F426182

General Info

Members Datasets Scaffolds Average Seq Length
372 143 372 160

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_1572390_c1|nmdc:mga0n895_1572390_c1_61_600
Length 179
Sequence LKHPDWPKYRKSGSGWQKERLVNTNAIISELESKRDAGWTLSRLKELAVTLLHESNPRFHWTGIYELFPDDTLRLGPFLGAPTDHVFIGMGQGVCGTAVAERRNINVPDVTQLENYLACSTETRSELVVLIRSGERIHGQIDIDSHEPAAFDESAEHEVQRVADFLAPLYEAWTKGRGA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
95 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10087732 3300005295 Bacteria 4911
2 Ga0065707_10114690 3300005295 Bacteria 2290
3 Ga0065707_10185124 3300005295 Unclassified 1394
4 Ga0065707_10458934 3300005295 Bacteria 793
5 Ga0070690_100031068 3300005330 Bacteria 3324
6 Ga0070690_100046049 3300005330 Bacteria 2773
7 Ga0068869_100378901 3300005334 Bacteria 1159
8 Ga0068869_100512367 3300005334 Bacteria 1003
9 Ga0068868_100140922 3300005338 Bacteria 1979
10 Ga0070689_100000825 3300005340 Bacteria 19162
11 Ga0070689_100002180 3300005340 Bacteria 12681
12 Ga0070689_100024024 3300005340 Bacteria 4570
13 Ga0070689_100058174 3300005340 Bacteria 3002
14 Ga0070689_100149181 3300005340 Bacteria 1885
15 Ga0070689_100240376 3300005340 Bacteria 1491
16 Ga0070689_100850359 3300005340 Bacteria 805
17 Ga0070687_100015473 3300005343 Bacteria 3452
18 Ga0070692_10024968 3300005345 Bacteria 2942
19 Ga0070669_100060944 3300005353 Unclassified 2772
20 Ga0070675_100251373 3300005354 Bacteria 1547
21 Ga0070675_100470472 3300005354 Bacteria 1129
22 Ga0070675_100807060 3300005354 Unclassified 858
23 Ga0070673_100580183 3300005364 Bacteria 1021
24 Ga0070673_100753769 3300005364 Unclassified 897
25 Ga0070688_100000227 3300005365 Bacteria 29611
26 Ga0070688_100003058 3300005365 Bacteria 8539
27 Ga0070688_100017156 3300005365 Bacteria 4154
28 Ga0070688_100031617 3300005365 Bacteria 3185
29 Ga0070688_100090007 3300005365 Unclassified 2003
30 Ga0070688_100472022 3300005365 Bacteria 942
31 Ga0070703_10044482 3300005406 Unclassified 1396
32 Ga0070703_10385184 3300005406 Unclassified 607
33 Ga0070709_10022863 3300005434 Bacteria 3664
34 Ga0070701_10100550 3300005438 Unclassified 1601
35 Ga0070701_10170765 3300005438 Bacteria 1266
36 Ga0070701_10220603 3300005438 Unclassified 1130
37 Ga0070711_100724487 3300005439 Unclassified 839
38 Ga0070705_100376137 3300005440 Bacteria 1044
39 Ga0070705_100462277 3300005440 Unclassified 955
40 Ga0070700_100030610 3300005441 Bacteria 3218
41 Ga0070700_100497509 3300005441 Unclassified 937
42 Ga0070694_100002364 3300005444 Bacteria 11145
43 Ga0070694_100029304 3300005444 Bacteria 3591
44 Ga0070694_100053854 3300005444 Bacteria 2724
45 Ga0070694_100179438 3300005444 Bacteria 1565
46 Ga0070694_100182198 3300005444 Unclassified 1554
47 Ga0070708_100008590 3300005445 Bacteria 8206
48 Ga0070708_100048423 3300005445 Bacteria 3757
49 Ga0070708_100776683 3300005445 Unclassified 901
50 Ga0070662_100035742 3300005457 Bacteria 3511
51 Ga0068867_101488218 3300005459 Unclassified 630
52 Ga0070685_10002293 3300005466 Bacteria 9877
53 Ga0070685_10296799 3300005466 Unclassified 1088
54 Ga0070706_100057568 3300005467 Unclassified 3587
55 Ga0070706_100084524 3300005467 Bacteria 2940
56 Ga0070707_100052389 3300005468 Unclassified 3913
57 Ga0070707_100501336 3300005468 Unclassified 1176
58 Ga0070707_100566560 3300005468 Unclassified 1098
59 Ga0070707_100932964 3300005468 Unclassified 833
60 Ga0070698_100013976 3300005471 Bacteria 8491
61 Ga0070698_100139102 3300005471 Bacteria 2381
62 Ga0070698_100147955 3300005471 Bacteria 2297
63 Ga0070698_101084455 3300005471 Bacteria 749
64 Ga0070699_100000174 3300005518 Bacteria 61931
65 Ga0070699_100384610 3300005518 Unclassified 1267
66 Ga0070699_100924235 3300005518 Unclassified 799
67 Ga0070697_100000373 3300005536 Bacteria 35011
68 Ga0070697_100232541 3300005536 Bacteria 1572
69 Ga0070697_101246419 3300005536 Bacteria 663
70 Ga0070672_100412936 3300005543 Bacteria 1158
71 Ga0070672_100473118 3300005543 Unclassified 1081
72 Ga0070672_101446564 3300005543 Unclassified 615
73 Ga0070686_100031310 3300005544 Bacteria 3251
74 Ga0070686_100037856 3300005544 Bacteria 2995
75 Ga0070686_100082685 3300005544 Bacteria 2130
76 Ga0070686_100179901 3300005544 Bacteria 1502
77 Ga0070686_100739691 3300005544 Unclassified 788
78 Ga0070695_100003074 3300005545 Bacteria 9711
79 Ga0070695_100005388 3300005545 Bacteria 7531
80 Ga0070695_100422821 3300005545 Unclassified 1015
81 Ga0070695_100499246 3300005545 Bacteria 941
82 Ga0070696_100044207 3300005546 Bacteria 3084
83 Ga0070696_100084284 3300005546 Bacteria 2255
84 Ga0070704_100033268 3300005549 Bacteria 3484
85 Ga0070704_100034882 3300005549 Bacteria 3415
86 Ga0070704_100038556 3300005549 Bacteria 3274
87 Ga0070704_100050122 3300005549 Bacteria 2932
88 Ga0070704_100156360 3300005549 Bacteria 1798
89 Ga0070704_100709335 3300005549 Bacteria 893
90 Ga0068855_101398204 3300005563 Unclassified 721
91 Ga0070702_100297742 3300005615 Bacteria 1115
92 Ga0068859_100002813 3300005617 Bacteria 17634
93 Ga0068859_100005262 3300005617 Bacteria 13149
94 Ga0068859_100029236 3300005617 Bacteria 5530
95 Ga0068859_100042702 3300005617 Bacteria 4555
96 Ga0068859_100056698 3300005617 Bacteria 3944
97 Ga0068864_100704499 3300005618 Unclassified 987
98 Ga0068864_101292751 3300005618 Unclassified 730
99 Ga0068861_100003689 3300005719 Bacteria 10214
100 Ga0068861_100381905 3300005719 Bacteria 1245
101 Ga0068861_100941072 3300005719 Bacteria 821
102 Ga0068861_101006039 3300005719 Unclassified 796
103 Ga0068870_10163487 3300005840 Unclassified 1322
104 Ga0068863_100111807 3300005841 Bacteria 2601
105 Ga0068863_100539735 3300005841 Bacteria 1151
106 Ga0068858_100163113 3300005842 Bacteria 2099
107 Ga0068860_100171116 3300005843 Bacteria 2098
108 Ga0068860_100604535 3300005843 Bacteria 1102
109 Ga0068860_102106279 3300005843 Unclassified 585
110 Ga0068862_100189645 3300005844 Bacteria 1849
111 Ga0068862_102042476 3300005844 Bacteria 584
112 Ga0070712_101012144 3300006175 Unclassified 719
113 Ga0075428_100000473 3300006844 Bacteria 40394
114 Ga0075428_100005573 3300006844 Bacteria 13993
115 Ga0075428_100017512 3300006844 Bacteria 7916
116 Ga0075428_100028501 3300006844 Bacteria 6178
117 Ga0075428_100030230 3300006844 Bacteria 5991
118 Ga0075428_100031370 3300006844 Bacteria 5876
119 Ga0075428_100066037 3300006844 Bacteria 3962
120 Ga0075428_100083375 3300006844 Unclassified 3488
121 Ga0075428_100091446 3300006844 Bacteria 3319
122 Ga0075428_100158011 3300006844 Bacteria 2461
123 Ga0075428_100210322 3300006844 Bacteria 2102
124 Ga0075430_100026118 3300006846 Unclassified 4969
125 Ga0075430_100165880 3300006846 Bacteria 1838
126 Ga0075430_100294905 3300006846 Bacteria 1341
127 Ga0075431_100000715 3300006847 Bacteria 28585
128 Ga0075431_100046215 3300006847 Bacteria 4489
129 Ga0075431_101033527 3300006847 Bacteria 788
130 Ga0075431_101531063 3300006847 Bacteria 625
131 Ga0075433_10000053 3300006852 Bacteria 49682
132 Ga0075433_10003477 3300006852 Bacteria 12163
133 Ga0075433_10008729 3300006852 Bacteria 8085
134 Ga0075433_10013462 3300006852 Bacteria 6651
135 Ga0075433_10074928 3300006852 Bacteria 2978
136 Ga0075433_10113684 3300006852 Unclassified 2402
137 Ga0075433_10437417 3300006852 Unclassified 1153
138 Ga0075433_11196671 3300006852 Unclassified 660
139 Ga0075434_100005601 3300006871 Bacteria 11442
140 Ga0075434_100009408 3300006871 Bacteria 9108
141 Ga0075434_100017803 3300006871 Bacteria 6852
142 Ga0075434_100071236 3300006871 Bacteria 3467
143 Ga0075434_100216319 3300006871 Unclassified 1936
144 Ga0075434_100562202 3300006871 Bacteria 1160
145 Ga0075434_101074590 3300006871 Unclassified 818
146 Ga0075434_101160896 3300006871 Bacteria 785
147 Ga0075434_101292823 3300006871 Unclassified 740
148 Ga0075429_100029287 3300006880 Unclassified 4783
149 Ga0075429_100359358 3300006880 Unclassified 1275
150 Ga0075429_100871754 3300006880 Bacteria 788
151 Ga0068865_100044564 3300006881 Unclassified 3037
152 Ga0068865_100949811 3300006881 Unclassified 750
153 Ga0075436_100002172 3300006914 Bacteria 13521
154 Ga0075436_100005797 3300006914 Bacteria 8482
155 Ga0075436_100364543 3300006914 Bacteria 1043
156 Ga0097620_100002813 3300006931 Bacteria 17634
157 Ga0097620_100005262 3300006931 Bacteria 13149
158 Ga0097620_100029237 3300006931 Bacteria 5530
159 Ga0097620_100042702 3300006931 Bacteria 4555
160 Ga0097620_100056696 3300006931 Bacteria 3944
161 Ga0075435_100003701 3300007076 Bacteria 10415
162 Ga0075435_100046594 3300007076 Bacteria 3478
163 Ga0075435_100194381 3300007076 Bacteria 1718
164 Ga0099794_10298603 3300007265 Unclassified 834
165 Ga0111539_10017245 3300009094 Bacteria 8936
166 Ga0111539_10017373 3300009094 Bacteria 8904
167 Ga0111539_10024662 3300009094 Bacteria 7376
168 Ga0111539_10136739 3300009094 Bacteria 2870
169 Ga0111539_10239267 3300009094 Bacteria 2113
170 Ga0111539_10245026 3300009094 Bacteria 2087
171 Ga0111539_10703531 3300009094 Unclassified 1176
172 Ga0114129_10005814 3300009147 Bacteria 17468
173 Ga0114129_10153742 3300009147 Bacteria 3148
174 Ga0114129_10361798 3300009147 Bacteria 1920
175 Ga0114129_10509192 3300009147 Unclassified 1571
176 Ga0114129_10582182 3300009147 Unclassified 1452
177 Ga0114129_10617638 3300009147 Bacteria 1402
178 Ga0114129_10676595 3300009147 Unclassified 1329
179 Ga0114129_10832274 3300009147 Bacteria 1175
180 Ga0114129_11031426 3300009147 Unclassified 1034
181 Ga0105243_11840764 3300009148 Unclassified 637
182 Ga0105241_11749099 3300009174 Unclassified 605
183 Ga0105248_10483428 3300009177 Unclassified 1396
184 Ga0105249_10048908 3300009553 Bacteria 3856
185 Ga0105249_10483565 3300009553 Bacteria 1281
186 Ga0105249_12005537 3300009553 Bacteria 651
187 Ga0105239_12122968 3300010375 Unclassified 653
188 Ga0157378_10028508 3300013297 Bacteria 4928
189 Ga0157378_10968433 3300013297 Bacteria 884
190 Ga0157375_11060676 3300013308 Unclassified 947
191 Ga0163163_10014049 3300014325 Bacteria 7350
192 Ga0157380_10030795 3300014326 Bacteria 4112
193 Ga0157380_10088119 3300014326 Bacteria 2553
194 Ga0157380_10112970 3300014326 Bacteria 2286
195 Ga0157380_11008553 3300014326 Unclassified 866
196 Ga0157377_10630703 3300014745 Unclassified 769
197 Ga0163161_10948030 3300017792 Unclassified 732
198 Ga0207645_10363416 3300025907 Unclassified 970
199 Ga0207643_10187249 3300025908 Bacteria 1255
200 Ga0207663_10737615 3300025916 Unclassified 782
201 Ga0207662_10001142 3300025918 Bacteria 12541
202 Ga0207646_10077263 3300025922 Bacteria 2976
203 Ga0207646_10092523 3300025922 Bacteria 2707
204 Ga0207646_10185283 3300025922 Bacteria 1880
205 Ga0207646_10218972 3300025922 Bacteria 1720
206 Ga0207681_10007868 3300025923 Bacteria 6524
207 Ga0207681_10438049 3300025923 Unclassified 1061
208 Ga0207681_11182832 3300025923 Bacteria 642
209 Ga0207659_10143273 3300025926 Bacteria 1857
210 Ga0207659_10413828 3300025926 Bacteria 1130
211 Ga0207644_10004172 3300025931 Bacteria 9370
212 Ga0207706_10159123 3300025933 Bacteria 1986
213 Ga0207706_11240790 3300025933 Bacteria 618
214 Ga0207670_10000406 3300025936 Bacteria 24765
215 Ga0207670_10001228 3300025936 Bacteria 13543
216 Ga0207670_10002395 3300025936 Bacteria 9825
217 Ga0207670_10007565 3300025936 Bacteria 6071
218 Ga0207670_10010457 3300025936 Bacteria 5349
219 Ga0207670_10032522 3300025936 Bacteria 3355
220 Ga0207670_10237015 3300025936 Bacteria 1404
221 Ga0207704_10122526 3300025938 Bacteria 1783
222 Ga0207704_10506621 3300025938 Unclassified 974
223 Ga0207665_10523378 3300025939 Bacteria 918
224 Ga0207691_10564387 3300025940 Bacteria 965
225 Ga0207711_10057194 3300025941 Unclassified 3353
226 Ga0207689_10285770 3300025942 Unclassified 1366
227 Ga0207651_10581329 3300025960 Unclassified 977
228 Ga0207712_10027358 3300025961 Bacteria 3807
229 Ga0207677_10455864 3300026023 Bacteria 1097
230 Ga0207703_10092638 3300026035 Bacteria 2544
231 Ga0207703_10184777 3300026035 Bacteria 1842
232 Ga0207708_10023043 3300026075 Bacteria 4703
233 Ga0207708_10100985 3300026075 Bacteria 2233
234 Ga0207708_10179067 3300026075 Bacteria 1683
235 Ga0207641_10054596 3300026088 Bacteria 3391
236 Ga0207641_10235102 3300026088 Bacteria 1705
237 Ga0207676_10430130 3300026095 Unclassified 1240
238 Ga0207676_11821725 3300026095 Unclassified 607
239 Ga0207675_100001601 3300026118 Bacteria 22682
240 Ga0207675_100030430 3300026118 Bacteria 5028
241 Ga0207675_100167334 3300026118 Bacteria 2100
242 Ga0207675_101393066 3300026118 Bacteria 722
243 Ga0207675_102197986 3300026118 Bacteria 567
244 Ga0209998_10015561 3300027717 Bacteria 1594
245 Ga0207428_10047387 3300027907 Bacteria 3451
246 Ga0207428_10265681 3300027907 Unclassified 1277
247 Ga0207428_10767640 3300027907 Unclassified 686
248 Ga0268265_10113880 3300028380 Bacteria 2214
249 Ga0268265_10165001 3300028380 Unclassified 1887
250 Ga0268265_10205108 3300028380 Bacteria 1713
251 Ga0268265_10500594 3300028380 Bacteria 1145
252 Ga0373959_0068289 3300034820 Bacteria 799
253 Ga0373949_0109194 3300035090 Bacteria 766
254 Ga0373941_0244942 3300035115 Unclassified 698
255 Ga0373953_0160500 3300035117 Unclassified 966
256 Ga0373954_0111117 3300035118 Unclassified 1326
257 Ga0373943_0598685 3300035170 Unclassified 649
258 Ga0373942_0185901 3300035207 Unclassified 683
259 Ga0373933_0306865 3300035724 Bacteria 1028
260 Ga0373937_0203789 3300036401 Bacteria 1860
261 Ga0373937_0406119 3300036401 Unclassified 1292
262 Ga0450923_077331 3300042125 Unclassified 745
263 Ga0451577_0031013 3300042876 Bacteria 4826
264 Ga0451577_0342825 3300042876 Bacteria 1355
265 Ga0453683_0016107 3300044673 Bacteria 4831
266 Ga0453683_0463923 3300044673 Bacteria 820
267 Ga0453684_0251612 3300044712 Bacteria 2029
268 Ga0451576_0034670 3300045051 Bacteria 5359
269 Ga0451576_0043368 3300045051 Bacteria 4747
270 Ga0451576_0070860 3300045051 Bacteria 3628
271 Ga0451576_0179329 3300045051 Bacteria 2212
272 Ga0451576_0297460 3300045051 Bacteria 1688
273 Ga0451576_0348403 3300045051 Unclassified 1551
274 Ga0451576_0349434 3300045051 Bacteria 1548
275 Ga0451576_0476311 3300045051 Bacteria 1311
276 Ga0451576_0514484 3300045051 Bacteria 1257
277 Ga0451576_0819534 3300045051 Bacteria 977
278 Ga0451576_0833238 3300045051 Bacteria 968
279 Ga0451576_0839266 3300045051 Unclassified 964
280 Ga0495603_0399911 3300046455 Unclassified 787
281 Ga0495603_0567112 3300046455 Unclassified 650
282 Ga0495629_0000719 3300046459 Bacteria 26837
283 Ga0495629_0007279 3300046459 Bacteria 8150
284 Ga0495641_0204788 3300046461 Unclassified 884
285 Ga0495580_0369229 3300046472 Bacteria 970
286 Ga0495582_0035236 3300046473 Bacteria 2752
287 Ga0495639_0037818 3300046475 Bacteria 2165
288 Ga0495639_0045422 3300046475 Bacteria 1987
289 Ga0495594_0028105 3300046499 Bacteria 3033
290 Ga0495594_0123680 3300046499 Unclassified 1463
291 Ga0495618_0417904 3300046514 Unclassified 818
292 Ga0495630_0054179 3300046517 Bacteria 3005
293 Ga0495630_0447964 3300046517 Unclassified 989
294 Ga0495666_0073361 3300046526 Bacteria 1624
295 Ga0495666_0307873 3300046526 Unclassified 716
296 Ga0495586_0084325 3300046535 Bacteria 1749
297 Ga0495622_0292476 3300046557 Unclassified 711
298 Ga0495622_0308087 3300046557 Unclassified 689
299 Ga0495634_0071013 3300046642 Bacteria 2294
300 Ga0495635_0028606 3300046663 Bacteria 3874
301 Ga0495635_0412335 3300046663 Bacteria 896
302 Ga0495647_0000816 3300046681 Bacteria 9296
303 Ga0495658_0000263 3300046683 Bacteria 29804
304 Ga0495658_0348051 3300046683 Bacteria 942
305 Ga0495613_0002205 3300046689 Bacteria 14748
306 Ga0495613_0658547 3300046689 Unclassified 692
307 Ga0495600_0312485 3300046809 Bacteria 989
308 Ga0495581_0000788 3300047315 Bacteria 16802
309 Ga0495581_0172785 3300047315 Bacteria 1264
310 Ga0495676_0020779 3300047321 Bacteria 5752
311 Ga0495680_0000064 3300047322 Bacteria 89681
312 Ga0495680_0067849 3300047322 Bacteria 2726
313 Ga0495680_0158237 3300047322 Unclassified 1647
314 Ga0495684_0398130 3300047471 Unclassified 967
315 Ga0495614_0009257 3300048089 Bacteria 4360
316 Ga0495614_0208683 3300048089 Unclassified 885
317 Ga0501068_0368805 3300049584 Bacteria 924
318 Ga0501073_0358610 3300049589 Bacteria 1007
319 nmdc:mga05p37_1216858_c1 3300050507 Bacteria 776
320 nmdc:mga05p37_134647_c1 3300050507 Unclassified 3031
321 nmdc:mga05p37_199266_c1 3300050507 Bacteria 2426
322 nmdc:mga05p37_291562_c1 3300050507 Unclassified 1942
323 nmdc:mga05p37_292230_c1 3300050507 Bacteria 1939
324 nmdc:mga05p37_331864_c1 3300050507 Unclassified 1796
325 nmdc:mga05p37_463241_c1 3300050507 Bacteria 1464
326 nmdc:mga05p37_46339_c1 3300050507 Bacteria 5346
327 nmdc:mga05p37_656134_c1 3300050507 Bacteria 1174
328 nmdc:mga09592_104331_c1 3300050508 Unclassified 2429
329 nmdc:mga09592_13010_c1 3300050508 Bacteria 6792
330 nmdc:mga09592_24771_c1 3300050508 Bacteria 4962
331 nmdc:mga09592_328535_c1 3300050508 Bacteria 1324
332 nmdc:mga09592_740146_c1 3300050508 Bacteria 835
333 nmdc:mga0qj67_88046_c1 3300050509 Unclassified 2493
334 nmdc:mga06r32_1019779_c1 3300050510 Bacteria 779
335 nmdc:mga06r32_1348848_c1 3300050510 Bacteria 656
336 nmdc:mga06r32_18064_c1 3300050510 Bacteria 6450
337 nmdc:mga06r32_27335_c1 3300050510 Bacteria 5328
338 nmdc:mga06r32_528821_c1 3300050510 Unclassified 1154
339 nmdc:mga06r32_70277_c1 3300050510 Bacteria 3385
340 nmdc:mga08y16_219324_c1 3300050511 Bacteria 1969
341 nmdc:mga08y16_363440_c1 3300050511 Bacteria 1486
342 nmdc:mga08y16_447489_c1 3300050511 Unclassified 1318
343 nmdc:mga08y16_49199_c1 3300050511 Bacteria 4412
344 nmdc:mga08y16_60241_c1 3300050511 Bacteria 3965
345 nmdc:mga08y16_699227_c1 3300050511 Unclassified 1014
346 nmdc:mga0n895_1053291_c1 3300050512 Unclassified 792
347 nmdc:mga0n895_135063_c1 3300050512 Bacteria 2493
348 nmdc:mga0n895_156367_c1 3300050512 Bacteria 2311
349 nmdc:mga0n895_1572390_c1 3300050512 Unclassified 622
350 nmdc:mga0n895_258025_c1 3300050512 Unclassified 1769
351 nmdc:mga0n895_273490_c1 3300050512 Unclassified 1713
352 nmdc:mga0n895_492859_c1 3300050512 Bacteria 1235
353 nmdc:mga0n895_5605_c1 3300050512 Bacteria 10513
354 nmdc:mga0n895_89_c1 3300050512 Bacteria 52989
355 nmdc:mga0n895_91864_c1 3300050512 Bacteria 3038
356 nmdc:mga0rr50_213926_c1 3300050513 Unclassified 1589
357 nmdc:mga0rr50_358_c1 3300050513 Bacteria 24880
358 nmdc:mga0rr50_78357_c1 3300050513 Bacteria 2542
359 nmdc:mga08x19_2964_c1 3300050514 Bacteria 10196
360 nmdc:mga08x19_38840_c1 3300050514 Unclassified 3024
361 nmdc:mga08x19_399386_c1 3300050514 Bacteria 964
362 nmdc:mga08x19_551989_c1 3300050514 Unclassified 815
363 nmdc:mga0a205_10324_c1 3300050515 Bacteria 8583
364 nmdc:mga0a205_14208_c2 3300050515 Bacteria 1909
365 nmdc:mga0a205_143660_c1 3300050515 Bacteria 2286
366 nmdc:mga0a205_199538_c1 3300050515 Unclassified 1891
367 nmdc:mga0a205_21177_c1 3300050515 Bacteria 6149
368 nmdc:mga0a205_25652_c1 3300050515 Bacteria 5617
369 nmdc:mga0a205_285293_c1 3300050515 Unclassified 1526
370 nmdc:mga0a205_34_c1 3300050515 Bacteria 78051
371 Ga0495619_0001478 3300053085 Bacteria 15485
372 Ga0501082_0631877 3300060353 Bacteria 937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_551989_c1 nmdc:mga08x19_551989_c1_286_804 143
2 3300049589 Ga0501073_0358610 Ga0501073_0358610_465_956 149
3 3300005295 Ga0065707_10114690 Ga0065707_101146903 154
4 3300005457 Ga0070662_100035742 Ga0070662_1000357423 154
5 3300005543 Ga0070672_100412936 Ga0070672_1004129362 154
6 3300025933 Ga0207706_10159123 Ga0207706_101591233 154
7 3300026118 Ga0207675_102197986 Ga0207675_1021979861 154
8 3300005330 Ga0070690_100031068 Ga0070690_1000310683 155
9 3300005340 Ga0070689_100149181 Ga0070689_1001491813 155
10 3300005345 Ga0070692_10024968 Ga0070692_100249682 155
11 3300005353 Ga0070669_100060944 Ga0070669_1000609441 155
12 3300005354 Ga0070675_100807060 Ga0070675_1008070602 155
13 3300005364 Ga0070673_100753769 Ga0070673_1007537692 155
14 3300005444 Ga0070694_100002364 Ga0070694_1000023646 155
15 3300005459 Ga0068867_101488218 Ga0068867_1014882182 155
16 3300005468 Ga0070707_100566560 Ga0070707_1005665602 155
17 3300005543 Ga0070672_101446564 Ga0070672_1014465641 155
18 3300005544 Ga0070686_100739691 Ga0070686_1007396912 155
19 3300005545 Ga0070695_100499246 Ga0070695_1004992462 155
20 3300005546 Ga0070696_100044207 Ga0070696_1000442073 155
21 3300005549 Ga0070704_100034882 Ga0070704_1000348822 155
22 3300005549 Ga0070704_100050122 Ga0070704_1000501222 155
23 3300005615 Ga0070702_100297742 Ga0070702_1002977422 155
24 3300005617 Ga0068859_100005262 Ga0068859_1000052625 155
25 3300005617 Ga0068859_100029236 Ga0068859_1000292363 155
26 3300005719 Ga0068861_100941072 Ga0068861_1009410722 155
27 3300005719 Ga0068861_101006039 Ga0068861_1010060392 155
28 3300005844 Ga0068862_102042476 Ga0068862_1020424761 155
29 3300006881 Ga0068865_100949811 Ga0068865_1009498111 155
30 3300006931 Ga0097620_100005262 Ga0097620_1000052625 155
31 3300006931 Ga0097620_100029237 Ga0097620_1000292375 155
32 3300009094 Ga0111539_10136739 Ga0111539_101367392 155
33 3300009147 Ga0114129_10509192 Ga0114129_105091922 155
34 3300009553 Ga0105249_10048908 Ga0105249_100489082 155
35 3300009553 Ga0105249_10483565 Ga0105249_104835651 155
36 3300014745 Ga0157377_10630703 Ga0157377_106307032 155
37 3300017792 Ga0163161_10948030 Ga0163161_109480301 155
38 3300025907 Ga0207645_10363416 Ga0207645_103634162 155
39 3300025923 Ga0207681_10007868 Ga0207681_100078685 155
40 3300025923 Ga0207681_11182832 Ga0207681_111828322 155
41 3300025936 Ga0207670_10032522 Ga0207670_100325222 155
42 3300025938 Ga0207704_10506621 Ga0207704_105066212 155
43 3300025940 Ga0207691_10564387 Ga0207691_105643871 155
44 3300025960 Ga0207651_10581329 Ga0207651_105813291 155
45 3300025961 Ga0207712_10027358 Ga0207712_100273584 155
46 3300026075 Ga0207708_10179067 Ga0207708_101790671 155
47 3300026118 Ga0207675_100030430 Ga0207675_1000304302 155
48 3300026118 Ga0207675_101393066 Ga0207675_1013930661 155
49 3300027907 Ga0207428_10767640 Ga0207428_107676402 155
50 3300028380 Ga0268265_10113880 Ga0268265_101138802 155
51 3300045051 Ga0451576_0070860 Ga0451576_0070860_24_491 155
52 3300050507 nmdc:mga05p37_199266_c1 nmdc:mga05p37_199266_c1_240_707 155
53 3300050510 nmdc:mga06r32_27335_c1 nmdc:mga06r32_27335_c1_3357_3824 155
54 3300050511 nmdc:mga08y16_60241_c1 nmdc:mga08y16_60241_c1_3369_3836 155
55 3300005544 Ga0070686_100082685 Ga0070686_1000826851 156
56 3300005549 Ga0070704_100709335 Ga0070704_1007093351 156
57 3300006852 Ga0075433_10003477 Ga0075433_100034778 156
58 3300006871 Ga0075434_100017803 Ga0075434_1000178034 156
59 3300009094 Ga0111539_10239267 Ga0111539_102392671 156
60 3300025922 Ga0207646_10092523 Ga0207646_100925233 156
61 3300045051 Ga0451576_0043368 Ga0451576_0043368_3889_4359 156
62 3300049584 Ga0501068_0368805 Ga0501068_0368805_105_575 156
63 3300050508 nmdc:mga09592_104331_c1 nmdc:mga09592_104331_c1_1193_1663 156
64 3300050512 nmdc:mga0n895_5605_c1 nmdc:mga0n895_5605_c1_9016_9486 156
65 3300050515 nmdc:mga0a205_10324_c1 nmdc:mga0a205_10324_c1_7773_8243 156
66 3300005334 Ga0068869_100512367 Ga0068869_1005123672 157
67 3300006881 Ga0068865_100044564 Ga0068865_1000445642 157
68 3300025938 Ga0207704_10122526 Ga0207704_101225261 157
69 3300045051 Ga0451576_0179329 Ga0451576_0179329_790_1263 157
70 3300005444 Ga0070694_100029304 Ga0070694_1000293042 158
71 3300005444 Ga0070694_100182198 Ga0070694_1001821982 158
72 3300005445 Ga0070708_100776683 Ga0070708_1007766832 158
73 3300005467 Ga0070706_100057568 Ga0070706_1000575682 158
74 3300005468 Ga0070707_100052389 Ga0070707_1000523892 158
75 3300005471 Ga0070698_100013976 Ga0070698_1000139763 158
76 3300005518 Ga0070699_100924235 Ga0070699_1009242351 158
77 3300005563 Ga0068855_101398204 Ga0068855_1013982041 158
78 3300005719 Ga0068861_100003689 Ga0068861_1000036892 158
79 3300005843 Ga0068860_102106279 Ga0068860_1021062791 158
80 3300006844 Ga0075428_100000473 Ga0075428_10000047333 158
81 3300006844 Ga0075428_100017512 Ga0075428_1000175124 158
82 3300006844 Ga0075428_100030230 Ga0075428_1000302302 158
83 3300006844 Ga0075428_100083375 Ga0075428_1000833754 158
84 3300006844 Ga0075428_100158011 Ga0075428_1001580113 158
85 3300006846 Ga0075430_100026118 Ga0075430_1000261185 158
86 3300006846 Ga0075430_100165880 Ga0075430_1001658802 158
87 3300006847 Ga0075431_100000715 Ga0075431_10000071512 158
88 3300006847 Ga0075431_100046215 Ga0075431_1000462153 158
89 3300006852 Ga0075433_10113684 Ga0075433_101136841 158
90 3300006871 Ga0075434_100216319 Ga0075434_1002163192 158
91 3300006871 Ga0075434_101160896 Ga0075434_1011608962 158
92 3300006871 Ga0075434_101292823 Ga0075434_1012928232 158
93 3300006880 Ga0075429_100029287 Ga0075429_1000292874 158
94 3300006880 Ga0075429_100359358 Ga0075429_1003593582 158
95 3300006880 Ga0075429_100871754 Ga0075429_1008717541 158
96 3300009094 Ga0111539_10245026 Ga0111539_102450262 158
97 3300009147 Ga0114129_10361798 Ga0114129_103617982 158
98 3300009147 Ga0114129_10676595 Ga0114129_106765952 158
99 3300009147 Ga0114129_10832274 Ga0114129_108322742 158
100 3300009148 Ga0105243_11840764 Ga0105243_118407642 158
101 3300010375 Ga0105239_12122968 Ga0105239_121229681 158
102 3300013308 Ga0157375_11060676 Ga0157375_110606762 158
103 3300025922 Ga0207646_10077263 Ga0207646_100772632 158
104 3300025923 Ga0207681_10438049 Ga0207681_104380492 158
105 3300026035 Ga0207703_10092638 Ga0207703_100926381 158
106 3300026118 Ga0207675_100001601 Ga0207675_10000160119 158
107 3300027717 Ga0209998_10015561 Ga0209998_100155613 158
108 3300028380 Ga0268265_10500594 Ga0268265_105005942 158
109 3300035118 Ga0373954_0111117 Ga0373954_0111117_551_1027 158
110 3300042125 Ga0450923_077331 Ga0450923_077331_160_651 158
111 3300045051 Ga0451576_0833238 Ga0451576_0833238_352_828 158
112 3300050507 nmdc:mga05p37_134647_c1 nmdc:mga05p37_134647_c1_1971_2462 158
113 3300050507 nmdc:mga05p37_291562_c1 nmdc:mga05p37_291562_c1_1413_1889 158
114 3300050507 nmdc:mga05p37_331864_c1 nmdc:mga05p37_331864_c1_1165_1641 158
115 3300050507 nmdc:mga05p37_656134_c1 nmdc:mga05p37_656134_c1_228_704 158
116 3300050508 nmdc:mga09592_13010_c1 nmdc:mga09592_13010_c1_3430_3906 158
117 3300050508 nmdc:mga09592_24771_c1 nmdc:mga09592_24771_c1_3160_3636 158
118 3300050508 nmdc:mga09592_328535_c1 nmdc:mga09592_328535_c1_219_710 158
119 3300050508 nmdc:mga09592_740146_c1 nmdc:mga09592_740146_c1_245_736 158
120 3300050509 nmdc:mga0qj67_88046_c1 nmdc:mga0qj67_88046_c1_1074_1550 158
121 3300050510 nmdc:mga06r32_18064_c1 nmdc:mga06r32_18064_c1_1196_1672 158
122 3300050510 nmdc:mga06r32_528821_c1 nmdc:mga06r32_528821_c1_191_667 158
123 3300050510 nmdc:mga06r32_70277_c1 nmdc:mga06r32_70277_c1_1969_2460 158
124 3300050511 nmdc:mga08y16_219324_c1 nmdc:mga08y16_219324_c1_629_1120 158
125 3300050512 nmdc:mga0n895_1572390_c1 nmdc:mga0n895_1572390_c1_61_600 158
126 3300050512 nmdc:mga0n895_273490_c1 nmdc:mga0n895_273490_c1_877_1353 158
127 3300050515 nmdc:mga0a205_199538_c1 nmdc:mga0a205_199538_c1_16_492 158
128 3300050515 nmdc:mga0a205_285293_c1 nmdc:mga0a205_285293_c1_854_1330 158
129 3300005330 Ga0070690_100046049 Ga0070690_1000460493 159
130 3300005334 Ga0068869_100378901 Ga0068869_1003789012 159
131 3300005338 Ga0068868_100140922 Ga0068868_1001409222 159
132 3300005340 Ga0070689_100000825 Ga0070689_1000008254 159
133 3300005340 Ga0070689_100002180 Ga0070689_1000021805 159
134 3300005340 Ga0070689_100024024 Ga0070689_1000240242 159
135 3300005340 Ga0070689_100058174 Ga0070689_1000581743 159
136 3300005340 Ga0070689_100850359 Ga0070689_1008503592 159
137 3300005343 Ga0070687_100015473 Ga0070687_1000154734 159
138 3300005354 Ga0070675_100251373 Ga0070675_1002513732 159
139 3300005364 Ga0070673_100580183 Ga0070673_1005801831 159
140 3300005365 Ga0070688_100000227 Ga0070688_1000002275 159
141 3300005365 Ga0070688_100003058 Ga0070688_1000030581 159
142 3300005365 Ga0070688_100017156 Ga0070688_1000171562 159
143 3300005365 Ga0070688_100031617 Ga0070688_1000316172 159
144 3300005365 Ga0070688_100090007 Ga0070688_1000900072 159
145 3300005365 Ga0070688_100472022 Ga0070688_1004720222 159
146 3300005406 Ga0070703_10044482 Ga0070703_100444821 159
147 3300005406 Ga0070703_10385184 Ga0070703_103851841 159
148 3300005434 Ga0070709_10022863 Ga0070709_100228633 159
149 3300005438 Ga0070701_10100550 Ga0070701_101005502 159
150 3300005438 Ga0070701_10220603 Ga0070701_102206032 159
151 3300005439 Ga0070711_100724487 Ga0070711_1007244871 159
152 3300005440 Ga0070705_100376137 Ga0070705_1003761372 159
153 3300005440 Ga0070705_100462277 Ga0070705_1004622771 159
154 3300005441 Ga0070700_100030610 Ga0070700_1000306102 159
155 3300005441 Ga0070700_100497509 Ga0070700_1004975091 159
156 3300005444 Ga0070694_100053854 Ga0070694_1000538542 159
157 3300005444 Ga0070694_100179438 Ga0070694_1001794382 159
158 3300005445 Ga0070708_100008590 Ga0070708_1000085902 159
159 3300005445 Ga0070708_100048423 Ga0070708_1000484233 159
160 3300005466 Ga0070685_10002293 Ga0070685_100022935 159
161 3300005466 Ga0070685_10296799 Ga0070685_102967991 159
162 3300005467 Ga0070706_100084524 Ga0070706_1000845243 159
163 3300005468 Ga0070707_100501336 Ga0070707_1005013362 159
164 3300005468 Ga0070707_100932964 Ga0070707_1009329641 159
165 3300005471 Ga0070698_100139102 Ga0070698_1001391021 159
166 3300005471 Ga0070698_101084455 Ga0070698_1010844551 159
167 3300005518 Ga0070699_100384610 Ga0070699_1003846102 159
168 3300005536 Ga0070697_100000373 Ga0070697_10000037322 159
169 3300005536 Ga0070697_100232541 Ga0070697_1002325412 159
170 3300005536 Ga0070697_101246419 Ga0070697_1012464191 159
171 3300005543 Ga0070672_100473118 Ga0070672_1004731182 159
172 3300005544 Ga0070686_100031310 Ga0070686_1000313103 159
173 3300005544 Ga0070686_100037856 Ga0070686_1000378562 159
174 3300005544 Ga0070686_100179901 Ga0070686_1001799011 159
175 3300005545 Ga0070695_100003074 Ga0070695_1000030742 159
176 3300005545 Ga0070695_100422821 Ga0070695_1004228211 159
177 3300005546 Ga0070696_100084284 Ga0070696_1000842842 159
178 3300005549 Ga0070704_100156360 Ga0070704_1001563602 159
179 3300005617 Ga0068859_100042702 Ga0068859_1000427025 159
180 3300005617 Ga0068859_100056698 Ga0068859_1000566983 159
181 3300005618 Ga0068864_100704499 Ga0068864_1007044992 159
182 3300005618 Ga0068864_101292751 Ga0068864_1012927511 159
183 3300005840 Ga0068870_10163487 Ga0068870_101634872 159
184 3300005841 Ga0068863_100111807 Ga0068863_1001118072 159
185 3300005844 Ga0068862_100189645 Ga0068862_1001896452 159
186 3300006175 Ga0070712_101012144 Ga0070712_1010121442 159
187 3300006844 Ga0075428_100210322 Ga0075428_1002103222 159
188 3300006852 Ga0075433_10000053 Ga0075433_100000536 159
189 3300006852 Ga0075433_10008729 Ga0075433_100087294 159
190 3300006852 Ga0075433_11196671 Ga0075433_111966712 159
191 3300006871 Ga0075434_100005601 Ga0075434_10000560110 159
192 3300006871 Ga0075434_100009408 Ga0075434_1000094082 159
193 3300006914 Ga0075436_100002172 Ga0075436_10000217211 159
194 3300006914 Ga0075436_100005797 Ga0075436_1000057975 159
195 3300006914 Ga0075436_100364543 Ga0075436_1003645431 159
196 3300006931 Ga0097620_100042702 Ga0097620_1000427025 159
197 3300006931 Ga0097620_100056696 Ga0097620_1000566963 159
198 3300007076 Ga0075435_100003701 Ga0075435_1000037013 159
199 3300007076 Ga0075435_100194381 Ga0075435_1001943812 159
200 3300007265 Ga0099794_10298603 Ga0099794_102986031 159
201 3300009094 Ga0111539_10017245 Ga0111539_100172453 159
202 3300009094 Ga0111539_10017373 Ga0111539_100173733 159
203 3300009094 Ga0111539_10703531 Ga0111539_107035312 159
204 3300009147 Ga0114129_10153742 Ga0114129_101537423 159
205 3300009147 Ga0114129_10582182 Ga0114129_105821822 159
206 3300009147 Ga0114129_10617638 Ga0114129_106176382 159
207 3300009147 Ga0114129_11031426 Ga0114129_110314262 159
208 3300009553 Ga0105249_12005537 Ga0105249_120055371 159
209 3300013297 Ga0157378_10968433 Ga0157378_109684331 159
210 3300014325 Ga0163163_10014049 Ga0163163_100140495 159
211 3300014326 Ga0157380_11008553 Ga0157380_110085532 159
212 3300025908 Ga0207643_10187249 Ga0207643_101872492 159
213 3300025916 Ga0207663_10737615 Ga0207663_107376151 159
214 3300025918 Ga0207662_10001142 Ga0207662_100011425 159
215 3300025922 Ga0207646_10185283 Ga0207646_101852832 159
216 3300025922 Ga0207646_10218972 Ga0207646_102189722 159
217 3300025926 Ga0207659_10143273 Ga0207659_101432732 159
218 3300025933 Ga0207706_11240790 Ga0207706_112407902 159
219 3300025936 Ga0207670_10000406 Ga0207670_100004065 159
220 3300025936 Ga0207670_10001228 Ga0207670_100012285 159
221 3300025936 Ga0207670_10002395 Ga0207670_100023952 159
222 3300025936 Ga0207670_10007565 Ga0207670_100075656 159
223 3300025936 Ga0207670_10010457 Ga0207670_100104576 159
224 3300025939 Ga0207665_10523378 Ga0207665_105233782 159
225 3300025942 Ga0207689_10285770 Ga0207689_102857702 159
226 3300026023 Ga0207677_10455864 Ga0207677_104558642 159
227 3300026075 Ga0207708_10023043 Ga0207708_100230433 159
228 3300026075 Ga0207708_10100985 Ga0207708_101009852 159
229 3300026088 Ga0207641_10054596 Ga0207641_100545961 159
230 3300026095 Ga0207676_10430130 Ga0207676_104301302 159
231 3300026095 Ga0207676_11821725 Ga0207676_118217251 159
232 3300026118 Ga0207675_100167334 Ga0207675_1001673341 159
233 3300027907 Ga0207428_10047387 Ga0207428_100473872 159
234 3300027907 Ga0207428_10265681 Ga0207428_102656812 159
235 3300028380 Ga0268265_10165001 Ga0268265_101650012 159
236 3300028380 Ga0268265_10205108 Ga0268265_102051082 159
237 3300035115 Ga0373941_0244942 Ga0373941_0244942_137_616 159
238 3300035117 Ga0373953_0160500 Ga0373953_0160500_340_819 159
239 3300035207 Ga0373942_0185901 Ga0373942_0185901_67_546 159
240 3300035724 Ga0373933_0306865 Ga0373933_0306865_370_849 159
241 3300036401 Ga0373937_0406119 Ga0373937_0406119_724_1203 159
242 3300042876 Ga0451577_0342825 Ga0451577_0342825_373_852 159
243 3300044673 Ga0453683_0463923 Ga0453683_0463923_282_794 159
244 3300045051 Ga0451576_0034670 Ga0451576_0034670_2494_2973 159
245 3300045051 Ga0451576_0297460 Ga0451576_0297460_285_764 159
246 3300045051 Ga0451576_0348403 Ga0451576_0348403_905_1384 159
247 3300045051 Ga0451576_0514484 Ga0451576_0514484_61_540 159
248 3300045051 Ga0451576_0839266 Ga0451576_0839266_50_529 159
249 3300046517 Ga0495630_0054179 Ga0495630_0054179_2120_2599 159
250 3300046517 Ga0495630_0447964 Ga0495630_0447964_168_647 159
251 3300046535 Ga0495586_0084325 Ga0495586_0084325_117_596 159
252 3300046689 Ga0495613_0658547 Ga0495613_0658547_154_633 159
253 3300046809 Ga0495600_0312485 Ga0495600_0312485_497_976 159
254 3300047322 Ga0495680_0158237 Ga0495680_0158237_800_1279 159
255 3300047471 Ga0495684_0398130 Ga0495684_0398130_21_500 159
256 3300050507 nmdc:mga05p37_1216858_c1 nmdc:mga05p37_1216858_c1_144_623 159
257 3300050507 nmdc:mga05p37_292230_c1 nmdc:mga05p37_292230_c1_264_743 159
258 3300050507 nmdc:mga05p37_463241_c1 nmdc:mga05p37_463241_c1_710_1192 159
259 3300050511 nmdc:mga08y16_447489_c1 nmdc:mga08y16_447489_c1_521_1000 159
260 3300050511 nmdc:mga08y16_49199_c1 nmdc:mga08y16_49199_c1_946_1425 159
261 3300050511 nmdc:mga08y16_699227_c1 nmdc:mga08y16_699227_c1_397_930 159
262 3300050512 nmdc:mga0n895_156367_c1 nmdc:mga0n895_156367_c1_939_1421 159
263 3300050512 nmdc:mga0n895_89_c1 nmdc:mga0n895_89_c1_28390_28872 159
264 3300050513 nmdc:mga0rr50_358_c1 nmdc:mga0rr50_358_c1_21856_22338 159
265 3300050514 nmdc:mga08x19_2964_c1 nmdc:mga08x19_2964_c1_2764_3246 159
266 3300050514 nmdc:mga08x19_38840_c1 nmdc:mga08x19_38840_c1_1017_1499 159
267 3300050514 nmdc:mga08x19_399386_c1 nmdc:mga08x19_399386_c1_437_916 159
268 3300050515 nmdc:mga0a205_25652_c1 nmdc:mga0a205_25652_c1_1637_2119 159
269 3300050515 nmdc:mga0a205_34_c1 nmdc:mga0a205_34_c1_24075_24557 159
270 3300060353 Ga0501082_0631877 Ga0501082_0631877_99_578 159
271 3300013297 Ga0157378_10028508 Ga0157378_100285082 160
272 3300025941 Ga0207711_10057194 Ga0207711_100571945 160
273 3300034820 Ga0373959_0068289 Ga0373959_0068289_49_531 160
274 3300035090 Ga0373949_0109194 Ga0373949_0109194_29_511 160
275 3300035170 Ga0373943_0598685 Ga0373943_0598685_34_516 160
276 3300042876 Ga0451577_0031013 Ga0451577_0031013_4322_4804 160
277 3300044712 Ga0453684_0251612 Ga0453684_0251612_706_1188 160
278 3300045051 Ga0451576_0349434 Ga0451576_0349434_802_1284 160
279 3300046514 Ga0495618_0417904 Ga0495618_0417904_230_712 160
280 3300046642 Ga0495634_0071013 Ga0495634_0071013_481_963 160
281 3300046683 Ga0495658_0348051 Ga0495658_0348051_367_849 160
282 3300045051 Ga0451576_0476311 Ga0451576_0476311_633_1118 161
283 3300005354 Ga0070675_100470472 Ga0070675_1004704722 162
284 3300005438 Ga0070701_10170765 Ga0070701_101707651 162
285 3300005545 Ga0070695_100005388 Ga0070695_1000053883 162
286 3300005719 Ga0068861_100381905 Ga0068861_1003819052 162
287 3300009147 Ga0114129_10005814 Ga0114129_100058148 162
288 3300014326 Ga0157380_10112970 Ga0157380_101129702 162
289 3300025926 Ga0207659_10413828 Ga0207659_104138282 162
290 3300050507 nmdc:mga05p37_46339_c1 nmdc:mga05p37_46339_c1_280_768 162
291 3300005549 Ga0070704_100038556 Ga0070704_1000385563 163
292 3300006844 Ga0075428_100031370 Ga0075428_1000313703 163
293 3300006846 Ga0075430_100294905 Ga0075430_1002949052 163
294 3300006852 Ga0075433_10074928 Ga0075433_100749282 163
295 3300006852 Ga0075433_10437417 Ga0075433_104374171 163
296 3300006871 Ga0075434_100562202 Ga0075434_1005622022 163
297 3300006871 Ga0075434_101074590 Ga0075434_1010745901 163
298 3300045051 Ga0451576_0819534 Ga0451576_0819534_96_587 163
299 3300050510 nmdc:mga06r32_1019779_c1 nmdc:mga06r32_1019779_c1_70_561 163
300 3300050512 nmdc:mga0n895_1053291_c1 nmdc:mga0n895_1053291_c1_73_564 163
301 3300050512 nmdc:mga0n895_258025_c1 nmdc:mga0n895_258025_c1_54_545 163
302 3300050512 nmdc:mga0n895_492859_c1 nmdc:mga0n895_492859_c1_669_1160 163
303 3300050513 nmdc:mga0rr50_213926_c1 nmdc:mga0rr50_213926_c1_629_1120 163
304 3300050515 nmdc:mga0a205_14208_c2 nmdc:mga0a205_14208_c2_460_951 163
305 3300050515 nmdc:mga0a205_143660_c1 nmdc:mga0a205_143660_c1_195_686 163
306 3300006844 Ga0075428_100005573 Ga0075428_1000055733 164
307 3300006847 Ga0075431_101531063 Ga0075431_1015310631 164
308 3300009094 Ga0111539_10024662 Ga0111539_100246623 164
309 3300046455 Ga0495603_0567112 Ga0495603_0567112_33_527 164
310 3300050510 nmdc:mga06r32_1348848_c1 nmdc:mga06r32_1348848_c1_121_615 164
311 3300050511 nmdc:mga08y16_363440_c1 nmdc:mga08y16_363440_c1_597_1091 164
312 3300005295 Ga0065707_10087732 Ga0065707_100877322 165
313 3300005295 Ga0065707_10185124 Ga0065707_101851242 165
314 3300005295 Ga0065707_10458934 Ga0065707_104589341 165
315 3300005340 Ga0070689_100240376 Ga0070689_1002403762 165
316 3300005471 Ga0070698_100147955 Ga0070698_1001479552 165
317 3300005518 Ga0070699_100000174 Ga0070699_1000001744 165
318 3300005549 Ga0070704_100033268 Ga0070704_1000332683 165
319 3300005617 Ga0068859_100002813 Ga0068859_10000281311 165
320 3300005841 Ga0068863_100539735 Ga0068863_1005397352 165
321 3300005842 Ga0068858_100163113 Ga0068858_1001631132 165
322 3300005843 Ga0068860_100171116 Ga0068860_1001711162 165
323 3300005843 Ga0068860_100604535 Ga0068860_1006045351 165
324 3300006844 Ga0075428_100028501 Ga0075428_1000285012 165
325 3300006844 Ga0075428_100066037 Ga0075428_1000660373 165
326 3300006844 Ga0075428_100091446 Ga0075428_1000914462 165
327 3300006847 Ga0075431_101033527 Ga0075431_1010335272 165
328 3300006852 Ga0075433_10013462 Ga0075433_100134627 165
329 3300006871 Ga0075434_100071236 Ga0075434_1000712362 165
330 3300006931 Ga0097620_100002813 Ga0097620_1000028137 165
331 3300007076 Ga0075435_100046594 Ga0075435_1000465944 165
332 3300009174 Ga0105241_11749099 Ga0105241_117490991 165
333 3300009177 Ga0105248_10483428 Ga0105248_104834282 165
334 3300014326 Ga0157380_10030795 Ga0157380_100307952 165
335 3300014326 Ga0157380_10088119 Ga0157380_100881192 165
336 3300025931 Ga0207644_10004172 Ga0207644_100041723 165
337 3300025936 Ga0207670_10237015 Ga0207670_102370152 165
338 3300026035 Ga0207703_10184777 Ga0207703_101847772 165
339 3300026088 Ga0207641_10235102 Ga0207641_102351022 165
340 3300036401 Ga0373937_0203789 Ga0373937_0203789_743_1240 165
341 3300044673 Ga0453683_0016107 Ga0453683_0016107_367_864 165
342 3300046455 Ga0495603_0399911 Ga0495603_0399911_81_578 165
343 3300046459 Ga0495629_0000719 Ga0495629_0000719_5699_6196 165
344 3300046459 Ga0495629_0007279 Ga0495629_0007279_4938_5435 165
345 3300046461 Ga0495641_0204788 Ga0495641_0204788_251_748 165
346 3300046472 Ga0495580_0369229 Ga0495580_0369229_453_950 165
347 3300046473 Ga0495582_0035236 Ga0495582_0035236_269_766 165
348 3300046475 Ga0495639_0037818 Ga0495639_0037818_968_1465 165
349 3300046475 Ga0495639_0045422 Ga0495639_0045422_138_635 165
350 3300046499 Ga0495594_0028105 Ga0495594_0028105_658_1155 165
351 3300046499 Ga0495594_0123680 Ga0495594_0123680_406_903 165
352 3300046526 Ga0495666_0073361 Ga0495666_0073361_1057_1554 165
353 3300046526 Ga0495666_0307873 Ga0495666_0307873_164_661 165
354 3300046557 Ga0495622_0292476 Ga0495622_0292476_94_591 165
355 3300046557 Ga0495622_0308087 Ga0495622_0308087_43_540 165
356 3300046663 Ga0495635_0028606 Ga0495635_0028606_1672_2169 165
357 3300046663 Ga0495635_0412335 Ga0495635_0412335_145_642 165
358 3300046681 Ga0495647_0000816 Ga0495647_0000816_2463_2960 165
359 3300046683 Ga0495658_0000263 Ga0495658_0000263_28611_29108 165
360 3300046689 Ga0495613_0002205 Ga0495613_0002205_8882_9379 165
361 3300047315 Ga0495581_0000788 Ga0495581_0000788_7242_7739 165
362 3300047315 Ga0495581_0172785 Ga0495581_0172785_591_1088 165
363 3300047321 Ga0495676_0020779 Ga0495676_0020779_3094_3591 165
364 3300047322 Ga0495680_0000064 Ga0495680_0000064_4707_5204 165
365 3300047322 Ga0495680_0067849 Ga0495680_0067849_1806_2303 165
366 3300048089 Ga0495614_0009257 Ga0495614_0009257_743_1240 165
367 3300048089 Ga0495614_0208683 Ga0495614_0208683_172_669 165
368 3300050512 nmdc:mga0n895_135063_c1 nmdc:mga0n895_135063_c1_1866_2363 165
369 3300050512 nmdc:mga0n895_91864_c1 nmdc:mga0n895_91864_c1_2514_3011 165
370 3300050513 nmdc:mga0rr50_78357_c1 nmdc:mga0rr50_78357_c1_1584_2081 165
371 3300050515 nmdc:mga0a205_21177_c1 nmdc:mga0a205_21177_c1_1140_1637 165
372 3300053085 Ga0495619_0001478 Ga0495619_0001478_7480_7977 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01590

GAF

GAF domain

39

168

0.89

PF13185

GAF_2

GAF domain

42

169

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mmn-assembly2.cif.gz_E structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum 0.9648 20 147
4mn7-assembly1.cif.gz_B structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum 0.9512 20 147
3mmh-assembly1.cif.gz_B x-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate 0.9158 3 155
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9133 1 147
3rfb-assembly1.cif.gz_A structure of frmsr 0.9034 3 147
ID Description Score Start End Superfamily
4mmnA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9475 20 152 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9108 3 147 3.30.450.40
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9034 3 147 3.30.450.40
4mmnA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8829 20 152 3.30.450.40
af_A0A1D8PPZ9_7_175_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8597 1 147 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A1F4X250-F1-model_v4 GAF domain-containing protein 0.9998 3 155
AF-A0A3N5QQ97-F1-model_v4 GAF domain-containing protein 0.996 1 151
AF-A0A538T5Y8-F1-model_v4 GAF domain-containing protein 0.9926 2 156
AF-A0A538T417-F1-model_v4 GAF domain-containing protein 0.9904 1 155
AF-A0A2V8TKF4-F1-model_v4 Diguanylate cyclase 0.9895 1 150

Feature Viewer

pLDDT pTM Quality
91.18 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map