F426265

General Info

Members Datasets Scaffolds Average Seq Length
373 232 373 138

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101508561|Ga0070713_1015085612
Length 147
Sequence VSEGRLPRAVLLDTCAVIWLANGDPLAGSAAAAIVGAGLADGVFVSPVSAWEVGLLSKPKAGRTTAVRFMPDPKTWFARVMAGPAIKEAPLTSEIAIDASFLPGDLHGDPGDRLIVTTARHLGIPIVTRDRRIIACASEGHVDVIAC

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
221 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 0
Rhizoplane 2.41
Rhizosphere 85.52
Stem 0
Stem Tuber 0
Unclassified 6.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016401 3300003203 Bacteria 3089
2 rootH2_10128887 3300003320 Bacteria 3009
3 Ga0058862_11684349 3300004803 Bacteria 902
4 Ga0065707_10647718 3300005295 Bacteria 665
5 Ga0070683_100082955 3300005329 Bacteria 3002
6 Ga0070670_100015275 3300005331 Bacteria 6591
7 Ga0070666_10475718 3300005335 Unclassified 904
8 Ga0070680_100036145 3300005336 Bacteria 3990
9 Ga0070680_100129153 3300005336 Bacteria 2113
10 Ga0070680_100183802 3300005336 Unclassified 1761
11 Ga0070660_100037769 3300005339 Bacteria 3661
12 Ga0070661_100001149 3300005344 Bacteria 18629
13 Ga0070661_100089357 3300005344 Bacteria 2281
14 Ga0070669_101043183 3300005353 Bacteria 703
15 Ga0070675_101347528 3300005354 Unclassified 658
16 Ga0070671_100015403 3300005355 Bacteria 6177
17 Ga0070671_100466460 3300005355 Unclassified 1084
18 Ga0070674_101398914 3300005356 Unclassified 626
19 Ga0070673_100044752 3300005364 Bacteria 3429
20 Ga0070688_100050216 3300005365 Bacteria 2598
21 Ga0070709_10061935 3300005434 Bacteria 2384
22 Ga0070714_100037201 3300005435 Bacteria 4088
23 Ga0070714_100113458 3300005435 Unclassified 2403
24 Ga0070714_100489610 3300005435 Bacteria 1172
25 Ga0070713_101508561 3300005436 Unclassified 652
26 Ga0070710_10570532 3300005437 Bacteria 784
27 Ga0070708_100803315 3300005445 Unclassified 884
28 Ga0070662_100247874 3300005457 Unclassified 1431
29 Ga0070681_10058506 3300005458 Bacteria 3834
30 Ga0070681_10208389 3300005458 Bacteria 1871
31 Ga0070681_10253939 3300005458 Bacteria 1670
32 Ga0070681_10280427 3300005458 Unclassified 1577
33 Ga0070681_10871566 3300005458 Bacteria 818
34 Ga0070706_100235289 3300005467 Unclassified 1710
35 Ga0070707_100093801 3300005468 Archaea 2906
36 Ga0070698_100002647 3300005471 Bacteria 19740
37 Ga0070699_100432953 3300005518 Bacteria 1192
38 Ga0070679_100024929 3300005530 Bacteria 5864
39 Ga0070679_100371523 3300005530 Unclassified 1377
40 Ga0070679_100415295 3300005530 Unclassified 1291
41 Ga0070679_100532802 3300005530 Bacteria 1118
42 Ga0070684_100004374 3300005535 Bacteria 10739
43 Ga0070697_100121118 3300005536 Bacteria 2188
44 Ga0068853_100002720 3300005539 Bacteria 13352
45 Ga0068853_100005433 3300005539 Bacteria 9987
46 Ga0070695_100207843 3300005545 Bacteria 1403
47 Ga0070665_100078222 3300005548 Bacteria 3314
48 Ga0068855_100313086 3300005563 Bacteria 1736
49 Ga0070664_100871817 3300005564 Unclassified 843
50 Ga0068857_100235216 3300005577 Bacteria 1676
51 Ga0068857_101432821 3300005577 Unclassified 672
52 Ga0068856_100458787 3300005614 Bacteria 1295
53 Ga0068856_101069163 3300005614 Unclassified 825
54 Ga0068856_102135306 3300005614 Unclassified 569
55 Ga0068856_102274294 3300005614 Unclassified 550
56 Ga0068852_100153849 3300005616 Bacteria 2141
57 Ga0068852_101373198 3300005616 Bacteria 728
58 Ga0068851_10044736 3300005834 Bacteria 2236
59 Ga0081455_10003187 3300005937 Bacteria 19036
60 Ga0081539_10000240 3300005985 Bacteria 128629
61 Ga0070717_10089185 3300006028 Bacteria 2601
62 Ga0070717_10114118 3300006028 Unclassified 2307
63 Ga0070717_10164715 3300006028 Bacteria 1925
64 Ga0070715_10017572 3300006163 Bacteria 2710
65 Ga0070716_100356896 3300006173 Bacteria 1037
66 Ga0070712_100093298 3300006175 Bacteria 2209
67 Ga0070712_101214396 3300006175 Bacteria 656
68 Ga0070712_101498902 3300006175 Unclassified 589
69 Ga0075367_10745082 3300006178 Unclassified 623
70 Ga0075366_10198394 3300006195 Bacteria 1220
71 Ga0097621_100127684 3300006237 Bacteria 2161
72 Ga0068871_100102058 3300006358 Bacteria 2404
73 Ga0068871_100650615 3300006358 Unclassified 962
74 Ga0099794_10050066 3300007265 Bacteria 2009
75 Ga0099794_10623609 3300007265 Bacteria 572
76 Ga0105240_10001227 3300009093 Bacteria 44588
77 Ga0105240_10039238 3300009093 Bacteria 6066
78 Ga0105240_10699194 3300009093 Bacteria 1107
79 Ga0105245_10373634 3300009098 Unclassified 1418
80 Ga0105247_11766414 3300009101 Unclassified 513
81 Ga0105241_10141012 3300009174 Unclassified 1962
82 Ga0105241_10570307 3300009174 Bacteria 1019
83 Ga0105242_10202748 3300009176 Bacteria 1763
84 Ga0105242_10217027 3300009176 Unclassified 1707
85 Ga0105248_10000009 3300009177 Bacteria 403549
86 Ga0105248_10188536 3300009177 Unclassified 2323
87 Ga0105237_10005387 3300009545 Bacteria 14457
88 Ga0105237_10102629 3300009545 Bacteria 2852
89 Ga0105237_11147100 3300009545 Unclassified 784
90 Ga0105238_10114664 3300009551 Bacteria 2674
91 Ga0105239_10092708 3300010375 Bacteria 3334
92 Ga0105239_10666742 3300010375 Bacteria 1188
93 Ga0105246_10527759 3300011119 Bacteria 1007
94 Ga0157370_10200227 3300013104 Bacteria 1852
95 Ga0157369_10133905 3300013105 Bacteria 2625
96 Ga0157369_12027359 3300013105 Unclassified 584
97 Ga0157378_12402862 3300013297 Bacteria 579
98 Ga0157372_11050662 3300013307 Bacteria 943
99 Ga0163163_10073055 3300014325 Bacteria 3420
100 Ga0163163_10495516 3300014325 Unclassified 1283
101 Ga0182008_10055425 3300014497 Bacteria 1960
102 Ga0157379_11700175 3300014968 Bacteria 618
103 Ga0157376_10157302 3300014969 Bacteria 2056
104 Ga0182007_10331304 3300015262 Unclassified 567
105 Ga0206356_11282669 3300020070 Bacteria 1699
106 Ga0206353_10947098 3300020082 Bacteria 1096
107 Ga0213874_10093263 3300021377 Bacteria 992
108 Ga0213876_10000346 3300021384 Bacteria 40175
109 Ga0213876_10101090 3300021384 Bacteria 1529
110 Ga0213876_10491415 3300021384 Unclassified 653
111 Ga0213875_10000025 3300021388 Bacteria 197787
112 Ga0228598_1001437 3300024227 Bacteria 5242
113 Ga0207656_10007821 3300025321 Bacteria 3914
114 Ga0207682_10223174 3300025893 Unclassified 872
115 Ga0207692_11193404 3300025898 Unclassified 505
116 Ga0207680_10335674 3300025903 Unclassified 1059
117 Ga0207685_10063951 3300025905 Bacteria 1468
118 Ga0207699_10187728 3300025906 Bacteria 1393
119 Ga0207684_10196867 3300025910 Unclassified 1738
120 Ga0207707_10004473 3300025912 Bacteria 12303
121 Ga0207707_10046465 3300025912 Bacteria 3782
122 Ga0207707_10238352 3300025912 Bacteria 1582
123 Ga0207707_10717112 3300025912 Bacteria 839
124 Ga0207695_10008451 3300025913 Bacteria 12893
125 Ga0207695_10093723 3300025913 Bacteria 3012
126 Ga0207671_10146157 3300025914 Unclassified 1824
127 Ga0207693_10101134 3300025915 Bacteria 2260
128 Ga0207663_10492202 3300025916 Unclassified 951
129 Ga0207663_10561086 3300025916 Bacteria 893
130 Ga0207660_10021022 3300025917 Bacteria 4385
131 Ga0207660_10554245 3300025917 Bacteria 935
132 Ga0207660_11394553 3300025917 Unclassified 568
133 Ga0207657_10004981 3300025919 Bacteria 13971
134 Ga0207649_10010898 3300025920 Bacteria 4998
135 Ga0207649_10117046 3300025920 Bacteria 1791
136 Ga0207649_11240723 3300025920 Unclassified 589
137 Ga0207652_10042013 3300025921 Bacteria 3889
138 Ga0207652_10426411 3300025921 Bacteria 1196
139 Ga0207646_10400570 3300025922 Unclassified 1239
140 Ga0207694_10051823 3300025924 Bacteria 3180
141 Ga0207650_10159604 3300025925 Bacteria 1786
142 Ga0207659_10656465 3300025926 Unclassified 897
143 Ga0207687_10243187 3300025927 Unclassified 1427
144 Ga0207664_10030963 3300025929 Bacteria 4090
145 Ga0207664_10261187 3300025929 Bacteria 1514
146 Ga0207664_10891012 3300025929 Unclassified 799
147 Ga0207644_10005879 3300025931 Bacteria 8001
148 Ga0207706_10246412 3300025933 Unclassified 1561
149 Ga0207686_10057396 3300025934 Bacteria 2451
150 Ga0207669_11136084 3300025937 Unclassified 660
151 Ga0207665_10061144 3300025939 Bacteria 2552
152 Ga0207711_10000003 3300025941 Bacteria 1042791
153 Ga0207711_10000005 3300025941 Bacteria 822972
154 Ga0207711_10000009 3300025941 Bacteria 580864
155 Ga0207711_10000015 3300025941 Bacteria 494097
156 Ga0207661_10175082 3300025944 Bacteria 1870
157 Ga0207661_11875326 3300025944 Unclassified 545
158 Ga0207667_10058126 3300025949 Bacteria 4058
159 Ga0207651_10132578 3300025960 Bacteria 1910
160 Ga0207639_10002122 3300026041 Bacteria 13359
161 Ga0207639_10037304 3300026041 Bacteria 3609
162 Ga0207702_10294105 3300026078 Bacteria 1539
163 Ga0207674_10225991 3300026116 Bacteria 1820
164 Ga0207674_11745655 3300026116 Unclassified 590
165 Ga0207698_10011635 3300026142 Bacteria 5716
166 Ga0207698_10380598 3300026142 Bacteria 1342
167 Ga0268266_10066315 3300028379 Bacteria 3122
168 Ga0265337_1003275 3300028556 Bacteria 7076
169 Ga0265334_10002710 3300028573 Bacteria 8183
170 Ga0265318_10000046 3300028577 Bacteria 126568
171 Ga0265338_10014216 3300028800 Bacteria 8886
172 Ga0265330_10060550 3300031235 Bacteria 1647
173 Ga0265330_10066786 3300031235 Bacteria 1559
174 Ga0265330_10109102 3300031235 Bacteria 1183
175 Ga0265325_10041744 3300031241 Bacteria 2403
176 Ga0265329_10163620 3300031242 Unclassified 724
177 Ga0265340_10086291 3300031247 Bacteria 1472
178 Ga0265339_10202333 3300031249 Bacteria 979
179 Ga0265331_10047418 3300031250 Bacteria 2067
180 Ga0265316_10915814 3300031344 Unclassified 612
181 Ga0307408_100227221 3300031548 Bacteria 1526
182 Ga0265313_10056783 3300031595 Bacteria 1850
183 Ga0265313_10097864 3300031595 Bacteria 1306
184 Ga0265314_10088508 3300031711 Bacteria 2022
185 Ga0265314_10103310 3300031711 Bacteria 1827
186 Ga0307416_101851342 3300032002 Bacteria 707
187 Ga0307415_100371170 3300032126 Bacteria 1212
188 Ga0373923_0127621 3300035111 Bacteria 1141
189 Ga0373939_0003428 3300035114 Bacteria 3718
190 Ga0373957_0280083 3300035120 Bacteria 705
191 Ga0373955_0200471 3300035172 Unclassified 1188
192 Ga0373955_0748357 3300035172 Unclassified 600
193 Ga0373937_0245391 3300036401 Unclassified 1688
194 Ga0373937_0462802 3300036401 Bacteria 1204
195 Ga0373925_0393451 3300037068 Unclassified 1130
196 Ga0373925_0681984 3300037068 Bacteria 847
197 Ga0395905_0000314 3300037471 Bacteria 70335
198 Ga0395905_0003221 3300037471 Bacteria 17559
199 Ga0395905_0305954 3300037471 Bacteria 1478
200 Ga0436364_0054996 3300037853 Bacteria 990
201 Ga0436364_0206987 3300037853 Bacteria 14423
202 Ga0436364_0307311 3300037853 Bacteria 1102
203 Ga0436364_0347576 3300037853 Bacteria 2066
204 Ga0436364_0897161 3300037853 Bacteria 2813
205 Ga0436365_0069647 3300039437 Bacteria 2521
206 Ga0436365_0798167 3300039437 Bacteria 89850
207 Ga0436365_1171056 3300039437 Bacteria 3413
208 Ga0436365_1747629 3300039437 Unclassified 586
209 Ga0436360_0884335 3300039438 Bacteria 1135
210 Ga0436360_1107637 3300039438 Bacteria 955
211 Ga0436361_0550608 3300039447 Bacteria 1320
212 Ga0436363_0487079 3300039450 Bacteria 807
213 Ga0436363_1283927 3300039450 Bacteria 996
214 Ga0436362_1180665 3300039453 Bacteria 764
215 Ga0436362_1249986 3300039453 Bacteria 4528
216 Ga0439453_0001435 3300041408 Bacteria 3060
217 Ga0439435_0012866 3300042436 Unclassified 2037
218 Ga0466967_0099940 3300045976 Bacteria 2650
219 Ga0466967_0677558 3300045976 Bacteria 1021
220 Ga0495592_0051533 3300046454 Bacteria 3057
221 Ga0495592_0294635 3300046454 Unclassified 1056
222 Ga0495592_0655273 3300046454 Bacteria 635
223 Ga0495629_0156273 3300046459 Bacteria 1585
224 Ga0495638_0007769 3300046460 Bacteria 7658
225 Ga0495651_0120270 3300046462 Bacteria 1930
226 Ga0495580_0597286 3300046472 Unclassified 730
227 Ga0495662_0563173 3300046476 Bacteria 558
228 Ga0495618_0337544 3300046514 Bacteria 931
229 Ga0495628_0173760 3300046516 Bacteria 1632
230 Ga0495630_0125020 3300046517 Bacteria 1952
231 Ga0495630_0379413 3300046517 Unclassified 1083
232 Ga0495630_0959908 3300046517 Bacteria 650
233 Ga0495643_0472576 3300046522 Bacteria 543
234 Ga0495652_0484592 3300046529 Unclassified 860
235 Ga0495640_0110141 3300046533 Unclassified 1800
236 Ga0495587_0344670 3300046536 Bacteria 831
237 Ga0495587_0678635 3300046536 Bacteria 565
238 Ga0495634_0446266 3300046642 Bacteria 764
239 Ga0495635_0384912 3300046663 Bacteria 933
240 Ga0495635_0596350 3300046663 Unclassified 721
241 Ga0495599_0039964 3300046678 Bacteria 2947
242 Ga0495646_0373861 3300046680 Bacteria 744
243 Ga0495613_0181217 3300046689 Bacteria 1492
244 Ga0495600_0056936 3300046809 Bacteria 2554
245 Ga0495674_0226483 3300047319 Bacteria 1544
246 Ga0495672_0016664 3300047320 Bacteria 4940
247 Ga0495680_0035260 3300047322 Bacteria 4031
248 Ga0495680_0047600 3300047322 Bacteria 3372
249 Ga0495686_0230207 3300047472 Bacteria 1050
250 Ga0495593_0427041 3300047673 Unclassified 663
251 Ga0495602_0102814 3300048088 Bacteria 2340
252 Ga0496104_0194639 3300048907 Unclassified 1939
253 Ga0496108_0162806 3300048911 Bacteria 1929
254 Ga0496110_0392157 3300048913 Unclassified 1266
255 Ga0496112_0034052 3300048915 Bacteria 4956
256 Ga0496112_0402743 3300048915 Unclassified 1308
257 Ga0496113_0106443 3300048916 Unclassified 2179
258 Ga0496114_0307604 3300048917 Bacteria 1400
259 Ga0496115_0025721 3300048918 Bacteria 4587
260 Ga0496115_0694792 3300048918 Unclassified 800
261 Ga0496120_0462847 3300048923 Bacteria 550
262 Ga0496121_0002742 3300048924 Bacteria 26192
263 Ga0496122_0050785 3300048925 Bacteria 3159
264 Ga0496123_0281486 3300048926 Bacteria 803
265 Ga0496123_0417869 3300048926 Bacteria 605
266 Ga0496124_0547399 3300048927 Unclassified 765
267 Ga0496126_1287427 3300048929 Unclassified 533
268 Ga0495682_0017082 3300049460 Bacteria 2743
269 Ga0495682_0199237 3300049460 Unclassified 710
270 Ga0501031_0039008 3300049568 Bacteria 3098
271 Ga0501031_0614760 3300049568 Bacteria 699
272 Ga0501032_0154179 3300049569 Bacteria 1509
273 Ga0501032_0156064 3300049569 Bacteria 1499
274 Ga0501033_0203214 3300049570 Bacteria 1414
275 Ga0501033_0563248 3300049570 Bacteria 784
276 Ga0501033_1059827 3300049570 Unclassified 540
277 Ga0501034_0004140 3300049571 Bacteria 16237
278 Ga0501034_0071618 3300049571 Bacteria 3476
279 Ga0501034_0121903 3300049571 Bacteria 2593
280 Ga0501034_1301219 3300049571 Bacteria 604
281 Ga0501036_0230931 3300049572 Bacteria 1553
282 Ga0501036_0249849 3300049572 Bacteria 1486
283 Ga0501037_0076748 3300049573 Bacteria 2425
284 Ga0501037_0139042 3300049573 Bacteria 1738
285 Ga0501038_0087372 3300049574 Bacteria 2618
286 Ga0501038_0119468 3300049574 Bacteria 2175
287 Ga0501039_0036547 3300049575 Bacteria 3791
288 Ga0501039_0221757 3300049575 Bacteria 1486
289 Ga0501040_0128488 3300049576 Bacteria 1781
290 Ga0501040_0484537 3300049576 Unclassified 891
291 Ga0501043_0160283 3300049579 Bacteria 1758
292 Ga0501043_0214880 3300049579 Bacteria 1489
293 Ga0501043_0315491 3300049579 Bacteria 1192
294 Ga0501046_0168180 3300049580 Bacteria 1646
295 Ga0501046_0354968 3300049580 Unclassified 1064
296 Ga0501047_0104918 3300049581 Bacteria 2707
297 Ga0501047_0248452 3300049581 Bacteria 1628
298 Ga0501047_0420042 3300049581 Unclassified 1169
299 Ga0501047_0436732 3300049581 Unclassified 1139
300 Ga0501047_0488392 3300049581 Bacteria 1059
301 Ga0501048_0100420 3300049582 Bacteria 2041
302 Ga0501069_0269447 3300049585 Bacteria 995
303 Ga0501070_0000345 3300049586 Bacteria 42150
304 Ga0501070_0059339 3300049586 Bacteria 3172
305 Ga0501070_0254710 3300049586 Bacteria 1435
306 Ga0501070_0260930 3300049586 Unclassified 1416
307 Ga0501070_0283168 3300049586 Bacteria 1352
308 Ga0501070_0312121 3300049586 Unclassified 1280
309 Ga0501071_0043354 3300049587 Unclassified 3226
310 Ga0501072_0018663 3300049588 Bacteria 5347
311 Ga0501072_0022232 3300049588 Bacteria 4920
312 Ga0501073_0020511 3300049589 Bacteria 4767
313 Ga0501073_0119740 3300049589 Bacteria 1824
314 Ga0501074_0019587 3300049590 Bacteria 4911
315 Ga0501074_0121433 3300049590 Bacteria 1869
316 Ga0501074_0858743 3300049590 Bacteria 639
317 Ga0501074_0919722 3300049590 Unclassified 615
318 Ga0501074_1288509 3300049590 Bacteria 512
319 Ga0501075_0786605 3300049591 Bacteria 724
320 Ga0501076_0008033 3300049592 Bacteria 7709
321 Ga0501077_0067619 3300049593 Bacteria 2265
322 Ga0501079_0465515 3300049741 Bacteria 993
323 Ga0501080_0000629 3300049742 Bacteria 27961
324 Ga0501080_0041259 3300049742 Bacteria 4301
325 Ga0501080_0226944 3300049742 Bacteria 1707
326 Ga0501080_0440511 3300049742 Bacteria 1169
327 Ga0501080_0747666 3300049742 Bacteria 860
328 Ga0501080_1128246 3300049742 Unclassified 676
329 Ga0501083_0160828 3300049744 Bacteria 1469
330 Ga0501083_0445591 3300049744 Bacteria 843
331 Ga0501083_0975500 3300049744 Bacteria 551
332 Ga0501035_0003869 3300049822 Bacteria 14283
333 Ga0501035_0111394 3300049822 Bacteria 2398
334 Ga0501035_0314286 3300049822 Bacteria 1317
335 Ga0501035_0815048 3300049822 Bacteria 745
336 Ga0501044_0002940 3300049823 Bacteria 19377
337 Ga0501044_0117445 3300049823 Bacteria 2664
338 Ga0501044_0120588 3300049823 Bacteria 2624
339 Ga0501044_0248991 3300049823 Bacteria 1718
340 Ga0501044_0499872 3300049823 Bacteria 1117
341 Ga0501044_0571230 3300049823 Bacteria 1026
342 Ga0501044_0585285 3300049823 Bacteria 1010
343 Ga0501045_0004796 3300049824 Bacteria 9341
344 nmdc:mga0k408_576970_c1 3300050493 Bacteria 664
345 nmdc:mga04h51_63643_c1 3300050495 Bacteria 1270
346 Ga0495601_0053300 3300053077 Unclassified 2556
347 Ga0495601_0086420 3300053077 Bacteria 2015
348 Ga0495595_0035275 3300053084 Bacteria 2266
349 Ga0495595_0155014 3300053084 Bacteria 1128
350 Ga0495619_0005773 3300053085 Bacteria 7843
351 Ga0495619_0025250 3300053085 Bacteria 3815
352 Ga0495619_0876693 3300053085 Bacteria 605
353 Ga0500644_0002049 3300053088 Bacteria 5111
354 Ga0500651_0002838 3300053093 Bacteria 9308
355 Ga0500566_0363565 3300053094 Unclassified 659
356 Ga0500641_0005104 3300053096 Bacteria 4652
357 Ga0500641_0222914 3300053096 Unclassified 799
358 Ga0500650_0244353 3300053098 Unclassified 807
359 Ga0500594_0076970 3300053118 Unclassified 991
360 Ga0500642_0112546 3300053130 Unclassified 1271
361 Ga0500652_123967 3300053131 Bacteria 1079
362 Ga0500655_004707 3300053133 Bacteria 2452
363 Ga0500573_0469051 3300053140 Bacteria 577
364 Ga0500577_0054908 3300053142 Bacteria 1511
365 Ga0500588_0000214 3300053146 Bacteria 8142
366 Ga0500588_0017720 3300053146 Bacteria 1865
367 Ga0500622_0001637 3300053156 Bacteria 17530
368 Ga0500622_0026973 3300053156 Bacteria 3030
369 Ga0500627_0069316 3300053158 Bacteria 1560
370 Ga0501084_0131816 3300054114 Bacteria 2104
371 Ga0501084_0742592 3300054114 Bacteria 827
372 Ga0501082_0322217 3300060353 Bacteria 1346
373 Ga0530510_0236465 3300061734 Bacteria 1359

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0547399 Ga0496124_0547399_126_464 111
2 3300005353 Ga0070669_101043183 Ga0070669_1010431831 117
3 3300006175 Ga0070712_101498902 Ga0070712_1014989022 122
4 3300009093 Ga0105240_10699194 Ga0105240_106991943 122
5 3300009174 Ga0105241_10141012 Ga0105241_101410122 132
6 3300049823 Ga0501044_0571230 Ga0501044_0571230_401_808 134
7 3300007265 Ga0099794_10623609 Ga0099794_106236091 135
8 3300013297 Ga0157378_12402862 Ga0157378_124028621 135
9 3300036401 Ga0373937_0245391 Ga0373937_0245391_143_553 135
10 3300039450 Ga0436363_0487079 Ga0436363_0487079_21_431 135
11 3300046517 Ga0495630_0959908 Ga0495630_0959908_73_483 135
12 3300048918 Ga0496115_0694792 Ga0496115_0694792_146_556 135
13 3300048925 Ga0496122_0050785 Ga0496122_0050785_112_522 135
14 3300048926 Ga0496123_0281486 Ga0496123_0281486_67_477 135
15 3300048926 Ga0496123_0417869 Ga0496123_0417869_130_540 135
16 3300048929 Ga0496126_1287427 Ga0496126_1287427_78_488 135
17 3300049586 Ga0501070_0059339 Ga0501070_0059339_1926_2336 135
18 3300004803 Ga0058862_11684349 Ga0058862_116843492 136
19 3300005295 Ga0065707_10647718 Ga0065707_106477182 136
20 3300005329 Ga0070683_100082955 Ga0070683_1000829553 136
21 3300005331 Ga0070670_100015275 Ga0070670_1000152752 136
22 3300005335 Ga0070666_10475718 Ga0070666_104757181 136
23 3300005336 Ga0070680_100036145 Ga0070680_1000361454 136
24 3300005336 Ga0070680_100129153 Ga0070680_1001291532 136
25 3300005339 Ga0070660_100037769 Ga0070660_1000377693 136
26 3300005344 Ga0070661_100089357 Ga0070661_1000893572 136
27 3300005354 Ga0070675_101347528 Ga0070675_1013475282 136
28 3300005355 Ga0070671_100015403 Ga0070671_1000154032 136
29 3300005355 Ga0070671_100466460 Ga0070671_1004664601 136
30 3300005364 Ga0070673_100044752 Ga0070673_1000447522 136
31 3300005365 Ga0070688_100050216 Ga0070688_1000502164 136
32 3300005435 Ga0070714_100113458 Ga0070714_1001134582 136
33 3300005457 Ga0070662_100247874 Ga0070662_1002478741 136
34 3300005458 Ga0070681_10058506 Ga0070681_100585064 136
35 3300005458 Ga0070681_10253939 Ga0070681_102539392 136
36 3300005458 Ga0070681_10871566 Ga0070681_108715662 136
37 3300005530 Ga0070679_100024929 Ga0070679_1000249294 136
38 3300005535 Ga0070684_100004374 Ga0070684_10000437415 136
39 3300005536 Ga0070697_100121118 Ga0070697_1001211182 136
40 3300005539 Ga0068853_100002720 Ga0068853_10000272013 136
41 3300005539 Ga0068853_100005433 Ga0068853_1000054338 136
42 3300005545 Ga0070695_100207843 Ga0070695_1002078432 136
43 3300005548 Ga0070665_100078222 Ga0070665_1000782222 136
44 3300005563 Ga0068855_100313086 Ga0068855_1003130862 136
45 3300005577 Ga0068857_100235216 Ga0068857_1002352163 136
46 3300005614 Ga0068856_100458787 Ga0068856_1004587872 136
47 3300005614 Ga0068856_102274294 Ga0068856_1022742941 136
48 3300005616 Ga0068852_101373198 Ga0068852_1013731982 136
49 3300005834 Ga0068851_10044736 Ga0068851_100447362 136
50 3300006028 Ga0070717_10164715 Ga0070717_101647154 136
51 3300006237 Ga0097621_100127684 Ga0097621_1001276843 136
52 3300006358 Ga0068871_100102058 Ga0068871_1001020581 136
53 3300006358 Ga0068871_100650615 Ga0068871_1006506152 136
54 3300007265 Ga0099794_10050066 Ga0099794_100500663 136
55 3300009093 Ga0105240_10039238 Ga0105240_100392386 136
56 3300009098 Ga0105245_10373634 Ga0105245_103736341 136
57 3300009101 Ga0105247_11766414 Ga0105247_117664141 136
58 3300009176 Ga0105242_10217027 Ga0105242_102170273 136
59 3300009177 Ga0105248_10000009 Ga0105248_10000009396 136
60 3300009177 Ga0105248_10188536 Ga0105248_101885362 136
61 3300009545 Ga0105237_10102629 Ga0105237_101026293 136
62 3300009545 Ga0105237_11147100 Ga0105237_111471002 136
63 3300009551 Ga0105238_10114664 Ga0105238_101146644 136
64 3300010375 Ga0105239_10092708 Ga0105239_100927086 136
65 3300010375 Ga0105239_10666742 Ga0105239_106667422 136
66 3300011119 Ga0105246_10527759 Ga0105246_105277592 136
67 3300013104 Ga0157370_10200227 Ga0157370_102002273 136
68 3300013105 Ga0157369_10133905 Ga0157369_101339053 136
69 3300013307 Ga0157372_11050662 Ga0157372_110506622 136
70 3300014325 Ga0163163_10073055 Ga0163163_100730552 136
71 3300014968 Ga0157379_11700175 Ga0157379_117001751 136
72 3300014969 Ga0157376_10157302 Ga0157376_101573023 136
73 3300020070 Ga0206356_11282669 Ga0206356_112826692 136
74 3300020082 Ga0206353_10947098 Ga0206353_109470982 136
75 3300021377 Ga0213874_10093263 Ga0213874_100932632 136
76 3300021384 Ga0213876_10000346 Ga0213876_1000034615 136
77 3300024227 Ga0228598_1001437 Ga0228598_10014373 136
78 3300025321 Ga0207656_10007821 Ga0207656_100078212 136
79 3300025893 Ga0207682_10223174 Ga0207682_102231741 136
80 3300025903 Ga0207680_10335674 Ga0207680_103356742 136
81 3300025912 Ga0207707_10004473 Ga0207707_1000447311 136
82 3300025912 Ga0207707_10046465 Ga0207707_100464653 136
83 3300025912 Ga0207707_10717112 Ga0207707_107171122 136
84 3300025913 Ga0207695_10093723 Ga0207695_100937235 136
85 3300025917 Ga0207660_10021022 Ga0207660_100210223 136
86 3300025917 Ga0207660_10554245 Ga0207660_105542452 136
87 3300025919 Ga0207657_10004981 Ga0207657_100049814 136
88 3300025920 Ga0207649_10117046 Ga0207649_101170463 136
89 3300025920 Ga0207649_11240723 Ga0207649_112407232 136
90 3300025921 Ga0207652_10042013 Ga0207652_100420132 136
91 3300025921 Ga0207652_10426411 Ga0207652_104264111 136
92 3300025924 Ga0207694_10051823 Ga0207694_100518233 136
93 3300025925 Ga0207650_10159604 Ga0207650_101596043 136
94 3300025926 Ga0207659_10656465 Ga0207659_106564652 136
95 3300025927 Ga0207687_10243187 Ga0207687_102431871 136
96 3300025929 Ga0207664_10891012 Ga0207664_108910122 136
97 3300025931 Ga0207644_10005879 Ga0207644_100058799 136
98 3300025933 Ga0207706_10246412 Ga0207706_102464123 136
99 3300025941 Ga0207711_10000003 Ga0207711_10000003724 136
100 3300025941 Ga0207711_10000005 Ga0207711_10000005410 136
101 3300025941 Ga0207711_10000009 Ga0207711_10000009246 136
102 3300025941 Ga0207711_10000015 Ga0207711_10000015477 136
103 3300025944 Ga0207661_10175082 Ga0207661_101750822 136
104 3300025949 Ga0207667_10058126 Ga0207667_100581263 136
105 3300025960 Ga0207651_10132578 Ga0207651_101325782 136
106 3300026041 Ga0207639_10002122 Ga0207639_100021223 136
107 3300026041 Ga0207639_10037304 Ga0207639_100373043 136
108 3300026078 Ga0207702_10294105 Ga0207702_102941052 136
109 3300026116 Ga0207674_10225991 Ga0207674_102259912 136
110 3300026142 Ga0207698_10380598 Ga0207698_103805982 136
111 3300028379 Ga0268266_10066315 Ga0268266_100663151 136
112 3300028577 Ga0265318_10000046 Ga0265318_1000004698 136
113 3300031250 Ga0265331_10047418 Ga0265331_100474182 136
114 3300031548 Ga0307408_100227221 Ga0307408_1002272212 136
115 3300035111 Ga0373923_0127621 Ga0373923_0127621_418_831 136
116 3300035114 Ga0373939_0003428 Ga0373939_0003428_2628_3041 136
117 3300035120 Ga0373957_0280083 Ga0373957_0280083_188_601 136
118 3300035172 Ga0373955_0200471 Ga0373955_0200471_727_1137 136
119 3300035172 Ga0373955_0748357 Ga0373955_0748357_139_552 136
120 3300036401 Ga0373937_0462802 Ga0373937_0462802_295_708 136
121 3300037068 Ga0373925_0393451 Ga0373925_0393451_658_1071 136
122 3300037068 Ga0373925_0681984 Ga0373925_0681984_265_678 136
123 3300037853 Ga0436364_0054996 Ga0436364_0054996_426_839 136
124 3300037853 Ga0436364_0347576 Ga0436364_0347576_210_623 136
125 3300037853 Ga0436364_0897161 Ga0436364_0897161_298_711 136
126 3300039437 Ga0436365_0798167 Ga0436365_0798167_26768_27181 136
127 3300039437 Ga0436365_1747629 Ga0436365_1747629_159_572 136
128 3300039450 Ga0436363_1283927 Ga0436363_1283927_189_602 136
129 3300041408 Ga0439453_0001435 Ga0439453_0001435_1170_1583 136
130 3300042436 Ga0439435_0012866 Ga0439435_0012866_1058_1471 136
131 3300045976 Ga0466967_0677558 Ga0466967_0677558_292_705 136
132 3300046454 Ga0495592_0051533 Ga0495592_0051533_1724_2137 136
133 3300046454 Ga0495592_0294635 Ga0495592_0294635_223_633 136
134 3300046454 Ga0495592_0655273 Ga0495592_0655273_107_520 136
135 3300046459 Ga0495629_0156273 Ga0495629_0156273_986_1399 136
136 3300046462 Ga0495651_0120270 Ga0495651_0120270_923_1336 136
137 3300046472 Ga0495580_0597286 Ga0495580_0597286_36_449 136
138 3300046476 Ga0495662_0563173 Ga0495662_0563173_133_546 136
139 3300046514 Ga0495618_0337544 Ga0495618_0337544_97_510 136
140 3300046516 Ga0495628_0173760 Ga0495628_0173760_431_844 136
141 3300046517 Ga0495630_0125020 Ga0495630_0125020_17_430 136
142 3300046517 Ga0495630_0379413 Ga0495630_0379413_463_873 136
143 3300046529 Ga0495652_0484592 Ga0495652_0484592_348_761 136
144 3300046533 Ga0495640_0110141 Ga0495640_0110141_27_437 136
145 3300046536 Ga0495587_0344670 Ga0495587_0344670_54_467 136
146 3300046536 Ga0495587_0678635 Ga0495587_0678635_83_496 136
147 3300046642 Ga0495634_0446266 Ga0495634_0446266_195_608 136
148 3300046663 Ga0495635_0384912 Ga0495635_0384912_71_484 136
149 3300046663 Ga0495635_0596350 Ga0495635_0596350_77_490 136
150 3300046678 Ga0495599_0039964 Ga0495599_0039964_797_1210 136
151 3300046680 Ga0495646_0373861 Ga0495646_0373861_97_510 136
152 3300046689 Ga0495613_0181217 Ga0495613_0181217_360_773 136
153 3300046809 Ga0495600_0056936 Ga0495600_0056936_943_1353 136
154 3300047319 Ga0495674_0226483 Ga0495674_0226483_415_828 136
155 3300047320 Ga0495672_0016664 Ga0495672_0016664_202_615 136
156 3300047322 Ga0495680_0035260 Ga0495680_0035260_3099_3512 136
157 3300047322 Ga0495680_0047600 Ga0495680_0047600_1819_2229 136
158 3300047472 Ga0495686_0230207 Ga0495686_0230207_357_770 136
159 3300047673 Ga0495593_0427041 Ga0495593_0427041_162_575 136
160 3300048088 Ga0495602_0102814 Ga0495602_0102814_856_1269 136
161 3300048907 Ga0496104_0194639 Ga0496104_0194639_1018_1431 136
162 3300048911 Ga0496108_0162806 Ga0496108_0162806_557_970 136
163 3300048913 Ga0496110_0392157 Ga0496110_0392157_32_445 136
164 3300048915 Ga0496112_0034052 Ga0496112_0034052_308_721 136
165 3300048916 Ga0496113_0106443 Ga0496113_0106443_1248_1661 136
166 3300048917 Ga0496114_0307604 Ga0496114_0307604_166_579 136
167 3300048918 Ga0496115_0025721 Ga0496115_0025721_3870_4283 136
168 3300048924 Ga0496121_0002742 Ga0496121_0002742_14210_14623 136
169 3300049460 Ga0495682_0017082 Ga0495682_0017082_39_452 136
170 3300049460 Ga0495682_0199237 Ga0495682_0199237_234_647 136
171 3300049568 Ga0501031_0039008 Ga0501031_0039008_604_1017 136
172 3300049568 Ga0501031_0614760 Ga0501031_0614760_273_686 136
173 3300049569 Ga0501032_0154179 Ga0501032_0154179_706_1119 136
174 3300049570 Ga0501033_0203214 Ga0501033_0203214_384_797 136
175 3300049570 Ga0501033_0563248 Ga0501033_0563248_295_708 136
176 3300049571 Ga0501034_0071618 Ga0501034_0071618_56_469 136
177 3300049571 Ga0501034_0121903 Ga0501034_0121903_896_1309 136
178 3300049571 Ga0501034_1301219 Ga0501034_1301219_68_481 136
179 3300049572 Ga0501036_0249849 Ga0501036_0249849_664_1077 136
180 3300049573 Ga0501037_0139042 Ga0501037_0139042_755_1168 136
181 3300049574 Ga0501038_0119468 Ga0501038_0119468_1292_1705 136
182 3300049575 Ga0501039_0036547 Ga0501039_0036547_2991_3404 136
183 3300049575 Ga0501039_0221757 Ga0501039_0221757_410_823 136
184 3300049576 Ga0501040_0128488 Ga0501040_0128488_761_1174 136
185 3300049576 Ga0501040_0484537 Ga0501040_0484537_429_842 136
186 3300049579 Ga0501043_0214880 Ga0501043_0214880_393_806 136
187 3300049580 Ga0501046_0168180 Ga0501046_0168180_773_1186 136
188 3300049580 Ga0501046_0354968 Ga0501046_0354968_161_574 136
189 3300049581 Ga0501047_0248452 Ga0501047_0248452_14_427 136
190 3300049581 Ga0501047_0420042 Ga0501047_0420042_237_653 136
191 3300049581 Ga0501047_0436732 Ga0501047_0436732_147_560 136
192 3300049581 Ga0501047_0488392 Ga0501047_0488392_118_531 136
193 3300049582 Ga0501048_0100420 Ga0501048_0100420_1007_1420 136
194 3300049585 Ga0501069_0269447 Ga0501069_0269447_439_852 136
195 3300049586 Ga0501070_0254710 Ga0501070_0254710_1007_1420 136
196 3300049586 Ga0501070_0260930 Ga0501070_0260930_938_1351 136
197 3300049586 Ga0501070_0283168 Ga0501070_0283168_453_866 136
198 3300049586 Ga0501070_0312121 Ga0501070_0312121_180_593 136
199 3300049587 Ga0501071_0043354 Ga0501071_0043354_2632_3045 136
200 3300049588 Ga0501072_0018663 Ga0501072_0018663_94_507 136
201 3300049589 Ga0501073_0020511 Ga0501073_0020511_4031_4444 136
202 3300049589 Ga0501073_0119740 Ga0501073_0119740_1081_1494 136
203 3300049590 Ga0501074_0019587 Ga0501074_0019587_582_995 136
204 3300049590 Ga0501074_0919722 Ga0501074_0919722_174_587 136
205 3300049590 Ga0501074_1288509 Ga0501074_1288509_18_431 136
206 3300049591 Ga0501075_0786605 Ga0501075_0786605_261_674 136
207 3300049592 Ga0501076_0008033 Ga0501076_0008033_6974_7387 136
208 3300049593 Ga0501077_0067619 Ga0501077_0067619_1002_1415 136
209 3300049741 Ga0501079_0465515 Ga0501079_0465515_217_630 136
210 3300049742 Ga0501080_0041259 Ga0501080_0041259_1861_2274 136
211 3300049742 Ga0501080_0226944 Ga0501080_0226944_360_773 136
212 3300049742 Ga0501080_0440511 Ga0501080_0440511_699_1112 136
213 3300049744 Ga0501083_0445591 Ga0501083_0445591_130_543 136
214 3300049744 Ga0501083_0975500 Ga0501083_0975500_38_451 136
215 3300049822 Ga0501035_0111394 Ga0501035_0111394_1543_1956 136
216 3300049822 Ga0501035_0314286 Ga0501035_0314286_170_583 136
217 3300049822 Ga0501035_0815048 Ga0501035_0815048_37_450 136
218 3300049823 Ga0501044_0117445 Ga0501044_0117445_1519_1932 136
219 3300049823 Ga0501044_0120588 Ga0501044_0120588_1728_2141 136
220 3300049823 Ga0501044_0248991 Ga0501044_0248991_425_838 136
221 3300049823 Ga0501044_0499872 Ga0501044_0499872_232_645 136
222 3300049823 Ga0501044_0585285 Ga0501044_0585285_207_620 136
223 3300049824 Ga0501045_0004796 Ga0501045_0004796_2996_3409 136
224 3300050495 nmdc:mga04h51_63643_c1 nmdc:mga04h51_63643_c1_212_625 136
225 3300053077 Ga0495601_0053300 Ga0495601_0053300_622_1032 136
226 3300053077 Ga0495601_0086420 Ga0495601_0086420_942_1355 136
227 3300053084 Ga0495595_0035275 Ga0495595_0035275_1419_1829 136
228 3300053084 Ga0495595_0155014 Ga0495595_0155014_450_863 136
229 3300053085 Ga0495619_0005773 Ga0495619_0005773_6041_6451 136
230 3300053085 Ga0495619_0025250 Ga0495619_0025250_2382_2795 136
231 3300053085 Ga0495619_0876693 Ga0495619_0876693_23_436 136
232 3300053093 Ga0500651_0002838 Ga0500651_0002838_3826_4239 136
233 3300053094 Ga0500566_0363565 Ga0500566_0363565_136_549 136
234 3300053096 Ga0500641_0005104 Ga0500641_0005104_3171_3584 136
235 3300053096 Ga0500641_0222914 Ga0500641_0222914_152_565 136
236 3300053098 Ga0500650_0244353 Ga0500650_0244353_222_635 136
237 3300053118 Ga0500594_0076970 Ga0500594_0076970_159_572 136
238 3300053130 Ga0500642_0112546 Ga0500642_0112546_330_743 136
239 3300053133 Ga0500655_004707 Ga0500655_004707_986_1399 136
240 3300053146 Ga0500588_0017720 Ga0500588_0017720_1429_1842 136
241 3300053156 Ga0500622_0026973 Ga0500622_0026973_1090_1503 136
242 3300054114 Ga0501084_0131816 Ga0501084_0131816_1644_2057 136
243 3300060353 Ga0501082_0322217 Ga0501082_0322217_177_590 136
244 3300061734 Ga0530510_0236465 Ga0530510_0236465_614_1027 136
245 3300005336 Ga0070680_100183802 Ga0070680_1001838023 137
246 3300005344 Ga0070661_100001149 Ga0070661_10000114916 137
247 3300005435 Ga0070714_100037201 Ga0070714_1000372014 137
248 3300005458 Ga0070681_10280427 Ga0070681_102804271 137
249 3300005530 Ga0070679_100371523 Ga0070679_1003715231 137
250 3300005530 Ga0070679_100415295 Ga0070679_1004152952 137
251 3300005577 Ga0068857_101432821 Ga0068857_1014328212 137
252 3300005614 Ga0068856_102135306 Ga0068856_1021353061 137
253 3300009093 Ga0105240_10001227 Ga0105240_1000122724 137
254 3300009176 Ga0105242_10202748 Ga0105242_102027484 137
255 3300009545 Ga0105237_10005387 Ga0105237_100053873 137
256 3300025913 Ga0207695_10008451 Ga0207695_100084518 137
257 3300025914 Ga0207671_10146157 Ga0207671_101461573 137
258 3300025920 Ga0207649_10010898 Ga0207649_100108984 137
259 3300025929 Ga0207664_10030963 Ga0207664_100309634 137
260 3300025934 Ga0207686_10057396 Ga0207686_100573964 137
261 3300025944 Ga0207661_11875326 Ga0207661_118753261 137
262 3300026116 Ga0207674_11745655 Ga0207674_117456551 137
263 3300028556 Ga0265337_1003275 Ga0265337_10032756 137
264 3300028573 Ga0265334_10002710 Ga0265334_100027104 137
265 3300028800 Ga0265338_10014216 Ga0265338_100142169 137
266 3300031235 Ga0265330_10060550 Ga0265330_100605502 137
267 3300031235 Ga0265330_10066786 Ga0265330_100667863 137
268 3300031235 Ga0265330_10109102 Ga0265330_101091022 137
269 3300031241 Ga0265325_10041744 Ga0265325_100417443 137
270 3300031242 Ga0265329_10163620 Ga0265329_101636202 137
271 3300031247 Ga0265340_10086291 Ga0265340_100862913 137
272 3300031249 Ga0265339_10202333 Ga0265339_102023332 137
273 3300031344 Ga0265316_10915814 Ga0265316_109158141 137
274 3300031595 Ga0265313_10056783 Ga0265313_100567834 137
275 3300031595 Ga0265313_10097864 Ga0265313_100978641 137
276 3300031711 Ga0265314_10088508 Ga0265314_100885083 137
277 3300031711 Ga0265314_10103310 Ga0265314_101033103 137
278 3300039438 Ga0436360_0884335 Ga0436360_0884335_272_688 137
279 3300039447 Ga0436361_0550608 Ga0436361_0550608_757_1173 137
280 3300039453 Ga0436362_1180665 Ga0436362_1180665_39_482 137
281 3300039453 Ga0436362_1249986 Ga0436362_1249986_945_1361 137
282 3300048923 Ga0496120_0462847 Ga0496120_0462847_111_527 137
283 3300049569 Ga0501032_0156064 Ga0501032_0156064_869_1285 137
284 3300049571 Ga0501034_0004140 Ga0501034_0004140_7957_8373 137
285 3300049572 Ga0501036_0230931 Ga0501036_0230931_713_1129 137
286 3300049573 Ga0501037_0076748 Ga0501037_0076748_1115_1531 137
287 3300049574 Ga0501038_0087372 Ga0501038_0087372_973_1389 137
288 3300049579 Ga0501043_0160283 Ga0501043_0160283_373_789 137
289 3300049581 Ga0501047_0104918 Ga0501047_0104918_1263_1679 137
290 3300049586 Ga0501070_0000345 Ga0501070_0000345_18687_19103 137
291 3300049588 Ga0501072_0022232 Ga0501072_0022232_425_841 137
292 3300049590 Ga0501074_0121433 Ga0501074_0121433_1250_1666 137
293 3300049590 Ga0501074_0858743 Ga0501074_0858743_159_575 137
294 3300049742 Ga0501080_0000629 Ga0501080_0000629_9245_9661 137
295 3300049744 Ga0501083_0160828 Ga0501083_0160828_757_1173 137
296 3300049822 Ga0501035_0003869 Ga0501035_0003869_211_627 137
297 3300049823 Ga0501044_0002940 Ga0501044_0002940_18751_19167 137
298 3300054114 Ga0501084_0742592 Ga0501084_0742592_169_585 137
299 3300005937 Ga0081455_10003187 Ga0081455_1000318714 138
300 3300049570 Ga0501033_1059827 Ga0501033_1059827_10_429 138
301 3300005356 Ga0070674_101398914 Ga0070674_1013989141 139
302 3300006178 Ga0075367_10745082 Ga0075367_107450822 139
303 3300006195 Ga0075366_10198394 Ga0075366_101983942 139
304 3300025937 Ga0207669_11136084 Ga0207669_111360842 139
305 3300049742 Ga0501080_1128246 Ga0501080_1128246_92_514 139
306 3300050493 nmdc:mga0k408_576970_c1 nmdc:mga0k408_576970_c1_186_608 139
307 3300053131 Ga0500652_123967 Ga0500652_123967_43_465 139
308 3300053140 Ga0500573_0469051 Ga0500573_0469051_39_461 139
309 3300005434 Ga0070709_10061935 Ga0070709_100619353 140
310 3300005435 Ga0070714_100489610 Ga0070714_1004896101 140
311 3300006028 Ga0070717_10089185 Ga0070717_100891853 140
312 3300006163 Ga0070715_10017572 Ga0070715_100175723 140
313 3300006173 Ga0070716_100356896 Ga0070716_1003568963 140
314 3300006175 Ga0070712_101214396 Ga0070712_1012143961 140
315 3300021384 Ga0213876_10101090 Ga0213876_101010902 140
316 3300021384 Ga0213876_10491415 Ga0213876_104914152 140
317 3300021388 Ga0213875_10000025 Ga0213875_1000002528 140
318 3300025905 Ga0207685_10063951 Ga0207685_100639513 140
319 3300025906 Ga0207699_10187728 Ga0207699_101877283 140
320 3300025916 Ga0207663_10561086 Ga0207663_105610863 140
321 3300025929 Ga0207664_10261187 Ga0207664_102611873 140
322 3300025939 Ga0207665_10061144 Ga0207665_100611443 140
323 3300037853 Ga0436364_0206987 Ga0436364_0206987_2916_3341 140
324 3300039437 Ga0436365_0069647 Ga0436365_0069647_1056_1481 140
325 3300039437 Ga0436365_1171056 Ga0436365_1171056_286_711 140
326 3300039438 Ga0436360_1107637 Ga0436360_1107637_363_788 140
327 3300005471 Ga0070698_100002647 Ga0070698_1000026473 141
328 3300005530 Ga0070679_100532802 Ga0070679_1005328023 141
329 3300006028 Ga0070717_10114118 Ga0070717_101141182 141
330 3300025910 Ga0207684_10196867 Ga0207684_101968672 141
331 3300025922 Ga0207646_10400570 Ga0207646_104005701 141
332 3300003320 rootH2_10128887 rootH2_101288873 142
333 3300005458 Ga0070681_10208389 Ga0070681_102083892 142
334 3300005616 Ga0068852_100153849 Ga0068852_1001538493 142
335 3300009174 Ga0105241_10570307 Ga0105241_105703073 142
336 3300013105 Ga0157369_12027359 Ga0157369_120273592 142
337 3300025912 Ga0207707_10238352 Ga0207707_102383523 142
338 3300025917 Ga0207660_11394553 Ga0207660_113945532 142
339 3300026142 Ga0207698_10011635 Ga0207698_100116355 142
340 3300032002 Ga0307416_101851342 Ga0307416_1018513421 142
341 3300032126 Ga0307415_100371170 Ga0307415_1003711703 142
342 3300037853 Ga0436364_0307311 Ga0436364_0307311_240_680 142
343 3300045976 Ga0466967_0099940 Ga0466967_0099940_490_921 142
344 3300046460 Ga0495638_0007769 Ga0495638_0007769_3911_4342 142
345 3300046522 Ga0495643_0472576 Ga0495643_0472576_83_511 142
346 3300049579 Ga0501043_0315491 Ga0501043_0315491_461_904 142
347 3300053088 Ga0500644_0002049 Ga0500644_0002049_2749_3180 142
348 3300053142 Ga0500577_0054908 Ga0500577_0054908_865_1296 142
349 3300053156 Ga0500622_0001637 Ga0500622_0001637_7977_8408 142
350 3300037471 Ga0395905_0000314 Ga0395905_0000314_32496_32930 143
351 3300037471 Ga0395905_0003221 Ga0395905_0003221_14893_15327 143
352 3300037471 Ga0395905_0305954 Ga0395905_0305954_1007_1441 143
353 3300049742 Ga0501080_0747666 Ga0501080_0747666_318_752 143
354 3300053158 Ga0500627_0069316 Ga0500627_0069316_415_849 143
355 3300005445 Ga0070708_100803315 Ga0070708_1008033152 144
356 3300005518 Ga0070699_100432953 Ga0070699_1004329532 144
357 3300005564 Ga0070664_100871817 Ga0070664_1008718172 144
358 3300005614 Ga0068856_101069163 Ga0068856_1010691631 144
359 3300014325 Ga0163163_10495516 Ga0163163_104955162 144
360 3300014497 Ga0182008_10055425 Ga0182008_100554253 144
361 3300015262 Ga0182007_10331304 Ga0182007_103313041 144
362 3300048915 Ga0496112_0402743 Ga0496112_0402743_718_1155 144
363 3300053146 Ga0500588_0000214 Ga0500588_0000214_839_1276 144
364 3300003203 JGI25406J46586_10016401 JGI25406J46586_100164013 146
365 3300005436 Ga0070713_101508561 Ga0070713_1015085612 146
366 3300005437 Ga0070710_10570532 Ga0070710_105705322 146
367 3300005467 Ga0070706_100235289 Ga0070706_1002352893 146
368 3300005468 Ga0070707_100093801 Ga0070707_1000938011 146
369 3300005985 Ga0081539_10000240 Ga0081539_1000024031 146
370 3300006175 Ga0070712_100093298 Ga0070712_1000932982 146
371 3300025898 Ga0207692_11193404 Ga0207692_111934041 146
372 3300025915 Ga0207693_10101134 Ga0207693_101011342 146
373 3300025916 Ga0207663_10492202 Ga0207663_104922021 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

10

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.7438 10 145
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.7334 10 145
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.73 10 145
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7176 10 144
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7166 9 145
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8802 11 134 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8273 11 134 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.716 9 146 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7145 10 145 3.40.50.1010
2lcqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7086 9 146 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7U7GBE2-F1-model_v4 PIN domain-containing protein 0.981 82 146
AF-A0A4R3PSV9-F1-model_v4 PIN domain-containing protein 0.9731 88 146
AF-T1BGJ9-F1-model_v4 PilT domain-containing protein 0.9709 80 146
AF-A0A354UX23-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9688 6 146 GO:0000287
GO:0004540
GO:0090729
AF-A0A0C5XBX6-F1-model_v4 PIN domain-containing protein 0.9658 11 146

Feature Viewer

pLDDT pTM Quality
94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map