F426187

General Info

Members Datasets Scaffolds Average Seq Length
372 327 223 334

Family's Representative Sequence

Representative Sequence 3300053105|Ga0500557_000030|Ga0500557_000030_19041_20150
Length 369
Sequence MAIRLLRGVLSGLKWALCAVGGVALILAAMIATPLERPPEMRSVSDSAKGIDWSTLPPLERFQARDGTWIGFRHYAAKAFSSEVEAGSREENASKQESGAPFRSHRNGNGSGPATGRGAIFIHGSSGSSGTVNHALTHAIASRGVETWALDIRGHGGSGTRGDIGYVGQLEDDLVDFVAELRKTAPELPLTLIGHSAGAGFSLRVAATPIMQDMFVRTVLLAPYLGYDAPTNKPHAGGWANVDVPRLFALSALRKLGIDCCSQLPVLALAVPATSAKYLVSTYSDRLTRNFATHGYRTDLPATTRPITIFGGAEDEMMISDKYAEVVQAIKPSVDVKIIDGINHMGIVTNPKAISVIADDVATRGAGQS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
22 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
23 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
24 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
25 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
26 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
27 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
28 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
29 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
30 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
31 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
32 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
33 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
34 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
35 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
36 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
37 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
38 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
39 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
40 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
41 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
42 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
43 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
44 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
45 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
46 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
47 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
48 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
49 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
50 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
51 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
52 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
53 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
54 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
55 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
56 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
57 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
58 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
59 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
60 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
61 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
62 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
63 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
64 2922368715
65 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
66 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
67 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
68 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
69 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
70 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
71 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
72 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
73 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
74 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
75 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
76 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
77 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
78 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
79 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
80 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
81 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
82 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
83 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
84 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
85 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
86 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
87 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
88 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
89 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
90 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
91 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
92 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
93 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
94 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
95 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
96 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
97 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
98 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
99 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
100 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
101 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
102 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
103 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
104 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
105 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
106 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
107 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
108 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
109 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
110 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
111 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
112 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
113 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
114 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
115 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
116 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
117 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
118 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
119 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
120 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
121 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
122 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
123 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
124 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
125 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
126 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
127 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
128 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
129 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
130 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
131 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
132 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
133 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
134 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
135 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
136 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
139 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
140 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
143 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
144 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
147 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
150 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
151 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
154 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
162 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
163 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
164 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
189 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
190 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
191 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
291 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
294 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
297 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
300 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
301 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
302 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
303 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
304 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
305 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
306 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
307 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
308 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
309 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
310 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
311 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
312 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
313 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
314 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
315 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
316 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
317 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
318 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
319 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
320 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
321 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
322 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
323 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
324 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
325 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
326 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
327 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.11
Metatranscriptomes 0
Isolates 39.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.87
Nodule 35.48
Rhizoplane 4.57
Rhizosphere 37.63
Stem 0
Stem Tuber 0
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001623 3300003215 Bacteria 13334
2 rootH1_10192526 3300003323 Bacteria 1898
3 JGI25160J50197_1002758 3300003354 Bacteria 8050
4 Ga0070668_100035799 3300005347 Bacteria 3787
5 Ga0070668_100099661 3300005347 Bacteria 2300
6 Ga0070673_100448028 3300005364 Bacteria 1161
7 Ga0070667_100207448 3300005367 Bacteria 1741
8 Ga0070709_10015719 3300005434 Bacteria 4310
9 Ga0070713_100000953 3300005436 Bacteria 18526
10 Ga0070713_100002544 3300005436 Bacteria 11922
11 Ga0070711_100032960 3300005439 Bacteria 3447
12 Ga0070663_100110969 3300005455 Bacteria 2060
13 Ga0070681_10078189 3300005458 Bacteria 3265
14 Ga0070681_10082109 3300005458 Bacteria 3178
15 Ga0070679_100324834 3300005530 Bacteria 1488
16 Ga0068853_100365443 3300005539 Bacteria 1345
17 Ga0070665_100483180 3300005548 Bacteria 1249
18 Ga0068856_100273332 3300005614 Bacteria 1706
19 Ga0068852_100641570 3300005616 Bacteria 1069
20 Ga0068859_100534844 3300005617 Bacteria 1267
21 Ga0068864_100265284 3300005618 Bacteria 1598
22 Ga0068864_100461795 3300005618 Bacteria 1216
23 Ga0081540_1039073 3300005983 Bacteria 2492
24 Ga0081539_10035406 3300005985 Bacteria 3001
25 Ga0070717_10000254 3300006028 Bacteria 36784
26 Ga0075365_10131062 3300006038 Bacteria 1735
27 Ga0075370_10050931 3300006353 Bacteria 2349
28 Ga0075434_100014230 3300006871 Bacteria 7599
29 Ga0097620_100534873 3300006931 Bacteria 1267
30 Ga0099825_1029146 3300006941 Bacteria 2599
31 Ga0099824_1024933 3300006942 Bacteria 3384
32 Ga0099823_1040966 3300006944 Bacteria 3320
33 Ga0105240_10016306 3300009093 Bacteria 10064
34 Ga0105240_10153372 3300009093 Bacteria 2742
35 Ga0105243_10233940 3300009148 Bacteria 1632
36 Ga0105241_10115949 3300009174 Bacteria 2150
37 Ga0105241_10419373 3300009174 Bacteria 1178
38 Ga0105237_10283482 3300009545 Bacteria 1659
39 Ga0105238_10227618 3300009551 Bacteria 1841
40 Ga0105239_10428697 3300010375 Bacteria 1499
41 Ga0157372_10407214 3300013307 Bacteria 1585
42 Ga0157375_10165506 3300013308 Bacteria 2356
43 Ga0163163_10229325 3300014325 Bacteria 1906
44 Ga0214544_1010585 3300021320 Bacteria 13451
45 Ga0214542_1008517 3300021321 Bacteria 16825
46 Ga0214542_1028635 3300021321 Bacteria 2383
47 Ga0214543_1019010 3300021327 Bacteria 6077
48 Ga0214543_1024354 3300021327 Bacteria 3765
49 Ga0213875_10033988 3300021388 Bacteria 2409
50 Ga0209677_104778 3300025253 Bacteria 3764
51 Ga0209148_1000335 3300025254 Bacteria 63754
52 Ga0209233_1012301 3300025261 Bacteria 2486
53 Ga0209564_1006693 3300025295 Bacteria 6127
54 Ga0209758_1000604 3300025297 Bacteria 55558
55 Ga0209758_1012739 3300025297 Bacteria 4664
56 Ga0209758_1051022 3300025297 Bacteria 1444
57 Ga0209256_1026679 3300025299 Bacteria 1659
58 Ga0207426_1000500 3300025302 Bacteria 58181
59 Ga0209257_1029591 3300025304 Bacteria 1781
60 Ga0207688_10086097 3300025901 Bacteria 1800
61 Ga0207647_10097983 3300025904 Bacteria 1743
62 Ga0207699_10050650 3300025906 Bacteria 2450
63 Ga0207699_10064927 3300025906 Bacteria 2211
64 Ga0207707_10000639 3300025912 Bacteria 34565
65 Ga0207707_10013667 3300025912 Bacteria 7080
66 Ga0207695_10000123 3300025913 Bacteria 232059
67 Ga0207693_10050661 3300025915 Bacteria 3260
68 Ga0207660_10066286 3300025917 Bacteria 2612
69 Ga0207652_10014637 3300025921 Bacteria 6357
70 Ga0207700_10004425 3300025928 Bacteria 8282
71 Ga0207700_10138074 3300025928 Bacteria 2000
72 Ga0207664_10022744 3300025929 Bacteria 4686
73 Ga0207667_10248548 3300025949 Bacteria 1819
74 Ga0207668_10161695 3300025972 Bacteria 1745
75 Ga0207639_10203497 3300026041 Bacteria 1700
76 Ga0207639_10261082 3300026041 Bacteria 1515
77 Ga0207678_10121940 3300026067 Bacteria 2225
78 Ga0207678_10161556 3300026067 Bacteria 1913
79 Ga0207674_10153017 3300026116 Bacteria 2263
80 Ga0209389_1000019 3300027296 Bacteria 172067
81 Ga0209389_1000070 3300027296 Bacteria 97498
82 Ga0209589_1000838 3300027357 Bacteria 46552
83 Ga0209489_100033 3300027361 Bacteria 172166
84 Ga0209489_100196 3300027361 Bacteria 97498
85 Ga0209700_100012 3300027363 Bacteria 357892
86 Ga0268266_10176215 3300028379 Bacteria 1944
87 Ga0307517_10147672 3300028786 Bacteria 1625
88 Ga0265338_10057804 3300028800 Bacteria 3428
89 Ga0265324_10018994 3300029957 Bacteria 2478
90 Ga0265340_10036726 3300031247 Bacteria 2428
91 Ga0265339_10001243 3300031249 Bacteria 19180
92 Ga0265339_10008559 3300031249 Bacteria 6500
93 Ga0265342_10146698 3300031712 Bacteria 1313
94 Ga0307510_10004632 3300033180 Bacteria 16219
95 Ga0307510_10267590 3300033180 Bacteria 1187
96 Ga0373944_0035969 3300035089 Bacteria 1511
97 Ga0373936_0043234 3300035113 Bacteria 1810
98 Ga0373945_0089948 3300035116 Bacteria 1187
99 Ga0373953_0060139 3300035117 Bacteria 1552
100 Ga0373954_0014534 3300035118 Bacteria 3512
101 Ga0373954_0042046 3300035118 Bacteria 2131
102 Ga0373935_0030162 3300035692 Bacteria 3359
103 Ga0373927_0131200 3300035695 Bacteria 1637
104 Ga0373933_0071189 3300035724 Bacteria 2116
105 Ga0373947_0013699 3300035725 Bacteria 4646
106 Ga0373937_0007168 3300036401 Bacteria 9640
107 Ga0395898_0172278 3300037466 Bacteria 2069
108 Ga0395905_0031189 3300037471 Bacteria 5019
109 Ga0436364_1151766 3300037853 Bacteria 7820
110 Ga0436364_1224184 3300037853 Bacteria 3548
111 Ga0436365_1440327 3300039437 Bacteria 2906
112 Ga0466972_0055497 3300044658 Bacteria 1905
113 Ga0466966_0057436 3300044684 Bacteria 2460
114 Ga0466961_0018981 3300044693 Bacteria 4424
115 Ga0466957_0088312 3300044842 Bacteria 1940
116 Ga0466959_0002955 3300045049 Bacteria 10975
117 Ga0466959_0087243 3300045049 Bacteria 2245
118 Ga0466959_0094017 3300045049 Bacteria 2151
119 Ga0466967_0014490 3300045976 Bacteria 6144
120 Ga0495592_0071921 3300046454 Bacteria 2517
121 Ga0495590_0034234 3300046457 Bacteria 1774
122 Ga0495629_0044250 3300046459 Bacteria 3125
123 Ga0495638_0003264 3300046460 Bacteria 12800
124 Ga0495651_0102180 3300046462 Bacteria 2132
125 Ga0495651_0156210 3300046462 Bacteria 1639
126 Ga0495653_0162847 3300046463 Bacteria 1547
127 Ga0495650_0070148 3300046471 Bacteria 1377
128 Ga0495582_0021685 3300046473 Bacteria 3515
129 Ga0495639_0012233 3300046475 Bacteria 3702
130 Ga0495664_0006070 3300046477 Bacteria 6664
131 Ga0495664_0049374 3300046477 Bacteria 2498
132 Ga0495664_0183602 3300046477 Bacteria 1268
133 Ga0495583_0108335 3300046506 Bacteria 1179
134 Ga0495606_0085716 3300046507 Bacteria 1948
135 Ga0495610_0048403 3300046512 Bacteria 2087
136 Ga0495618_0007721 3300046514 Bacteria 6507
137 Ga0495628_0038399 3300046516 Bacteria 3833
138 Ga0495630_0045995 3300046517 Bacteria 3262
139 Ga0495643_0047323 3300046522 Bacteria 2329
140 Ga0495652_0036972 3300046529 Bacteria 4239
141 Ga0495640_0033071 3300046533 Bacteria 3677
142 Ga0495609_0042159 3300046538 Bacteria 2050
143 Ga0495645_0024305 3300046543 Bacteria 4395
144 Ga0495645_0045511 3300046543 Bacteria 3202
145 Ga0495667_0081248 3300046559 Bacteria 2107
146 Ga0495634_0055274 3300046642 Bacteria 2654
147 Ga0495611_0138104 3300046648 Bacteria 1138
148 Ga0495625_0057020 3300046660 Bacteria 2779
149 Ga0495635_0052309 3300046663 Bacteria 2814
150 Ga0495635_0057741 3300046663 Bacteria 2670
151 Ga0495635_0213560 3300046663 Bacteria 1306
152 Ga0495588_0044463 3300046674 Bacteria 2275
153 Ga0495657_0035797 3300046675 Bacteria 3437
154 Ga0495599_0074203 3300046678 Bacteria 2124
155 Ga0495623_0012424 3300046679 Bacteria 5512
156 Ga0495623_0203074 3300046679 Bacteria 1138
157 Ga0495649_0069642 3300046694 Bacteria 1887
158 Ga0495649_0146499 3300046694 Bacteria 1241
159 Ga0495604_0035353 3300047317 Bacteria 3946
160 Ga0495604_0145333 3300047317 Bacteria 1690
161 Ga0495674_0112693 3300047319 Bacteria 2304
162 Ga0495676_0124493 3300047321 Bacteria 1870
163 Ga0495676_0133936 3300047321 Bacteria 1785
164 Ga0495680_0025217 3300047322 Bacteria 4924
165 Ga0495683_0136508 3300047323 Bacteria 1152
166 Ga0495675_0147785 3300047444 Bacteria 1453
167 Ga0495684_0084381 3300047471 Bacteria 2409
168 Ga0495593_0023139 3300047673 Bacteria 3456
169 Ga0495602_0018699 3300048088 Bacteria 6907
170 Ga0496101_0062882 3300048904 Bacteria 2700
171 Ga0496101_0259062 3300048904 Bacteria 1356
172 Ga0496102_0128791 3300048905 Bacteria 2367
173 Ga0496102_0191152 3300048905 Bacteria 1929
174 Ga0496102_0217738 3300048905 Bacteria 1800
175 Ga0496104_0142748 3300048907 Bacteria 2300
176 Ga0496104_0209983 3300048907 Bacteria 1858
177 Ga0496105_0020594 3300048908 Bacteria 5332
178 Ga0496107_0239115 3300048910 Bacteria 1351
179 Ga0496107_0306688 3300048910 Bacteria 1182
180 Ga0496111_0163015 3300048914 Bacteria 1655
181 Ga0496112_0117285 3300048915 Bacteria 2632
182 Ga0496113_0270310 3300048916 Bacteria 1358
183 Ga0496114_0236119 3300048917 Bacteria 1607
184 Ga0496115_0201537 3300048918 Bacteria 1644
185 Ga0496115_0246031 3300048918 Bacteria 1473
186 Ga0496115_0338547 3300048918 Bacteria 1228
187 Ga0496116_0096323 3300048919 Bacteria 1783
188 Ga0496117_0091575 3300048920 Bacteria 1955
189 Ga0496118_0094698 3300048921 Bacteria 2041
190 Ga0496119_0066684 3300048922 Bacteria 2125
191 Ga0496120_0069720 3300048923 Bacteria 1936
192 Ga0496120_0086779 3300048923 Bacteria 1681
193 Ga0496121_0011258 3300048924 Bacteria 9968
194 Ga0496125_0055584 3300048928 Bacteria 3223
195 Ga0496126_0078181 3300048929 Bacteria 2932
196 Ga0496126_0090208 3300048929 Bacteria 2697
197 Ga0496126_0144646 3300048929 Bacteria 2043
198 Ga0496126_0328246 3300048929 Bacteria 1256
199 Ga0501047_0055709 3300049581 Bacteria 3823
200 Ga0501070_0068830 3300049586 Bacteria 2930
201 Ga0501074_0065042 3300049590 Bacteria 2625
202 Ga0501044_0117914 3300049823 Bacteria 2658
203 nmdc:mga0k408_144324_c1 3300050493 Bacteria 1417
204 nmdc:mga07m45_195817_c1 3300050496 Bacteria 1175
205 nmdc:mga07m45_67106_c1 3300050496 Bacteria 2039
206 nmdc:mga0sz30_5194_c1 3300050516 Bacteria 4769
207 Ga0495612_0004736 3300053078 Bacteria 5631
208 Ga0495619_0124679 3300053085 Bacteria 1767
209 Ga0500578_0057352 3300053086 Bacteria 2490
210 Ga0500643_000013 3300053087 Bacteria 324296
211 Ga0500555_019218 3300053103 Bacteria 1968
212 Ga0500557_000030 3300053105 Bacteria 76944
213 Ga0500569_048993 3300053109 Bacteria 1267
214 Ga0500595_056954 3300053119 Bacteria 1192
215 Ga0500607_044196 3300053121 Bacteria 2397
216 Ga0500642_0000299 3300053130 Bacteria 17848
217 Ga0500559_0001936 3300053136 Bacteria 11206
218 Ga0500620_024371 3300053155 Bacteria 1847
219 Ga0500638_083588 3300053162 Bacteria 1513
220 Ga0500636_0000554 3300053177 Bacteria 20357
221 Ga0500625_023982 3300053729 Bacteria 2883
222 Ga0500601_000191 3300053737 Bacteria 12543
223 Ga0500661_007605 3300055283 Bacteria 2001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10407214 Ga0157372_104072142 277
2 3300037853 Ga0436364_1151766 Ga0436364_1151766_969_1832 287
3 iso_pu_bacteria 8016622563 8016630081 292
4 3300046648 Ga0495611_0138104 Ga0495611_0138104_16_906 296
5 3300049586 Ga0501070_0068830 Ga0501070_0068830_971_1993 301
6 3300025928 Ga0207700_10138074 Ga0207700_101380742 302
7 3300035724 Ga0373933_0071189 Ga0373933_0071189_1187_2101 304
8 3300046517 Ga0495630_0045995 Ga0495630_0045995_19_933 304
9 3300005985 Ga0081539_10035406 Ga0081539_100354062 305
10 3300031249 Ga0265339_10008559 Ga0265339_100085595 305
11 3300031712 Ga0265342_10146698 Ga0265342_101466982 305
12 3300025254 Ga0209148_1000335 Ga0209148_10003357 308
13 3300037853 Ga0436364_1224184 Ga0436364_1224184_960_1964 310
14 3300048929 Ga0496126_0328246 Ga0496126_0328246_169_1173 310
15 3300006941 Ga0099825_1029146 Ga0099825_10291463 313
16 3300006944 Ga0099823_1040966 Ga0099823_10409665 313
17 3300027296 Ga0209389_1000019 Ga0209389_1000019161 313
18 3300027361 Ga0209489_100033 Ga0209489_100033160 313
19 3300027363 Ga0209700_100012 Ga0209700_100012208 313
20 3300044684 Ga0466966_0057436 Ga0466966_0057436_272_1258 314
21 3300045049 Ga0466959_0087243 Ga0466959_0087243_911_1897 314
22 3300025261 Ga0209233_1012301 Ga0209233_10123012 316
23 3300050496 nmdc:mga07m45_195817_c1 nmdc:mga07m45_195817_c1_12_986 316
24 3300035117 Ga0373953_0060139 Ga0373953_0060139_37_1035 318
25 3300036401 Ga0373937_0007168 Ga0373937_0007168_5071_6069 318
26 3300046462 Ga0495651_0156210 Ga0495651_0156210_432_1430 318
27 3300046512 Ga0495610_0048403 Ga0495610_0048403_1098_2054 318
28 3300046679 Ga0495623_0203074 Ga0495623_0203074_87_1085 318
29 3300048916 Ga0496113_0270310 Ga0496113_0270310_387_1343 318
30 3300005458 Ga0070681_10082109 Ga0070681_100821092 324
31 3300005530 Ga0070679_100324834 Ga0070679_1003248341 324
32 3300025912 Ga0207707_10000639 Ga0207707_1000063932 324
33 3300025917 Ga0207660_10066286 Ga0207660_100662863 324
34 3300025921 Ga0207652_10014637 Ga0207652_100146373 324
35 3300046694 Ga0495649_0146499 Ga0495649_0146499_14_991 325
36 3300046463 Ga0495653_0162847 Ga0495653_0162847_69_1079 326
37 3300046675 Ga0495657_0035797 Ga0495657_0035797_2410_3420 326
38 3300047319 Ga0495674_0112693 Ga0495674_0112693_287_1297 326
39 3300050516 nmdc:mga0sz30_5194_c1 nmdc:mga0sz30_5194_c1_3692_4702 326
40 3300053121 Ga0500607_044196 Ga0500607_044196_510_1520 326
41 3300053155 Ga0500620_024371 Ga0500620_024371_329_1339 326
42 3300053162 Ga0500638_083588 Ga0500638_083588_457_1467 326
43 3300053177 Ga0500636_0000554 Ga0500636_0000554_9357_10367 326
44 3300009545 Ga0105237_10283482 Ga0105237_102834822 328
45 3300028800 Ga0265338_10057804 Ga0265338_100578045 328
46 3300029957 Ga0265324_10018994 Ga0265324_100189941 328
47 3300005617 Ga0068859_100534844 Ga0068859_1005348442 329
48 3300006931 Ga0097620_100534873 Ga0097620_1005348732 329
49 iso_pu_bacteria 2508501128 2509148081 330
50 iso_pu_bacteria 2941531003 2941538176 330
51 iso_pu_bacteria 3005483717 3005490286 330
52 3300053737 Ga0500601_000191 Ga0500601_000191_4875_5885 331
53 3300055283 Ga0500661_007605 Ga0500661_007605_884_1894 331
54 iso_pu_bacteria 2513237141 2513887843 331
55 iso_pu_bacteria 2929624759 2929629340 331
56 iso_pu_bacteria 2507262055 2507511981 332
57 iso_pu_bacteria 2508501009 2508545638 332
58 iso_pu_bacteria 2508501042 2508694459 332
59 iso_pu_bacteria 2511231028 2511394922 332
60 iso_pu_bacteria 2513237092 2513627486 332
61 iso_pu_bacteria 2513237094 2513643207 332
62 iso_pu_bacteria 2513237095 2513650994 332
63 iso_pu_bacteria 2513237104 2513717683 332
64 iso_pu_bacteria 2513237139 2513874396 332
65 iso_pu_bacteria 2513237161 2514017225 332
66 iso_pu_bacteria 2515154112 2515624610 332
67 iso_pu_bacteria 2517093001 2517104455 332
68 iso_pu_bacteria 2528768022 2528856745 332
69 iso_pu_bacteria 2617270735 2617349732 332
70 iso_pu_bacteria 2744054633 2745078424 332
71 iso_pu_bacteria 2791355196 2793059530 332
72 iso_pu_bacteria 2802429603 2805920990 332
73 iso_pu_bacteria 2816332527 2818242289 332
74 iso_pu_bacteria 2824661429 2824671062 332
75 iso_pu_bacteria 2824671348 2824678817 332
76 iso_pu_bacteria 2824679649 2824686957 332
77 iso_pu_bacteria 2824687955 2824695284 332
78 iso_pu_bacteria 2824696289 2824703636 332
79 iso_pu_bacteria 2824704595 2824713594 332
80 iso_pu_bacteria 2824732956 2824738248 332
81 iso_pu_bacteria 2824753945 2824762167 332
82 iso_pu_bacteria 2824763712 2824770997 332
83 iso_pu_bacteria 2824773399 2824776892 332
84 iso_pu_bacteria 2838122688 2838128493 332
85 iso_pu_bacteria 2841941048 2841942351 332
86 iso_pu_bacteria 2841949485 2841955520 332
87 iso_pu_bacteria 2841957949 2841960856 332
88 iso_pu_bacteria 2841966195 2841971126 332
89 iso_pu_bacteria 2841974524 2841982245 332
90 iso_pu_bacteria 2841983080 2841984367 332
91 iso_pu_bacteria 2842038055 2842041907 332
92 iso_pu_bacteria 2842045827 2842049950 332
93 iso_pu_bacteria 2844315083 2844321199 332
94 iso_pu_bacteria 2847930680 2847932208 332
95 iso_pu_bacteria 2847939898 2847943440 332
96 iso_pu_bacteria 2874590934 2874595850 332
97 iso_pu_bacteria 2874612657 2874614874 332
98 iso_pu_bacteria 2874628541 2874630457 332
99 iso_pu_bacteria 2874645413 2874651518 332
100 iso_pu_bacteria 2876761206 2876767526 332
101 iso_pu_bacteria 2876771140 2876776047 332
102 iso_pu_bacteria 2876818435 2876821255 332
103 iso_pu_bacteria 2879074833 2879080136 332
104 iso_pu_bacteria 2879083081 2879089386 332
105 iso_pu_bacteria 2879099564 2879106385 332
106 iso_pu_bacteria 2879127579 2879132633 332
107 iso_pu_bacteria 2879142872 2879150762 332
108 iso_pu_bacteria 2881665667 2881669189 332
109 iso_pu_bacteria 2885366525 2885373967 332
110 iso_pu_bacteria 2888378607 2888387485 332
111 iso_pu_bacteria 2888388044 2888391701 332
112 iso_pu_bacteria 2903727486 2903728622 332
113 iso_pu_bacteria 2904711408 2904713780 332
114 iso_pu_bacteria 2906602504 2906607814 332
115 iso_pu_bacteria 2906626472 2906628631 332
116 iso_pu_bacteria 2906643746 2906652190 332
117 iso_pu_bacteria 2922368715 2922376464 332
118 iso_pu_bacteria 2922393267 2922393477 332
119 iso_pu_bacteria 2932794094 2932796796 332
120 iso_pu_bacteria 2932801729 2932802424 332
121 iso_pu_bacteria 2932809354 2932814963 332
122 iso_pu_bacteria 2932818245 2932824180 332
123 iso_pu_bacteria 2932828146 2932834092 332
124 iso_pu_bacteria 2933577622 2933581945 332
125 iso_pu_bacteria 2935608549 2935613379 332
126 iso_pu_bacteria 2935616580 2935623518 332
127 iso_pu_bacteria 2935638405 2935644905 332
128 iso_pu_bacteria 2935648319 2935653746 332
129 iso_pu_bacteria 2935656913 2935662495 332
130 iso_pu_bacteria 2935675223 2935683117 332
131 iso_pu_bacteria 2935684952 2935689286 332
132 iso_pu_bacteria 2935694250 2935697454 332
133 iso_pu_bacteria 2935703347 2935711029 332
134 iso_pu_bacteria 2935713505 2935720232 332
135 iso_pu_bacteria 2935722832 2935728151 332
136 iso_pu_bacteria 2935732158 2935737252 332
137 iso_pu_bacteria 2935741537 2935746687 332
138 iso_pu_bacteria 2935750917 2935757654 332
139 iso_pu_bacteria 2935760218 2935764030 332
140 iso_pu_bacteria 2935769743 2935776527 332
141 iso_pu_bacteria 2935777560 2935784080 332
142 iso_pu_bacteria 2935785616 2935789955 332
143 iso_pu_bacteria 2935793552 2935798279 332
144 iso_pu_bacteria 2935801545 2935808618 332
145 iso_pu_bacteria 2935810662 2935817415 332
146 iso_pu_bacteria 2935819856 2935824768 332
147 iso_pu_bacteria 2935837841 2935844851 332
148 iso_pu_bacteria 2935847175 2935851988 332
149 iso_pu_bacteria 2935855204 2935861875 332
150 iso_pu_bacteria 2935864058 2935868490 332
151 iso_pu_bacteria 2935873716 2935879264 332
152 iso_pu_bacteria 2935883170 2935887134 332
153 iso_pu_bacteria 2935916978 2935920867 332
154 iso_pu_bacteria 2935959822 2935966033 332
155 iso_pu_bacteria 2935975950 2935979926 332
156 iso_pu_bacteria 2935984226 2935989356 332
157 iso_pu_bacteria 2935992306 2935998569 332
158 iso_pu_bacteria 2936002035 2936008970 332
159 iso_pu_bacteria 2936011229 2936016857 332
160 iso_pu_bacteria 2936019824 2936025490 332
161 iso_pu_bacteria 2936028420 2936034272 332
162 iso_pu_bacteria 2936037263 2936044212 332
163 iso_pu_bacteria 2936046547 2936052329 332
164 iso_pu_bacteria 2936055302 2936060610 332
165 iso_pu_bacteria 2940556831 2940563524 332
166 iso_pu_bacteria 2941538514 2941545255 332
167 iso_pu_bacteria 3005587118 3005591332 332
168 iso_pu_bacteria 3005594810 3005601533 332
169 iso_pu_bacteria 3005710791 3005717263 332
170 iso_pu_bacteria 3005718088 3005724229 332
171 iso_pu_bacteria 8006926726 8006928136 332
172 iso_pu_bacteria 8016511872 8016519380 332
173 iso_pu_bacteria 8016522445 8016524975 332
174 iso_pu_bacteria 8016530956 8016538551 332
175 iso_pu_bacteria 8016539877 8016542836 332
176 iso_pu_bacteria 8016566248 8016568226 332
177 iso_pu_bacteria 8016575299 8016580892 332
178 iso_pu_bacteria 8016583857 8016587858 332
179 iso_pu_bacteria 8016595262 8016596833 332
180 iso_pu_bacteria 8016603502 8016607733 332
181 iso_pu_bacteria 8016630954 8016637078 332
182 iso_pu_bacteria 8019530166 8019538219 332
183 iso_pu_bacteria 8019538911 8019541765 332
184 iso_pu_bacteria 8019547302 8019549025 332
185 iso_pu_bacteria 8019576017 8019578488 332
186 iso_pu_bacteria 8019608314 8019613371 332
187 iso_pu_bacteria 8019619141 8019624040 332
188 iso_pu_bacteria 8019638758 8019641640 332
189 iso_pu_bacteria 8019659431 8019665915 332
190 iso_pu_bacteria 8019668869 8019675436 332
191 iso_pu_bacteria 8019678201 8019680662 332
192 iso_pu_bacteria 8055742211 8055750220 332
193 iso_pu_bacteria 8056967851 8056975999 332
194 3300003323 rootH1_10192526 rootH1_101925263 333
195 3300005436 Ga0070713_100000953 Ga0070713_10000095314 333
196 3300006028 Ga0070717_10000254 Ga0070717_1000025417 333
197 3300025928 Ga0207700_10004425 Ga0207700_100044254 333
198 3300025929 Ga0207664_10022744 Ga0207664_100227444 333
199 3300026116 Ga0207674_10153017 Ga0207674_101530173 333
200 3300031247 Ga0265340_10036726 Ga0265340_100367261 333
201 3300031249 Ga0265339_10001243 Ga0265339_1000124311 333
202 3300035089 Ga0373944_0035969 Ga0373944_0035969_73_1074 333
203 3300035113 Ga0373936_0043234 Ga0373936_0043234_167_1168 333
204 3300035116 Ga0373945_0089948 Ga0373945_0089948_176_1177 333
205 3300035118 Ga0373954_0014534 Ga0373954_0014534_1138_2139 333
206 3300035118 Ga0373954_0042046 Ga0373954_0042046_1067_2068 333
207 3300035692 Ga0373935_0030162 Ga0373935_0030162_1722_2723 333
208 3300035695 Ga0373927_0131200 Ga0373927_0131200_451_1452 333
209 3300035725 Ga0373947_0013699 Ga0373947_0013699_1489_2490 333
210 3300046459 Ga0495629_0044250 Ga0495629_0044250_452_1453 333
211 3300046473 Ga0495582_0021685 Ga0495582_0021685_1873_2874 333
212 3300046475 Ga0495639_0012233 Ga0495639_0012233_2016_3017 333
213 3300046514 Ga0495618_0007721 Ga0495618_0007721_5454_6455 333
214 3300046533 Ga0495640_0033071 Ga0495640_0033071_840_1841 333
215 3300046559 Ga0495667_0081248 Ga0495667_0081248_430_1431 333
216 3300046642 Ga0495634_0055274 Ga0495634_0055274_594_1595 333
217 3300046663 Ga0495635_0052309 Ga0495635_0052309_823_1824 333
218 3300046678 Ga0495599_0074203 Ga0495599_0074203_952_1953 333
219 3300047471 Ga0495684_0084381 Ga0495684_0084381_71_1072 333
220 3300047673 Ga0495593_0023139 Ga0495593_0023139_1528_2529 333
221 3300048917 Ga0496114_0236119 Ga0496114_0236119_311_1312 333
222 3300048918 Ga0496115_0246031 Ga0496115_0246031_342_1343 333
223 3300005434 Ga0070709_10015719 Ga0070709_100157191 334
224 3300005436 Ga0070713_100002544 Ga0070713_1000025449 334
225 3300005439 Ga0070711_100032960 Ga0070711_1000329602 334
226 3300005458 Ga0070681_10078189 Ga0070681_100781894 334
227 3300005983 Ga0081540_1039073 Ga0081540_10390732 334
228 3300006871 Ga0075434_100014230 Ga0075434_1000142306 334
229 3300021388 Ga0213875_10033988 Ga0213875_100339884 334
230 3300025906 Ga0207699_10050650 Ga0207699_100506501 334
231 3300025906 Ga0207699_10064927 Ga0207699_100649272 334
232 3300025912 Ga0207707_10013667 Ga0207707_100136672 334
233 3300025915 Ga0207693_10050661 Ga0207693_100506612 334
234 3300025949 Ga0207667_10248548 Ga0207667_102485482 334
235 3300028786 Ga0307517_10147672 Ga0307517_101476722 334
236 3300037466 Ga0395898_0172278 Ga0395898_0172278_531_1562 334
237 3300039437 Ga0436365_1440327 Ga0436365_1440327_1452_2456 334
238 3300044658 Ga0466972_0055497 Ga0466972_0055497_783_1787 334
239 3300044842 Ga0466957_0088312 Ga0466957_0088312_38_1042 334
240 3300045049 Ga0466959_0094017 Ga0466959_0094017_653_1657 334
241 3300045976 Ga0466967_0014490 Ga0466967_0014490_805_1815 334
242 3300046477 Ga0495664_0006070 Ga0495664_0006070_4419_5441 334
243 3300046543 Ga0495645_0024305 Ga0495645_0024305_2197_3219 334
244 3300049581 Ga0501047_0055709 Ga0501047_0055709_1501_2523 334
245 3300049590 Ga0501074_0065042 Ga0501074_0065042_416_1438 334
246 3300049823 Ga0501044_0117914 Ga0501044_0117914_1124_2146 334
247 3300053078 Ga0495612_0004736 Ga0495612_0004736_1865_2887 334
248 3300048928 Ga0496125_0055584 Ga0496125_0055584_542_1549 335
249 3300003215 JGI25153J46596_10001623 JGI25153J46596_100016232 336
250 3300003354 JGI25160J50197_1002758 JGI25160J50197_10027589 336
251 3300005347 Ga0070668_100035799 Ga0070668_1000357992 336
252 3300005347 Ga0070668_100099661 Ga0070668_1000996612 336
253 3300005364 Ga0070673_100448028 Ga0070673_1004480281 336
254 3300005367 Ga0070667_100207448 Ga0070667_1002074482 336
255 3300005455 Ga0070663_100110969 Ga0070663_1001109693 336
256 3300005539 Ga0068853_100365443 Ga0068853_1003654431 336
257 3300005548 Ga0070665_100483180 Ga0070665_1004831802 336
258 3300005614 Ga0068856_100273332 Ga0068856_1002733321 336
259 3300005616 Ga0068852_100641570 Ga0068852_1006415701 336
260 3300005618 Ga0068864_100265284 Ga0068864_1002652842 336
261 3300005618 Ga0068864_100461795 Ga0068864_1004617952 336
262 3300006038 Ga0075365_10131062 Ga0075365_101310622 336
263 3300006353 Ga0075370_10050931 Ga0075370_100509311 336
264 3300006942 Ga0099824_1024933 Ga0099824_10249332 336
265 3300009093 Ga0105240_10016306 Ga0105240_100163061 336
266 3300009093 Ga0105240_10153372 Ga0105240_101533723 336
267 3300009148 Ga0105243_10233940 Ga0105243_102339402 336
268 3300009174 Ga0105241_10115949 Ga0105241_101159492 336
269 3300009174 Ga0105241_10419373 Ga0105241_104193731 336
270 3300009551 Ga0105238_10227618 Ga0105238_102276182 336
271 3300010375 Ga0105239_10428697 Ga0105239_104286972 336
272 3300013308 Ga0157375_10165506 Ga0157375_101655062 336
273 3300014325 Ga0163163_10229325 Ga0163163_102293252 336
274 3300021320 Ga0214544_1010585 Ga0214544_10105856 336
275 3300021321 Ga0214542_1008517 Ga0214542_10085179 336
276 3300021321 Ga0214542_1028635 Ga0214542_10286352 336
277 3300021327 Ga0214543_1019010 Ga0214543_10190105 336
278 3300021327 Ga0214543_1024354 Ga0214543_10243542 336
279 3300025253 Ga0209677_104778 Ga0209677_1047783 336
280 3300025295 Ga0209564_1006693 Ga0209564_10066932 336
281 3300025297 Ga0209758_1000604 Ga0209758_100060461 336
282 3300025297 Ga0209758_1012739 Ga0209758_10127394 336
283 3300025297 Ga0209758_1051022 Ga0209758_10510222 336
284 3300025299 Ga0209256_1026679 Ga0209256_10266791 336
285 3300025302 Ga0207426_1000500 Ga0207426_100050012 336
286 3300025304 Ga0209257_1029591 Ga0209257_10295912 336
287 3300025901 Ga0207688_10086097 Ga0207688_100860972 336
288 3300025904 Ga0207647_10097983 Ga0207647_100979832 336
289 3300025913 Ga0207695_10000123 Ga0207695_10000123120 336
290 3300025972 Ga0207668_10161695 Ga0207668_101616952 336
291 3300026041 Ga0207639_10203497 Ga0207639_102034971 336
292 3300026041 Ga0207639_10261082 Ga0207639_102610821 336
293 3300026067 Ga0207678_10121940 Ga0207678_101219402 336
294 3300026067 Ga0207678_10161556 Ga0207678_101615563 336
295 3300027296 Ga0209389_1000070 Ga0209389_100007032 336
296 3300027357 Ga0209589_1000838 Ga0209589_100083837 336
297 3300027361 Ga0209489_100196 Ga0209489_10019680 336
298 3300028379 Ga0268266_10176215 Ga0268266_101762152 336
299 3300033180 Ga0307510_10004632 Ga0307510_100046324 336
300 3300033180 Ga0307510_10267590 Ga0307510_102675901 336
301 3300037471 Ga0395905_0031189 Ga0395905_0031189_3826_4836 336
302 3300044693 Ga0466961_0018981 Ga0466961_0018981_1148_2158 336
303 3300045049 Ga0466959_0002955 Ga0466959_0002955_8524_9534 336
304 3300046454 Ga0495592_0071921 Ga0495592_0071921_457_1467 336
305 3300046457 Ga0495590_0034234 Ga0495590_0034234_294_1304 336
306 3300046460 Ga0495638_0003264 Ga0495638_0003264_3884_4894 336
307 3300046462 Ga0495651_0102180 Ga0495651_0102180_203_1213 336
308 3300046471 Ga0495650_0070148 Ga0495650_0070148_29_1039 336
309 3300046477 Ga0495664_0049374 Ga0495664_0049374_1149_2159 336
310 3300046477 Ga0495664_0183602 Ga0495664_0183602_11_1021 336
311 3300046506 Ga0495583_0108335 Ga0495583_0108335_141_1151 336
312 3300046507 Ga0495606_0085716 Ga0495606_0085716_284_1318 336
313 3300046516 Ga0495628_0038399 Ga0495628_0038399_284_1294 336
314 3300046522 Ga0495643_0047323 Ga0495643_0047323_1250_2260 336
315 3300046529 Ga0495652_0036972 Ga0495652_0036972_445_1455 336
316 3300046538 Ga0495609_0042159 Ga0495609_0042159_783_1817 336
317 3300046543 Ga0495645_0045511 Ga0495645_0045511_1209_2219 336
318 3300046660 Ga0495625_0057020 Ga0495625_0057020_918_1952 336
319 3300046663 Ga0495635_0057741 Ga0495635_0057741_203_1213 336
320 3300046663 Ga0495635_0213560 Ga0495635_0213560_231_1253 336
321 3300046674 Ga0495588_0044463 Ga0495588_0044463_368_1402 336
322 3300046679 Ga0495623_0012424 Ga0495623_0012424_2661_3671 336
323 3300046694 Ga0495649_0069642 Ga0495649_0069642_820_1830 336
324 3300047317 Ga0495604_0035353 Ga0495604_0035353_208_1218 336
325 3300047317 Ga0495604_0145333 Ga0495604_0145333_23_1045 336
326 3300047321 Ga0495676_0124493 Ga0495676_0124493_365_1399 336
327 3300047321 Ga0495676_0133936 Ga0495676_0133936_395_1405 336
328 3300047322 Ga0495680_0025217 Ga0495680_0025217_833_1843 336
329 3300047323 Ga0495683_0136508 Ga0495683_0136508_90_1100 336
330 3300047444 Ga0495675_0147785 Ga0495675_0147785_240_1250 336
331 3300048088 Ga0495602_0018699 Ga0495602_0018699_1808_2818 336
332 3300048904 Ga0496101_0062882 Ga0496101_0062882_564_1598 336
333 3300048904 Ga0496101_0259062 Ga0496101_0259062_212_1222 336
334 3300048905 Ga0496102_0128791 Ga0496102_0128791_1130_2140 336
335 3300048905 Ga0496102_0191152 Ga0496102_0191152_20_1030 336
336 3300048905 Ga0496102_0217738 Ga0496102_0217738_61_1071 336
337 3300048907 Ga0496104_0142748 Ga0496104_0142748_553_1563 336
338 3300048907 Ga0496104_0209983 Ga0496104_0209983_418_1452 336
339 3300048908 Ga0496105_0020594 Ga0496105_0020594_3095_4129 336
340 3300048910 Ga0496107_0239115 Ga0496107_0239115_189_1199 336
341 3300048910 Ga0496107_0306688 Ga0496107_0306688_100_1110 336
342 3300048914 Ga0496111_0163015 Ga0496111_0163015_592_1602 336
343 3300048915 Ga0496112_0117285 Ga0496112_0117285_1067_2077 336
344 3300048918 Ga0496115_0201537 Ga0496115_0201537_537_1547 336
345 3300048918 Ga0496115_0338547 Ga0496115_0338547_80_1090 336
346 3300048919 Ga0496116_0096323 Ga0496116_0096323_249_1259 336
347 3300048920 Ga0496117_0091575 Ga0496117_0091575_672_1706 336
348 3300048921 Ga0496118_0094698 Ga0496118_0094698_892_1926 336
349 3300048922 Ga0496119_0066684 Ga0496119_0066684_346_1383 336
350 3300048923 Ga0496120_0069720 Ga0496120_0069720_143_1177 336
351 3300048923 Ga0496120_0086779 Ga0496120_0086779_188_1225 336
352 3300048924 Ga0496121_0011258 Ga0496121_0011258_992_2026 336
353 3300048929 Ga0496126_0078181 Ga0496126_0078181_840_1874 336
354 3300048929 Ga0496126_0090208 Ga0496126_0090208_245_1255 336
355 3300048929 Ga0496126_0144646 Ga0496126_0144646_995_2032 336
356 3300050493 nmdc:mga0k408_144324_c1 nmdc:mga0k408_144324_c1_374_1384 336
357 3300050496 nmdc:mga07m45_67106_c1 nmdc:mga07m45_67106_c1_322_1332 336
358 3300053085 Ga0495619_0124679 Ga0495619_0124679_115_1125 336
359 3300053086 Ga0500578_0057352 Ga0500578_0057352_623_1633 336
360 3300053087 Ga0500643_000013 Ga0500643_000013_309794_310804 336
361 3300053103 Ga0500555_019218 Ga0500555_019218_611_1621 336
362 3300053105 Ga0500557_000030 Ga0500557_000030_19041_20150 336
363 3300053109 Ga0500569_048993 Ga0500569_048993_101_1111 336
364 3300053119 Ga0500595_056954 Ga0500595_056954_20_1030 336
365 3300053130 Ga0500642_0000299 Ga0500642_0000299_14905_15915 336
366 3300053136 Ga0500559_0001936 Ga0500559_0001936_8702_9712 336
367 3300053729 Ga0500625_023982 Ga0500625_023982_52_1062 336
368 iso_pu_bacteria 2932784394 2932789530 336
369 iso_pu_bacteria 2935665750 2935671954 336
370 iso_pu_bacteria 2935827899 2935834249 336
371 iso_pu_bacteria 8017057580 8017066142 336
372 iso_pu_bacteria 8019586578 8019596532 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

120

250

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

117

349

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

119

355

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.7846 50 336
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.7813 50 336
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.7777 52 330
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.7641 52 330
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.7478 58 331
ID Description Score Start End Superfamily
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7846 50 336 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7813 50 336 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7777 52 330 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7641 52 330 3.40.50.1820
af_B4FGW5_14_203_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7579 84 312 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7S7W835-F1-model_v4 Alpha/beta hydrolase 0.9352 24 336 GO:0016787
AF-A0A7S7W835-F1-model_v4 Alpha/beta hydrolase 0.9295 24 336 GO:0016787
AF-A0A7H9V8G5-F1-model_v4 deleted 0.9092 14 328
AF-A0A0Q8U698-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9048 18 327
AF-A0A1F9BFF1-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.8989 41 330 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map