga0501074_0919722 | 3300049590 | Unclassified | 615 |
| 318 | Ga0501074_1288509 | 3300049590 | Bacteria | 512 |
| 319 | Ga0501075_0786605 | 3300049591 | Bacteria | 724 |
| 320 | Ga0501076_0008033 | 3300049592 | Bacteria | 7709 |
| 321 | Ga0501077_0067619 | 3300049593 | Bacteria | 2265 |
| 322 | Ga0501079_0465515 | 3300049741 | Bacteria | 993 |
| 323 | Ga0501080_0000629 | 3300049742 | Bacteria | 27961 |
| 324 | Ga0501080_0041259 | 3300049742 | Bacteria | 4301 |
| 325 | Ga0501080_0226944 | 3300049742 | Bacteria | 1707 |
| 326 | Ga0501080_0440511 | 3300049742 | Bacteria | 1169 |
| 327 | Ga0501080_0747666 | 3300049742 | Bacteria | 860 |
| 328 | Ga0501080_1128246 | 3300049742 | Unclassified | 676 |
| 329 | Ga0501083_0160828 | 3300049744 | Bacteria | 1469 |
| 330 | Ga0501083_0445591 | 3300049744 | Bacteria | 843 |
| 331 | Ga0501083_0975500 | 3300049744 | Bacteria | 551 |
| 332 | Ga0501035_0003869 | 3300049822 | Bacteria | 14283 |
| 333 | Ga0501035_0111394 | 3300049822 | Bacteria | 2398 |
| 334 | Ga0501035_0314286 | 3300049822 | Bacteria | 1317 |
| 335 | Ga0501035_0815048 | 3300049822 | Bacteria | 745 |
| 336 | Ga0501044_0002940 | 3300049823 | Bacteria | 19377 |
| 337 | Ga0501044_0117445 | 3300049823 | Bacteria | 2664 |
| 338 | Ga0501044_0120588 | 3300049823 | Bacteria | 2624 |
| 339 | Ga0501044_0248991 | 3300049823 | Bacteria | 1718 |
| 340 | Ga0501044_0499872 | 3300049823 | Bacteria | 1117 |
| 341 | Ga0501044_0571230 | 3300049823 | Bacteria | 1026 |
| 342 | Ga0501044_0585285 | 3300049823 | Bacteria | 1010 |
| 343 | Ga0501045_0004796 | 3300049824 | Bacteria | 9341 |
| 344 | nmdc:mga0k408_576970_c1 | 3300050493 | Bacteria | 664 |
| 345 | nmdc:mga04h51_63643_c1 | 3300050495 | Bacteria | 1270 |
| 346 | Ga0495601_0053300 | 3300053077 | Unclassified | 2556 |
| 347 | Ga0495601_0086420 | 3300053077 | Bacteria | 2015 |
| 348 | Ga0495595_0035275 | 3300053084 | Bacteria | 2266 |
| 349 | Ga0495595_0155014 | 3300053084 | Bacteria | 1128 |
| 350 | Ga0495619_0005773 | 3300053085 | Bacteria | 7843 |
| 351 | Ga0495619_0025250 | 3300053085 | Bacteria | 3815 |
| 352 | Ga0495619_0876693 | 3300053085 | Bacteria | 605 |
| 353 | Ga0500644_0002049 | 3300053088 | Bacteria | 5111 |
| 354 | Ga0500651_0002838 | 3300053093 | Bacteria | 9308 |
| 355 | Ga0500566_0363565 | 3300053094 | Unclassified | 659 |
| 356 | Ga0500641_0005104 | 3300053096 | Bacteria | 4652 |
| 357 | Ga0500641_0222914 | 3300053096 | Unclassified | 799 |
| 358 | Ga0500650_0244353 | 3300053098 | Unclassified | 807 |
| 359 | Ga0500594_0076970 | 3300053118 | Unclassified | 991 |
| 360 | Ga0500642_0112546 | 3300053130 | Unclassified | 1271 |
| 361 | Ga0500652_123967 | 3300053131 | Bacteria | 1079 |
| 362 | Ga0500655_004707 | 3300053133 | Bacteria | 2452 |
| 363 | Ga0500573_0469051 | 3300053140 | Bacteria | 577 |
| 364 | Ga0500577_0054908 | 3300053142 | Bacteria | 1511 |
| 365 | Ga0500588_0000214 | 3300053146 | Bacteria | 8142 |
| 366 | Ga0500588_0017720 | 3300053146 | Bacteria | 1865 |
| 367 | Ga0500622_0001637 | 3300053156 | Bacteria | 17530 |
| 368 | Ga0500622_0026973 | 3300053156 | Bacteria | 3030 |
| 369 | Ga0500627_0069316 | 3300053158 | Bacteria | 1560 |
| 370 | Ga0501084_0131816 | 3300054114 | Bacteria | 2104 |
| 371 | Ga0501084_0742592 | 3300054114 | Bacteria | 827 |
| 372 | Ga0501082_0322217 | 3300060353 | Bacteria | 1346 |
| 373 | Ga0530510_0236465 | 3300061734 | Bacteria | 1359 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0547399 | Ga0496124_0547399_126_464 | 111 |
| 2 | 3300005353 | Ga0070669_101043183 | Ga0070669_1010431831 | 117 |
| 3 | 3300006175 | Ga0070712_101498902 | Ga0070712_1014989022 | 122 |
| 4 | 3300009093 | Ga0105240_10699194 | Ga0105240_106991943 | 122 |
| 5 | 3300009174 | Ga0105241_10141012 | Ga0105241_101410122 | 132 |
| 6 | 3300049823 | Ga0501044_0571230 | Ga0501044_0571230_401_808 | 134 |
| 7 | 3300007265 | Ga0099794_10623609 | Ga0099794_106236091 | 135 |
| 8 | 3300013297 | Ga0157378_12402862 | Ga0157378_124028621 | 135 |
| 9 | 3300036401 | Ga0373937_0245391 | Ga0373937_0245391_143_553 | 135 |
| 10 | 3300039450 | Ga0436363_0487079 | Ga0436363_0487079_21_431 | 135 |
| 11 | 3300046517 | Ga0495630_0959908 | Ga0495630_0959908_73_483 | 135 |
| 12 | 3300048918 | Ga0496115_0694792 | Ga0496115_0694792_146_556 | 135 |
| 13 | 3300048925 | Ga0496122_0050785 | Ga0496122_0050785_112_522 | 135 |
| 14 | 3300048926 | Ga0496123_0281486 | Ga0496123_0281486_67_477 | 135 |
| 15 | 3300048926 | Ga0496123_0417869 | Ga0496123_0417869_130_540 | 135 |
| 16 | 3300048929 | Ga0496126_1287427 | Ga0496126_1287427_78_488 | 135 |
| 17 | 3300049586 | Ga0501070_0059339 | Ga0501070_0059339_1926_2336 | 135 |
| 18 | 3300004803 | Ga0058862_11684349 | Ga0058862_116843492 | 136 |
| 19 | 3300005295 | Ga0065707_10647718 | Ga0065707_106477182 | 136 |
| 20 | 3300005329 | Ga0070683_100082955 | Ga0070683_1000829553 | 136 |
| 21 | 3300005331 | Ga0070670_100015275 | Ga0070670_1000152752 | 136 |
| 22 | 3300005335 | Ga0070666_10475718 | Ga0070666_104757181 | 136 |
| 23 | 3300005336 | Ga0070680_100036145 | Ga0070680_1000361454 | 136 |
| 24 | 3300005336 | Ga0070680_100129153 | Ga0070680_1001291532 | 136 |
| 25 | 3300005339 | Ga0070660_100037769 | Ga0070660_1000377693 | 136 |
| 26 | 3300005344 | Ga0070661_100089357 | Ga0070661_1000893572 | 136 |
| 27 | 3300005354 | Ga0070675_101347528 | Ga0070675_1013475282 | 136 |
| 28 | 3300005355 | Ga0070671_100015403 | Ga0070671_1000154032 | 136 |
| 29 | 3300005355 | Ga0070671_100466460 | Ga0070671_1004664601 | 136 |
| 30 | 3300005364 | Ga0070673_100044752 | Ga0070673_1000447522 | 136 |
| 31 | 3300005365 | Ga0070688_100050216 | Ga0070688_1000502164 | 136 |
| 32 | 3300005435 | Ga0070714_100113458 | Ga0070714_1001134582 | 136 |
| 33 | 3300005457 | Ga0070662_100247874 | Ga0070662_1002478741 | 136 |
| 34 | 3300005458 | Ga0070681_10058506 | Ga0070681_100585064 | 136 |
| 35 | 3300005458 | Ga0070681_10253939 | Ga0070681_102539392 | 136 |
| 36 | 3300005458 | Ga0070681_10871566 | Ga0070681_108715662 | 136 |
| 37 | 3300005530 | Ga0070679_100024929 | Ga0070679_1000249294 | 136 |
| 38 | 3300005535 | Ga0070684_100004374 | Ga0070684_10000437415 | 136 |
| 39 | 3300005536 | Ga0070697_100121118 | Ga0070697_1001211182 | 136 |
| 40 | 3300005539 | Ga0068853_100002720 | Ga0068853_10000272013 | 136 |
| 41 | 3300005539 | Ga0068853_100005433 | Ga0068853_1000054338 | 136 |
| 42 | 3300005545 | Ga0070695_100207843 | Ga0070695_1002078432 | 136 |
| 43 | 3300005548 | Ga0070665_100078222 | Ga0070665_1000782222 | 136 |
| 44 | 3300005563 | Ga0068855_100313086 | Ga0068855_1003130862 | 136 |
| 45 | 3300005577 | Ga0068857_100235216 | Ga0068857_1002352163 | 136 |
| 46 | 3300005614 | Ga0068856_100458787 | Ga0068856_1004587872 | 136 |
| 47 | 3300005614 | Ga0068856_102274294 | Ga0068856_1022742941 | 136 |
| 48 | 3300005616 | Ga0068852_101373198 | Ga0068852_1013731982 | 136 |
| 49 | 3300005834 | Ga0068851_10044736 | Ga0068851_100447362 | 136 |
| 50 | 3300006028 | Ga0070717_10164715 | Ga0070717_101647154 | 136 |
| 51 | 3300006237 | Ga0097621_100127684 | Ga0097621_1001276843 | 136 |
| 52 | 3300006358 | Ga0068871_100102058 | Ga0068871_1001020581 | 136 |
| 53 | 3300006358 | Ga0068871_100650615 | Ga0068871_1006506152 | 136 |
| 54 | 3300007265 | Ga0099794_10050066 | Ga0099794_100500663 | 136 |
| 55 | 3300009093 | Ga0105240_10039238 | Ga0105240_100392386 | 136 |
| 56 | 3300009098 | Ga0105245_10373634 | Ga0105245_103736341 | 136 |
| 57 | 3300009101 | Ga0105247_11766414 | Ga0105247_117664141 | 136 |
| 58 | 3300009176 | Ga0105242_10217027 | Ga0105242_102170273 | 136 |
| 59 | 3300009177 | Ga0105248_10000009 | Ga0105248_10000009396 | 136 |
| 60 | 3300009177 | Ga0105248_10188536 | Ga0105248_101885362 | 136 |
| 61 | 3300009545 | Ga0105237_10102629 | Ga0105237_101026293 | 136 |
| 62 | 3300009545 | Ga0105237_11147100 | Ga0105237_111471002 | 136 |
| 63 | 3300009551 | Ga0105238_10114664 | Ga0105238_101146644 | 136 |
| 64 | 3300010375 | Ga0105239_10092708 | Ga0105239_100927086 | 136 |
| 65 | 3300010375 | Ga0105239_10666742 | Ga0105239_106667422 | 136 |
| 66 | 3300011119 | Ga0105246_10527759 | Ga0105246_105277592 | 136 |
| 67 | 3300013104 | Ga0157370_10200227 | Ga0157370_102002273 | 136 |
| 68 | 3300013105 | Ga0157369_10133905 | Ga0157369_101339053 | 136 |
| 69 | 3300013307 | Ga0157372_11050662 | Ga0157372_110506622 | 136 |
| 70 | 3300014325 | Ga0163163_10073055 | Ga0163163_100730552 | 136 |
| 71 | 3300014968 | Ga0157379_11700175 | Ga0157379_117001751 | 136 |
| 72 | 3300014969 | Ga0157376_10157302 | Ga0157376_101573023 | 136 |
| 73 | 3300020070 | Ga0206356_11282669 | Ga0206356_112826692 | 136 |
| 74 | 3300020082 | Ga0206353_10947098 | Ga0206353_109470982 | 136 |
| 75 | 3300021377 | Ga0213874_10093263 | Ga0213874_100932632 | 136 |
| 76 | 3300021384 | Ga0213876_10000346 | Ga0213876_1000034615 | 136 |
| 77 | 3300024227 | Ga0228598_1001437 | Ga0228598_10014373 | 136 |
| 78 | 3300025321 | Ga0207656_10007821 | Ga0207656_100078212 | 136 |
| 79 | 3300025893 | Ga0207682_10223174 | Ga0207682_102231741 | 136 |
| 80 | 3300025903 | Ga0207680_10335674 | Ga0207680_103356742 | 136 |
| 81 | 3300025912 | Ga0207707_10004473 | Ga0207707_1000447311 | 136 |
| 82 | 3300025912 | Ga0207707_10046465 | Ga0207707_100464653 | 136 |
| 83 | 3300025912 | Ga0207707_10717112 | Ga0207707_107171122 | 136 |
| 84 | 3300025913 | Ga0207695_10093723 | Ga0207695_100937235 | 136 |
| 85 | 3300025917 | Ga0207660_10021022 | Ga0207660_100210223 | 136 |
| 86 | 3300025917 | Ga0207660_10554245 | Ga0207660_105542452 | 136 |
| 87 | 3300025919 | Ga0207657_10004981 | Ga0207657_100049814 | 136 |
| 88 | 3300025920 | Ga0207649_10117046 | Ga0207649_101170463 | 136 |
| 89 | 3300025920 | Ga0207649_11240723 | Ga0207649_112407232 | 136 |
| 90 | 3300025921 | Ga0207652_10042013 | Ga0207652_100420132 | 136 |
| 91 | 3300025921 | Ga0207652_10426411 | Ga0207652_104264111 | 136 |
| 92 | 3300025924 | Ga0207694_10051823 | Ga0207694_100518233 | 136 |
| 93 | 3300025925 | Ga0207650_10159604 | Ga0207650_101596043 | 136 |
| 94 | 3300025926 | Ga0207659_10656465 | Ga0207659_106564652 | 136 |
| 95 | 3300025927 | Ga0207687_10243187 | Ga0207687_102431871 | 136 |
| 96 | 3300025929 | Ga0207664_10891012 | Ga0207664_108910122 | 136 |
| 97 | 3300025931 | Ga0207644_10005879 | Ga0207644_100058799 | 136 |
| 98 | 3300025933 | Ga0207706_10246412 | Ga0207706_102464123 | 136 |
| 99 | 3300025941 | Ga0207711_10000003 | Ga0207711_10000003724 | 136 |
| 100 | 3300025941 | Ga0207711_10000005 | Ga0207711_10000005410 | 136 |
| 101 | 3300025941 | Ga0207711_10000009 | Ga0207711_10000009246 | 136 |
| 102 | 3300025941 | Ga0207711_10000015 | Ga0207711_10000015477 | 136 |
| 103 | 3300025944 | Ga0207661_10175082 | Ga0207661_101750822 | 136 |
| 104 | 3300025949 | Ga0207667_10058126 | Ga0207667_100581263 | 136 |
| 105 | 3300025960 | Ga0207651_10132578 | Ga0207651_101325782 | 136 |
| 106 | 3300026041 | Ga0207639_10002122 | Ga0207639_100021223 | 136 |
| 107 | 3300026041 | Ga0207639_10037304 | Ga0207639_100373043 | 136 |
| 108 | 3300026078 | Ga0207702_10294105 | Ga0207702_102941052 | 136 |
| 109 | 3300026116 | Ga0207674_10225991 | Ga0207674_102259912 | 136 |
| 110 | 3300026142 | Ga0207698_10380598 | Ga0207698_103805982 | 136 |
| 111 | 3300028379 | Ga0268266_10066315 | Ga0268266_100663151 | 136 |
| 112 | 3300028577 | Ga0265318_10000046 | Ga0265318_1000004698 | 136 |
| 113 | 3300031250 | Ga0265331_10047418 | Ga0265331_100474182 | 136 |
| 114 | 3300031548 | Ga0307408_100227221 | Ga0307408_1002272212 | 136 |
| 115 | 3300035111 | Ga0373923_0127621 | Ga0373923_0127621_418_831 | 136 |
| 116 | 3300035114 | Ga0373939_0003428 | Ga0373939_0003428_2628_3041 | 136 |
| 117 | 3300035120 | Ga0373957_0280083 | Ga0373957_0280083_188_601 | 136 |
| 118 | 3300035172 | Ga0373955_0200471 | Ga0373955_0200471_727_1137 | 136 |
| 119 | 3300035172 | Ga0373955_0748357 | Ga0373955_0748357_139_552 | 136 |
| 120 | 3300036401 | Ga0373937_0462802 | Ga0373937_0462802_295_708 | 136 |
| 121 | 3300037068 | Ga0373925_0393451 | Ga0373925_0393451_658_1071 | 136 |
| 122 | 3300037068 | Ga0373925_0681984 | Ga0373925_0681984_265_678 | 136 |
| 123 | 3300037853 | Ga0436364_0054996 | Ga0436364_0054996_426_839 | 136 |
| 124 | 3300037853 | Ga0436364_0347576 | Ga0436364_0347576_210_623 | 136 |
| 125 | 3300037853 | Ga0436364_0897161 | Ga0436364_0897161_298_711 | 136 |
| 126 | 3300039437 | Ga0436365_0798167 | Ga0436365_0798167_26768_27181 | 136 |
| 127 | 3300039437 | Ga0436365_1747629 | Ga0436365_1747629_159_572 | 136 |
| 128 | 3300039450 | Ga0436363_1283927 | Ga0436363_1283927_189_602 | 136 |
| 129 | 3300041408 | Ga0439453_0001435 | Ga0439453_0001435_1170_1583 | 136 |
| 130 | 3300042436 | Ga0439435_0012866 | Ga0439435_0012866_1058_1471 | 136 |
| 131 | 3300045976 | Ga0466967_0677558 | Ga0466967_0677558_292_705 | 136 |
| 132 | 3300046454 | Ga0495592_0051533 | Ga0495592_0051533_1724_2137 | 136 |
| 133 | 3300046454 | Ga0495592_0294635 | Ga0495592_0294635_223_633 | 136 |
| 134 | 3300046454 | Ga0495592_0655273 | Ga0495592_0655273_107_520 | 136 |
| 135 | 3300046459 | Ga0495629_0156273 | Ga0495629_0156273_986_1399 | 136 |
| 136 | 3300046462 | Ga0495651_0120270 | Ga0495651_0120270_923_1336 | 136 |
| 137 | 3300046472 | Ga0495580_0597286 | Ga0495580_0597286_36_449 | 136 |
| 138 | 3300046476 | Ga0495662_0563173 | Ga0495662_0563173_133_546 | 136 |
| 139 | 3300046514 | Ga0495618_0337544 | Ga0495618_0337544_97_510 | 136 |
| 140 | 3300046516 | Ga0495628_0173760 | Ga0495628_0173760_431_844 | 136 |
| 141 | 3300046517 | Ga0495630_0125020 | Ga0495630_0125020_17_430 | 136 |
| 142 | 3300046517 | Ga0495630_0379413 | Ga0495630_0379413_463_873 | 136 |
| 143 | 3300046529 | Ga0495652_0484592 | Ga0495652_0484592_348_761 | 136 |
| 144 | 3300046533 | Ga0495640_0110141 | Ga0495640_0110141_27_437 | 136 |
| 145 | 3300046536 | Ga0495587_0344670 | Ga0495587_0344670_54_467 | 136 |
| 146 | 3300046536 | Ga0495587_0678635 | Ga0495587_0678635_83_496 | 136 |
| 147 | 3300046642 | Ga0495634_0446266 | Ga0495634_0446266_195_608 | 136 |
| 148 | 3300046663 | Ga0495635_0384912 | Ga0495635_0384912_71_484 | 136 |
| 149 | 3300046663 | Ga0495635_0596350 | Ga0495635_0596350_77_490 | 136 |
| 150 | 3300046678 | Ga0495599_0039964 | Ga0495599_0039964_797_1210 | 136 |
| 151 | 3300046680 | Ga0495646_0373861 | Ga0495646_0373861_97_510 | 136 |
| 152 | 3300046689 | Ga0495613_0181217 | Ga0495613_0181217_360_773 | 136 |
| 153 | 3300046809 | Ga0495600_0056936 | Ga0495600_0056936_943_1353 | 136 |
| 154 | 3300047319 | Ga0495674_0226483 | Ga0495674_0226483_415_828 | 136 |
| 155 | 3300047320 | Ga0495672_0016664 | Ga0495672_0016664_202_615 | 136 |
| 156 | 3300047322 | Ga0495680_0035260 | Ga0495680_0035260_3099_3512 | 136 |
| 157 | 3300047322 | Ga0495680_0047600 | Ga0495680_0047600_1819_2229 | 136 |
| 158 | 3300047472 | Ga0495686_0230207 | Ga0495686_0230207_357_770 | 136 |
| 159 | 3300047673 | Ga0495593_0427041 | Ga0495593_0427041_162_575 | 136 |
| 160 | 3300048088 | Ga0495602_0102814 | Ga0495602_0102814_856_1269 | 136 |
| 161 | 3300048907 | Ga0496104_0194639 | Ga0496104_0194639_1018_1431 | 136 |
| 162 | 3300048911 | Ga0496108_0162806 | Ga0496108_0162806_557_970 | 136 |
| 163 | 3300048913 | Ga0496110_0392157 | Ga0496110_0392157_32_445 | 136 |
| 164 | 3300048915 | Ga0496112_0034052 | Ga0496112_0034052_308_721 | 136 |
| 165 | 3300048916 | Ga0496113_0106443 | Ga0496113_0106443_1248_1661 | 136 |
| 166 | 3300048917 | Ga0496114_0307604 | Ga0496114_0307604_166_579 | 136 |
| 167 | 3300048918 | Ga0496115_0025721 | Ga0496115_0025721_3870_4283 | 136 |
| 168 | 3300048924 | Ga0496121_0002742 | Ga0496121_0002742_14210_14623 | 136 |
| 169 | 3300049460 | Ga0495682_0017082 | Ga0495682_0017082_39_452 | 136 |
| 170 | 3300049460 | Ga0495682_0199237 | Ga0495682_0199237_234_647 | 136 |
| 171 | 3300049568 | Ga0501031_0039008 | Ga0501031_0039008_604_1017 | 136 |
| 172 | 3300049568 | Ga0501031_0614760 | Ga0501031_0614760_273_686 | 136 |
| 173 | 3300049569 | Ga0501032_0154179 | Ga0501032_0154179_706_1119 | 136 |
| 174 | 3300049570 | Ga0501033_0203214 | Ga0501033_0203214_384_797 | 136 |
| 175 | 3300049570 | Ga0501033_0563248 | Ga0501033_0563248_295_708 | 136 |
| 176 | 3300049571 | Ga0501034_0071618 | Ga0501034_0071618_56_469 | 136 |
| 177 | 3300049571 | Ga0501034_0121903 | Ga0501034_0121903_896_1309 | 136 |
| 178 | 3300049571 | Ga0501034_1301219 | Ga0501034_1301219_68_481 | 136 |
| 179 | 3300049572 | Ga0501036_0249849 | Ga0501036_0249849_664_1077 | 136 |
| 180 | 3300049573 | Ga0501037_0139042 | Ga0501037_0139042_755_1168 | 136 |
| 181 | 3300049574 | Ga0501038_0119468 | Ga0501038_0119468_1292_1705 | 136 |
| 182 | 3300049575 | Ga0501039_0036547 | Ga0501039_0036547_2991_3404 | 136 |
| 183 | 3300049575 | Ga0501039_0221757 | Ga0501039_0221757_410_823 | 136 |
| 184 | 3300049576 | Ga0501040_0128488 | Ga0501040_0128488_761_1174 | 136 |
| 185 | 3300049576 | Ga0501040_0484537 | Ga0501040_0484537_429_842 | 136 |
| 186 | 3300049579 | Ga0501043_0214880 | Ga0501043_0214880_393_806 | 136 |
| 187 | 3300049580 | Ga0501046_0168180 | Ga0501046_0168180_773_1186 | 136 |
| 188 | 3300049580 | Ga0501046_0354968 | Ga0501046_0354968_161_574 | 136 |
| 189 | 3300049581 | Ga0501047_0248452 | Ga0501047_0248452_14_427 | 136 |
| 190 | 3300049581 | Ga0501047_0420042 | Ga0501047_0420042_237_653 | 136 |
| 191 | 3300049581 | Ga0501047_0436732 | Ga0501047_0436732_147_560 | 136 |
| 192 | 3300049581 | Ga0501047_0488392 | Ga0501047_0488392_118_531 | 136 |
| 193 | 3300049582 | Ga0501048_0100420 | Ga0501048_0100420_1007_1420 | 136 |
| 194 | 3300049585 | Ga0501069_0269447 | Ga0501069_0269447_439_852 | 136 |
| 195 | 3300049586 | Ga0501070_0254710 | Ga0501070_0254710_1007_1420 | 136 |
| 196 | 3300049586 | Ga0501070_0260930 | Ga0501070_0260930_938_1351 | 136 |
| 197 | 3300049586 | Ga0501070_0283168 | Ga0501070_0283168_453_866 | 136 |
| 198 | 3300049586 | Ga0501070_0312121 | Ga0501070_0312121_180_593 | 136 |
| 199 | 3300049587 | Ga0501071_0043354 | Ga0501071_0043354_2632_3045 | 136 |
| 200 | 3300049588 | Ga0501072_0018663 | Ga0501072_0018663_94_507 | 136 |
| 201 | 3300049589 | Ga0501073_0020511 | Ga0501073_0020511_4031_4444 | 136 |
| 202 | 3300049589 | Ga0501073_0119740 | Ga0501073_0119740_1081_1494 | 136 |
| 203 | 3300049590 | Ga0501074_0019587 | Ga0501074_0019587_582_995 | 136 |
| 204 | 3300049590 | Ga0501074_0919722 | Ga0501074_0919722_174_587 | 136 |
| 205 | 3300049590 | Ga0501074_1288509 | Ga0501074_1288509_18_431 | 136 |
| 206 | 3300049591 | Ga0501075_0786605 | Ga0501075_0786605_261_674 | 136 |
| 207 | 3300049592 | Ga0501076_0008033 | Ga0501076_0008033_6974_7387 | 136 |
| 208 | 3300049593 | Ga0501077_0067619 | Ga0501077_0067619_1002_1415 | 136 |
| 209 | 3300049741 | Ga0501079_0465515 | Ga0501079_0465515_217_630 | 136 |
| 210 | 3300049742 | Ga0501080_0041259 | Ga0501080_0041259_1861_2274 | 136 |
| 211 | 3300049742 | Ga0501080_0226944 | Ga0501080_0226944_360_773 | 136 |
| 212 | 3300049742 | Ga0501080_0440511 | Ga0501080_0440511_699_1112 | 136 |
| 213 | 3300049744 | Ga0501083_0445591 | Ga0501083_0445591_130_543 | 136 |
| 214 | 3300049744 | Ga0501083_0975500 | Ga0501083_0975500_38_451 | 136 |
| 215 | 3300049822 | Ga0501035_0111394 | Ga0501035_0111394_1543_1956 | 136 |
| 216 | 3300049822 | Ga0501035_0314286 | Ga0501035_0314286_170_583 | 136 |
| 217 | 3300049822 | Ga0501035_0815048 | Ga0501035_0815048_37_450 | 136 |
| 218 | 3300049823 | Ga0501044_0117445 | Ga0501044_0117445_1519_1932 | 136 |
| 219 | 3300049823 | Ga0501044_0120588 | Ga0501044_0120588_1728_2141 | 136 |
| 220 | 3300049823 | Ga0501044_0248991 | Ga0501044_0248991_425_838 | 136 |
| 221 | 3300049823 | Ga0501044_0499872 | Ga0501044_0499872_232_645 | 136 |
| 222 | 3300049823 | Ga0501044_0585285 | Ga0501044_0585285_207_620 | 136 |
| 223 | 3300049824 | Ga0501045_0004796 | Ga0501045_0004796_2996_3409 | 136 |
| 224 | 3300050495 | nmdc:mga04h51_63643_c1 | nmdc:mga04h51_63643_c1_212_625 | 136 |
| 225 | 3300053077 | Ga0495601_0053300 | Ga0495601_0053300_622_1032 | 136 |
| 226 | 3300053077 | Ga0495601_0086420 | Ga0495601_0086420_942_1355 | 136 |
| 227 | 3300053084 | Ga0495595_0035275 | Ga0495595_0035275_1419_1829 | 136 |
| 228 | 3300053084 | Ga0495595_0155014 | Ga0495595_0155014_450_863 | 136 |
| 229 | 3300053085 | Ga0495619_0005773 | Ga0495619_0005773_6041_6451 | 136 |
| 230 | 3300053085 | Ga0495619_0025250 | Ga0495619_0025250_2382_2795 | 136 |
| 231 | 3300053085 | Ga0495619_0876693 | Ga0495619_0876693_23_436 | 136 |
| 232 | 3300053093 | Ga0500651_0002838 | Ga0500651_0002838_3826_4239 | 136 |
| 233 | 3300053094 | Ga0500566_0363565 | Ga0500566_0363565_136_549 | 136 |
| 234 | 3300053096 | Ga0500641_0005104 | Ga0500641_0005104_3171_3584 | 136 |
| 235 | 3300053096 | Ga0500641_0222914 | Ga0500641_0222914_152_565 | 136 |
| 236 | 3300053098 | Ga0500650_0244353 | Ga0500650_0244353_222_635 | 136 |
| 237 | 3300053118 | Ga0500594_0076970 | Ga0500594_0076970_159_572 | 136 |
| 238 | 3300053130 | Ga0500642_0112546 | Ga0500642_0112546_330_743 | 136 |
| 239 | 3300053133 | Ga0500655_004707 | Ga0500655_004707_986_1399 | 136 |
| 240 | 3300053146 | Ga0500588_0017720 | Ga0500588_0017720_1429_1842 | 136 |
| 241 | 3300053156 | Ga0500622_0026973 | Ga0500622_0026973_1090_1503 | 136 |
| 242 | 3300054114 | Ga0501084_0131816 | Ga0501084_0131816_1644_2057 | 136 |
| 243 | 3300060353 | Ga0501082_0322217 | Ga0501082_0322217_177_590 | 136 |
| 244 | 3300061734 | Ga0530510_0236465 | Ga0530510_0236465_614_1027 | 136 |
| 245 | 3300005336 | Ga0070680_100183802 | Ga0070680_1001838023 | 137 |
| 246 | 3300005344 | Ga0070661_100001149 | Ga0070661_10000114916 | 137 |
| 247 | 3300005435 | Ga0070714_100037201 | Ga0070714_1000372014 | 137 |
| 248 | 3300005458 | Ga0070681_10280427 | Ga0070681_102804271 | 137 |
| 249 | 3300005530 | Ga0070679_100371523 | Ga0070679_1003715231 | 137 |
| 250 | 3300005530 | Ga0070679_100415295 | Ga0070679_1004152952 | 137 |
| 251 | 3300005577 | Ga0068857_101432821 | Ga0068857_1014328212 | 137 |
| 252 | 3300005614 | Ga0068856_102135306 | Ga0068856_1021353061 | 137 |
| 253 | 3300009093 | Ga0105240_10001227 | Ga0105240_1000122724 | 137 |
| 254 | 3300009176 | Ga0105242_10202748 | Ga0105242_102027484 | 137 |
| 255 | 3300009545 | Ga0105237_10005387 | Ga0105237_100053873 | 137 |
| 256 | 3300025913 | Ga0207695_10008451 | Ga0207695_100084518 | 137 |
| 257 | 3300025914 | Ga0207671_10146157 | Ga0207671_101461573 | 137 |
| 258 | 3300025920 | Ga0207649_10010898 | Ga0207649_100108984 | 137 |
| 259 | 3300025929 | Ga0207664_10030963 | Ga0207664_100309634 | 137 |
| 260 | 3300025934 | Ga0207686_10057396 | Ga0207686_100573964 | 137 |
| 261 | 3300025944 | Ga0207661_11875326 | Ga0207661_118753261 | 137 |
| 262 | 3300026116 | Ga0207674_11745655 | Ga0207674_117456551 | 137 |
| 263 | 3300028556 | Ga0265337_1003275 | Ga0265337_10032756 | 137 |
| 264 | 3300028573 | Ga0265334_10002710 | Ga0265334_100027104 | 137 |
| 265 | 3300028800 | Ga0265338_10014216 | Ga0265338_100142169 | 137 |
| 266 | 3300031235 | Ga0265330_10060550 | Ga0265330_100605502 | 137 |
| 267 | 3300031235 | Ga0265330_10066786 | Ga0265330_100667863 | 137 |
| 268 | 3300031235 | Ga0265330_10109102 | Ga0265330_101091022 | 137 |
| 269 | 3300031241 | Ga0265325_10041744 | Ga0265325_100417443 | 137 |
| 270 | 3300031242 | Ga0265329_10163620 | Ga0265329_101636202 | 137 |
| 271 | 3300031247 | Ga0265340_10086291 | Ga0265340_100862913 | 137 |
| 272 | 3300031249 | Ga0265339_10202333 | Ga0265339_102023332 | 137 |
| 273 | 3300031344 | Ga0265316_10915814 | Ga0265316_109158141 | 137 |
| 274 | 3300031595 | Ga0265313_10056783 | Ga0265313_100567834 | 137 |
| 275 | 3300031595 | Ga0265313_10097864 | Ga0265313_100978641 | 137 |
| 276 | 3300031711 | Ga0265314_10088508 | Ga0265314_100885083 | 137 |
| 277 | 3300031711 | Ga0265314_10103310 | Ga0265314_101033103 | 137 |
| 278 | 3300039438 | Ga0436360_0884335 | Ga0436360_0884335_272_688 | 137 |
| 279 | 3300039447 | Ga0436361_0550608 | Ga0436361_0550608_757_1173 | 137 |
| 280 | 3300039453 | Ga0436362_1180665 | Ga0436362_1180665_39_482 | 137 |
| 281 | 3300039453 | Ga0436362_1249986 | Ga0436362_1249986_945_1361 | 137 |
| 282 | 3300048923 | Ga0496120_0462847 | Ga0496120_0462847_111_527 | 137 |
| 283 | 3300049569 | Ga0501032_0156064 | Ga0501032_0156064_869_1285 | 137 |
| 284 | 3300049571 | Ga0501034_0004140 | Ga0501034_0004140_7957_8373 | 137 |
| 285 | 3300049572 | Ga0501036_0230931 | Ga0501036_0230931_713_1129 | 137 |
| 286 | 3300049573 | Ga0501037_0076748 | Ga0501037_0076748_1115_1531 | 137 |
| 287 | 3300049574 | Ga0501038_0087372 | Ga0501038_0087372_973_1389 | 137 |
| 288 | 3300049579 | Ga0501043_0160283 | Ga0501043_0160283_373_789 | 137 |
| 289 | 3300049581 | Ga0501047_0104918 | Ga0501047_0104918_1263_1679 | 137 |
| 290 | 3300049586 | Ga0501070_0000345 | Ga0501070_0000345_18687_19103 | 137 |
| 291 | 3300049588 | Ga0501072_0022232 | Ga0501072_0022232_425_841 | 137 |
| 292 | 3300049590 | Ga0501074_0121433 | Ga0501074_0121433_1250_1666 | 137 |
| 293 | 3300049590 | Ga0501074_0858743 | Ga0501074_0858743_159_575 | 137 |
| 294 | 3300049742 | Ga0501080_0000629 | Ga0501080_0000629_9245_9661 | 137 |
| 295 | 3300049744 | Ga0501083_0160828 | Ga0501083_0160828_757_1173 | 137 |
| 296 | 3300049822 | Ga0501035_0003869 | Ga0501035_0003869_211_627 | 137 |
| 297 | 3300049823 | Ga0501044_0002940 | Ga0501044_0002940_18751_19167 | 137 |
| 298 | 3300054114 | Ga0501084_0742592 | Ga0501084_0742592_169_585 | 137 |
| 299 | 3300005937 | Ga0081455_10003187 | Ga0081455_1000318714 | 138 |
| 300 | 3300049570 | Ga0501033_1059827 | Ga0501033_1059827_10_429 | 138 |
| 301 | 3300005356 | Ga0070674_101398914 | Ga0070674_1013989141 | 139 |
| 302 | 3300006178 | Ga0075367_10745082 | Ga0075367_107450822 | 139 |
| 303 | 3300006195 | Ga0075366_10198394 | Ga0075366_101983942 | 139 |
| 304 | 3300025937 | Ga0207669_11136084 | Ga0207669_111360842 | 139 |
| 305 | 3300049742 | Ga0501080_1128246 | Ga0501080_1128246_92_514 | 139 |
| 306 | 3300050493 | nmdc:mga0k408_576970_c1 | nmdc:mga0k408_576970_c1_186_608 | 139 |
| 307 | 3300053131 | Ga0500652_123967 | Ga0500652_123967_43_465 | 139 |
| 308 | 3300053140 | Ga0500573_0469051 | Ga0500573_0469051_39_461 | 139 |
| 309 | 3300005434 | Ga0070709_10061935 | Ga0070709_100619353 | 140 |
| 310 | 3300005435 | Ga0070714_100489610 | Ga0070714_1004896101 | 140 |
| 311 | 3300006028 | Ga0070717_10089185 | Ga0070717_100891853 | 140 |
| 312 | 3300006163 | Ga0070715_10017572 | Ga0070715_100175723 | 140 |
| 313 | 3300006173 | Ga0070716_100356896 | Ga0070716_1003568963 | 140 |
| 314 | 3300006175 | Ga0070712_101214396 | Ga0070712_1012143961 | 140 |
| 315 | 3300021384 | Ga0213876_10101090 | Ga0213876_101010902 | 140 |
| 316 | 3300021384 | Ga0213876_10491415 | Ga0213876_104914152 | 140 |
| 317 | 3300021388 | Ga0213875_10000025 | Ga0213875_1000002528 | 140 |
| 318 | 3300025905 | Ga0207685_10063951 | Ga0207685_100639513 | 140 |
| 319 | 3300025906 | Ga0207699_10187728 | Ga0207699_101877283 | 140 |
| 320 | 3300025916 | Ga0207663_10561086 | Ga0207663_105610863 | 140 |
| 321 | 3300025929 | Ga0207664_10261187 | Ga0207664_102611873 | 140 |
| 322 | 3300025939 | Ga0207665_10061144 | Ga0207665_100611443 | 140 |
| 323 | 3300037853 | Ga0436364_0206987 | Ga0436364_0206987_2916_3341 | 140 |
| 324 | 3300039437 | Ga0436365_0069647 | Ga0436365_0069647_1056_1481 | 140 |
| 325 | 3300039437 | Ga0436365_1171056 | Ga0436365_1171056_286_711 | 140 |
| 326 | 3300039438 | Ga0436360_1107637 | Ga0436360_1107637_363_788 | 140 |
| 327 | 3300005471 | Ga0070698_100002647 | Ga0070698_1000026473 | 141 |
| 328 | 3300005530 | Ga0070679_100532802 | Ga0070679_1005328023 | 141 |
| 329 | 3300006028 | Ga0070717_10114118 | Ga0070717_101141182 | 141 |
| 330 | 3300025910 | Ga0207684_10196867 | Ga0207684_101968672 | 141 |
| 331 | 3300025922 | Ga0207646_10400570 | Ga0207646_104005701 | 141 |
| 332 | 3300003320 | rootH2_10128887 | rootH2_101288873 | 142 |
| 333 | 3300005458 | Ga0070681_10208389 | Ga0070681_102083892 | 142 |
| 334 | 3300005616 | Ga0068852_100153849 | Ga0068852_1001538493 | 142 |
| 335 | 3300009174 | Ga0105241_10570307 | Ga0105241_105703073 | 142 |
| 336 | 3300013105 | Ga0157369_12027359 | Ga0157369_120273592 | 142 |
| 337 | 3300025912 | Ga0207707_10238352 | Ga0207707_102383523 | 142 |
| 338 | 3300025917 | Ga0207660_11394553 | Ga0207660_113945532 | 142 |
| 339 | 3300026142 | Ga0207698_10011635 | Ga0207698_100116355 | 142 |
| 340 | 3300032002 | Ga0307416_101851342 | Ga0307416_1018513421 | 142 |
| 341 | 3300032126 | Ga0307415_100371170 | Ga0307415_1003711703 | 142 |
| 342 | 3300037853 | Ga0436364_0307311 | Ga0436364_0307311_240_680 | 142 |
| 343 | 3300045976 | Ga0466967_0099940 | Ga0466967_0099940_490_921 | 142 |
| 344 | 3300046460 | Ga0495638_0007769 | Ga0495638_0007769_3911_4342 | 142 |
| 345 | 3300046522 | Ga0495643_0472576 | Ga0495643_0472576_83_511 | 142 |
| 346 | 3300049579 | Ga0501043_0315491 | Ga0501043_0315491_461_904 | 142 |
| 347 | 3300053088 | Ga0500644_0002049 | Ga0500644_0002049_2749_3180 | 142 |
| 348 | 3300053142 | Ga0500577_0054908 | Ga0500577_0054908_865_1296 | 142 |
| 349 | 3300053156 | Ga0500622_0001637 | Ga0500622_0001637_7977_8408 | 142 |
| 350 | 3300037471 | Ga0395905_0000314 | Ga0395905_0000314_32496_32930 | 143 |
| 351 | 3300037471 | Ga0395905_0003221 | Ga0395905_0003221_14893_15327 | 143 |
| 352 | 3300037471 | Ga0395905_0305954 | Ga0395905_0305954_1007_1441 | 143 |
| 353 | 3300049742 | Ga0501080_0747666 | Ga0501080_0747666_318_752 | 143 |
| 354 | 3300053158 | Ga0500627_0069316 | Ga0500627_0069316_415_849 | 143 |
| 355 | 3300005445 | Ga0070708_100803315 | Ga0070708_1008033152 | 144 |
| 356 | 3300005518 | Ga0070699_100432953 | Ga0070699_1004329532 | 144 |
| 357 | 3300005564 | Ga0070664_100871817 | Ga0070664_1008718172 | 144 |
| 358 | 3300005614 | Ga0068856_101069163 | Ga0068856_1010691631 | 144 |
| 359 | 3300014325 | Ga0163163_10495516 | Ga0163163_104955162 | 144 |
| 360 | 3300014497 | Ga0182008_10055425 | Ga0182008_100554253 | 144 |
| 361 | 3300015262 | Ga0182007_10331304 | Ga0182007_103313041 | 144 |
| 362 | 3300048915 | Ga0496112_0402743 | Ga0496112_0402743_718_1155 | 144 |
| 363 | 3300053146 | Ga0500588_0000214 | Ga0500588_0000214_839_1276 | 144 |
| 364 | 3300003203 | JGI25406J46586_10016401 | JGI25406J46586_100164013 | 146 |
| 365 | 3300005436 | Ga0070713_101508561 | Ga0070713_1015085612 | 146 |
| 366 | 3300005437 | Ga0070710_10570532 | Ga0070710_105705322 | 146 |
| 367 | 3300005467 | Ga0070706_100235289 | Ga0070706_1002352893 | 146 |
| 368 | 3300005468 | Ga0070707_100093801 | Ga0070707_1000938011 | 146 |
| 369 | 3300005985 | Ga0081539_10000240 | Ga0081539_1000024031 | 146 |
| 370 | 3300006175 | Ga0070712_100093298 | Ga0070712_1000932982 | 146 |
| 371 | 3300025898 | Ga0207692_11193404 | Ga0207692_111934041 | 146 |
| 372 | 3300025915 | Ga0207693_10101134 | Ga0207693_101011342 | 146 |
| 373 | 3300025916 | Ga0207663_10492202 | Ga0207663_104922021 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6sd6-assembly1.cif.gz_C | structure of vapbc from shigella sonnei | 0.7438 | 10 | 145 |
| 5ed0-assembly2.cif.gz_B | structure of the shigella flexneri vapc mutant d7n | 0.7334 | 10 | 145 |
| 5ecw-assembly1.cif.gz_A | structure of the shigella flexneri vapc mutant d7a | 0.73 | 10 | 145 |
| 7by2-assembly1.cif.gz_B-2 | toxin-antitoxin complex from klebsiella pneumoniae | 0.7176 | 10 | 144 |
| 3zvk-assembly1.cif.gz_D | crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter | 0.7166 | 9 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71623_4_126_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8802 | 11 | 134 | 3.40.50.1010 |
| af_P71623_4_126_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8273 | 11 | 134 | 3.40.50.1010 |
| 3zvkB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.716 | 9 | 146 | 3.40.50.1010 |
| 5ecwB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.7145 | 10 | 145 | 3.40.50.1010 |
| 2lcqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.7086 | 9 | 146 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U7GBE2-F1-model_v4 | PIN domain-containing protein | 0.981 | 82 | 146 |
|
| AF-A0A4R3PSV9-F1-model_v4 | PIN domain-containing protein | 0.9731 | 88 | 146 |
|
| AF-T1BGJ9-F1-model_v4 | PilT domain-containing protein | 0.9709 | 80 | 146 |
|
| AF-A0A354UX23-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9688 | 6 | 146 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A0C5XBX6-F1-model_v4 | PIN domain-containing protein | 0.9658 | 11 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar