F426144

General Info

Members Datasets Scaffolds Average Seq Length
372 219 744 150

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0002140|Ga0495672_0002140_12785_13300
Length 171
Sequence MMRAVLTFEGAATTKETTMSTTAGPTHRYVEPKGFDLAFNRFVAWLARRGIGVAGARVLAVRGRSSGEWRTIVLNPLALEGERYLVAPRGRTQWVRNLEAAGGGELRLGRRVEEFDATELPDAEKSPVIRAYLDAWGWEVGRFFDGLSKDSDDAEIAAVAPDFPVFRIIGG

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
87 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
88 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
89 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
148 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 98.12
Stem 0
Stem Tuber 0
Unclassified 21.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0002140 3300047320 Bacteria 18503
2 LJNas_1000225 3300000546 Bacteria 9702
3 LJNas_1000809 3300000546 Bacteria 5191
4 Ga0065715_10349781 3300005293 Bacteria 953
5 Ga0070683_100207061 3300005329 Bacteria 1863
6 Ga0070690_100041176 3300005330 Bacteria 2924
7 Ga0068869_100007625 3300005334 Bacteria 6928
8 Ga0068869_101272934 3300005334 Archaea 648
9 Ga0070680_100144978 3300005336 Bacteria 1992
10 Ga0070680_100982869 3300005336 Archaea 729
11 Ga0070682_100127221 3300005337 Bacteria 1719
12 Ga0068868_100036536 3300005338 Bacteria 3803
13 Ga0070660_100412733 3300005339 Bacteria 1117
14 Ga0070689_100083620 3300005340 Unclassified 2508
15 Ga0070691_10738535 3300005341 Unclassified 594
16 Ga0070661_101037135 3300005344 Unclassified 681
17 Ga0070671_100161795 3300005355 Bacteria 1892
18 Ga0070674_100218242 3300005356 Bacteria 1482
19 Ga0070673_100662084 3300005364 Bacteria 956
20 Ga0070673_101008465 3300005364 Bacteria 775
21 Ga0070659_100168242 3300005366 Bacteria 1794
22 Ga0070667_100803348 3300005367 Unclassified 873
23 Ga0070709_10014156 3300005434 Bacteria 4506
24 Ga0070709_10018916 3300005434 Unclassified 3974
25 Ga0070709_10036997 3300005434 Bacteria 2977
26 Ga0070709_10502233 3300005434 Unclassified 921
27 Ga0070714_100070075 3300005435 Bacteria 3030
28 Ga0070714_100118158 3300005435 Unclassified 2356
29 Ga0070714_100774878 3300005435 Bacteria 928
30 Ga0070713_100077583 3300005436 Bacteria 2825
31 Ga0070713_100081175 3300005436 Bacteria 2766
32 Ga0070713_101965674 3300005436 Unclassified 567
33 Ga0070711_100314370 3300005439 Bacteria 1249
34 Ga0070705_100009940 3300005440 Bacteria 4748
35 Ga0070694_100248612 3300005444 Bacteria 1344
36 Ga0070708_100308854 3300005445 Bacteria 1489
37 Ga0070708_100709741 3300005445 Unclassified 946
38 Ga0070708_100754377 3300005445 Unclassified 915
39 Ga0070662_100292309 3300005457 Bacteria 1321
40 Ga0070681_10277452 3300005458 Bacteria 1587
41 Ga0068867_100105738 3300005459 Bacteria 2155
42 Ga0070706_100008711 3300005467 Bacteria 9457
43 Ga0070706_100317384 3300005467 Bacteria 1453
44 Ga0070706_101509301 3300005467 Unclassified 614
45 Ga0070707_100001967 3300005468 Bacteria 19655
46 Ga0070707_100111969 3300005468 Unclassified 2647
47 Ga0070707_100117911 3300005468 Bacteria 2576
48 Ga0070707_100654819 3300005468 Bacteria 1013
49 Ga0070698_100003803 3300005471 Bacteria 16584
50 Ga0070698_100048409 3300005471 Bacteria 4343
51 Ga0070698_100725527 3300005471 Bacteria 936
52 Ga0070698_101186369 3300005471 Unclassified 713
53 Ga0070699_100015965 3300005518 Bacteria 6448
54 Ga0070699_100048349 3300005518 Unclassified 3681
55 Ga0070699_100063657 3300005518 Bacteria 3198
56 Ga0070699_100068761 3300005518 Bacteria 3077
57 Ga0070699_100168391 3300005518 Bacteria 1941
58 Ga0070699_100192686 3300005518 Bacteria 1811
59 Ga0070679_100543766 3300005530 Bacteria 1105
60 Ga0070684_100012153 3300005535 Bacteria 6886
61 Ga0070684_100094719 3300005535 Unclassified 2660
62 Ga0070697_100039773 3300005536 Bacteria 3803
63 Ga0070697_100074968 3300005536 Unclassified 2780
64 Ga0070697_100136732 3300005536 Bacteria 2058
65 Ga0068853_100130614 3300005539 Bacteria 2248
66 Ga0070696_100210426 3300005546 Bacteria 1455
67 Ga0070693_100138057 3300005547 Bacteria 1531
68 Ga0070693_100783068 3300005547 Unclassified 705
69 Ga0068855_100001344 3300005563 Bacteria 30457
70 Ga0068855_100391582 3300005563 Bacteria 1524
71 Ga0070664_100000740 3300005564 Bacteria 25178
72 Ga0068857_100000267 3300005577 Bacteria 35430
73 Ga0068854_100006172 3300005578 Bacteria 7607
74 Ga0068854_100120520 3300005578 Bacteria 1991
75 Ga0068856_100001308 3300005614 Bacteria 26215
76 Ga0068856_100001875 3300005614 Bacteria 21936
77 Ga0068856_100357009 3300005614 Bacteria 1480
78 Ga0070702_100165562 3300005615 Bacteria 1433
79 Ga0070702_100716512 3300005615 Unclassified 764
80 Ga0068852_100187072 3300005616 Bacteria 1951
81 Ga0068859_100000431 3300005617 Bacteria 42019
82 Ga0068859_100232178 3300005617 Bacteria 1933
83 Ga0068864_100022854 3300005618 Bacteria 5246
84 Ga0068864_100041973 3300005618 Unclassified 3914
85 Ga0068870_10294361 3300005840 Bacteria 1022
86 Ga0068863_100012967 3300005841 Bacteria 8037
87 Ga0068858_100001258 3300005842 Bacteria 26230
88 Ga0068858_100034064 3300005842 Bacteria 4724
89 Ga0068860_100007026 3300005843 Bacteria 11274
90 Ga0081540_1232442 3300005983 Bacteria 650
91 Ga0070717_10008561 3300006028 Bacteria 7641
92 Ga0070717_10118488 3300006028 Bacteria 2265
93 Ga0070717_10766499 3300006028 Bacteria 877
94 Ga0075432_10074366 3300006058 Bacteria 1224
95 Ga0070716_100138057 3300006173 Bacteria 1550
96 Ga0070712_100075426 3300006175 Bacteria 2425
97 Ga0070712_100196597 3300006175 Unclassified 1581
98 Ga0070712_100283063 3300006175 Bacteria 1336
99 Ga0070712_100363004 3300006175 Bacteria 1188
100 Ga0075427_10010807 3300006194 Unclassified 1371
101 Ga0097621_100000044 3300006237 Bacteria 65368
102 Ga0097621_100151895 3300006237 Bacteria 1986
103 Ga0068871_100000510 3300006358 Bacteria 26634
104 Ga0068871_100030554 3300006358 Unclassified 4243
105 Ga0068871_100788140 3300006358 Unclassified 875
106 Ga0075428_100702009 3300006844 Bacteria 1078
107 Ga0075428_101641683 3300006844 Bacteria 671
108 Ga0075430_100027986 3300006846 Bacteria 4788
109 Ga0075431_100243113 3300006847 Unclassified 1830
110 Ga0075431_100288852 3300006847 Bacteria 1659
111 Ga0075431_100960358 3300006847 Unclassified 823
112 Ga0075433_10000340 3300006852 Bacteria 29026
113 Ga0075433_10203817 3300006852 Bacteria 1758
114 Ga0075433_10232635 3300006852 Bacteria 1636
115 Ga0075433_10929214 3300006852 Bacteria 758
116 Ga0075434_100000683 3300006871 Bacteria 26422
117 Ga0075434_100161088 3300006871 Bacteria 2263
118 Ga0075434_100520642 3300006871 Bacteria 1209
119 Ga0075429_100002568 3300006880 Bacteria 15302
120 Ga0075429_100180786 3300006880 Unclassified 1848
121 Ga0068865_100004763 3300006881 Bacteria 8204
122 Ga0075436_100002463 3300006914 Bacteria 12739
123 Ga0075436_100003448 3300006914 Bacteria 10840
124 Ga0075436_100044648 3300006914 Unclassified 3056
125 Ga0075436_100532166 3300006914 Unclassified 862
126 Ga0097620_100000431 3300006931 Bacteria 42019
127 Ga0097620_100232165 3300006931 Bacteria 1933
128 Ga0075435_100016232 3300007076 Bacteria 5613
129 Ga0075435_100034611 3300007076 Bacteria 4004
130 Ga0075435_100034956 3300007076 Bacteria 3986
131 Ga0075435_100038138 3300007076 Bacteria 3830
132 Ga0075435_100099420 3300007076 Unclassified 2409
133 Ga0075435_100332905 3300007076 Bacteria 1300
134 Ga0099794_10011568 3300007265 Bacteria 3781
135 Ga0105240_10006579 3300009093 Bacteria 17062
136 Ga0105240_10477368 3300009093 Bacteria 1391
137 Ga0111539_10000304 3300009094 Bacteria 59789
138 Ga0114129_10003561 3300009147 Bacteria 21925
139 Ga0114129_10320198 3300009147 Bacteria 2062
140 Ga0114129_12027649 3300009147 Bacteria 695
141 Ga0114129_12749579 3300009147 Unclassified 586
142 Ga0105243_10752815 3300009148 Bacteria 955
143 Ga0105241_10044073 3300009174 Bacteria 3380
144 Ga0105248_10022221 3300009177 Bacteria 7034
145 Ga0105238_10062825 3300009551 Bacteria 3714
146 Ga0105238_10686246 3300009551 Bacteria 1036
147 Ga0105239_10102013 3300010375 Bacteria 3175
148 Ga0157371_10455577 3300013102 Bacteria 941
149 Ga0157369_10204446 3300013105 Bacteria 2072
150 Ga0157374_10000299 3300013296 Bacteria 45851
151 Ga0157378_10001436 3300013297 Bacteria 21459
152 Ga0157378_10263371 3300013297 Bacteria 1655
153 Ga0157372_10001884 3300013307 Bacteria 22743
154 Ga0163163_12240631 3300014325 Bacteria 605
155 Ga0213876_10398526 3300021384 Unclassified 732
156 Ga0224570_100734 3300022730 Unclassified 2619
157 Ga0224569_101151 3300022732 Unclassified 2244
158 Ga0224571_101804 3300022734 Bacteria 1347
159 Ga0224572_1025128 3300024225 Unclassified 1143
160 Ga0228598_1000663 3300024227 Bacteria 7243
161 Ga0228598_1022728 3300024227 Bacteria 1233
162 Ga0207699_10004630 3300025906 Bacteria 6578
163 Ga0207699_10031243 3300025906 Bacteria 2988
164 Ga0207699_10369051 3300025906 Bacteria 1017
165 Ga0207699_10496832 3300025906 Bacteria 880
166 Ga0207643_10279843 3300025908 Bacteria 1034
167 Ga0207684_10000343 3300025910 Bacteria 64775
168 Ga0207684_10010147 3300025910 Bacteria 8294
169 Ga0207684_10089450 3300025910 Bacteria 2623
170 Ga0207684_10113740 3300025910 Unclassified 2317
171 Ga0207684_10155318 3300025910 Bacteria 1969
172 Ga0207654_10171190 3300025911 Bacteria 1410
173 Ga0207707_10022765 3300025912 Bacteria 5479
174 Ga0207707_10309750 3300025912 Unclassified 1364
175 Ga0207695_10182951 3300025913 Unclassified 2016
176 Ga0207693_10051298 3300025915 Bacteria 3238
177 Ga0207693_10536372 3300025915 Bacteria 913
178 Ga0207663_10716831 3300025916 Bacteria 793
179 Ga0207663_10987123 3300025916 Unclassified 675
180 Ga0207660_10273017 3300025917 Unclassified 1340
181 Ga0207652_10466180 3300025921 Bacteria 1138
182 Ga0207646_10007940 3300025922 Bacteria 10709
183 Ga0207646_10030443 3300025922 Bacteria 4892
184 Ga0207646_10692932 3300025922 Bacteria 911
185 Ga0207681_10200292 3300025923 Bacteria 1533
186 Ga0207700_10223905 3300025928 Bacteria 1596
187 Ga0207700_10274629 3300025928 Bacteria 1447
188 Ga0207700_11646658 3300025928 Unclassified 567
189 Ga0207664_10076392 3300025929 Bacteria 2711
190 Ga0207664_10128571 3300025929 Unclassified 2130
191 Ga0207664_10173598 3300025929 Bacteria 1846
192 Ga0207644_10406824 3300025931 Unclassified 1113
193 Ga0207690_10077495 3300025932 Bacteria 2311
194 Ga0207690_11163758 3300025932 Unclassified 643
195 Ga0207706_10315265 3300025933 Bacteria 1361
196 Ga0207670_11620820 3300025936 Bacteria 550
197 Ga0207669_10172027 3300025937 Bacteria 1543
198 Ga0207704_10407607 3300025938 Bacteria 1074
199 Ga0207665_10003313 3300025939 Bacteria 10793
200 Ga0207711_10020228 3300025941 Bacteria 5546
201 Ga0207661_10033686 3300025944 Bacteria 3978
202 Ga0207661_10095520 3300025944 Bacteria 2485
203 Ga0207679_10057455 3300025945 Unclassified 2878
204 Ga0207667_10001953 3300025949 Bacteria 25835
205 Ga0207667_10016317 3300025949 Bacteria 8393
206 Ga0207651_10068297 3300025960 Bacteria 2505
207 Ga0207651_10077170 3300025960 Bacteria 2384
208 Ga0207712_10389553 3300025961 Bacteria 1168
209 Ga0207712_11748308 3300025961 Unclassified 557
210 Ga0207640_10009658 3300025981 Bacteria 5410
211 Ga0207658_10662536 3300025986 Bacteria 941
212 Ga0207677_10000805 3300026023 Bacteria 17988
213 Ga0207677_10022175 3300026023 Bacteria 3898
214 Ga0207703_10105629 3300026035 Bacteria 2394
215 Ga0207639_10163759 3300026041 Bacteria 1877
216 Ga0207708_10540450 3300026075 Bacteria 982
217 Ga0207702_10163042 3300026078 Bacteria 2037
218 Ga0207702_10477419 3300026078 Unclassified 1213
219 Ga0207641_10037399 3300026088 Bacteria 4053
220 Ga0207648_10008798 3300026089 Bacteria 9727
221 Ga0207648_10093796 3300026089 Unclassified 2625
222 Ga0207676_10024495 3300026095 Bacteria 4466
223 Ga0207674_10002441 3300026116 Bacteria 23476
224 Ga0207698_11589139 3300026142 Unclassified 669
225 Ga0209588_1062771 3300027671 Unclassified 1201
226 Ga0207428_10000009 3300027907 Bacteria 410565
227 Ga0265356_1001498 3300028017 Bacteria 3419
228 Ga0268264_10058013 3300028381 Bacteria 3240
229 Ga0268264_10148065 3300028381 Bacteria 2102
230 Ga0265338_10015316 3300028800 Bacteria 8437
231 Ga0265338_10047911 3300028800 Bacteria 3896
232 Ga0265338_10651995 3300028800 Bacteria 730
233 Ga0265762_1003364 3300030760 Bacteria 2863
234 Ga0265762_1008789 3300030760 Bacteria 1798
235 Ga0265760_10001620 3300031090 Bacteria 6612
236 Ga0265760_10013093 3300031090 Bacteria 2374
237 Ga0265760_10090128 3300031090 Bacteria 959
238 Ga0265340_10010056 3300031247 Bacteria 5066
239 Ga0265339_10092385 3300031249 Bacteria 1584
240 Ga0265339_10307842 3300031249 Bacteria 754
241 Ga0265316_10019396 3300031344 Bacteria 5819
242 Ga0316579_10052151 3300031691 Bacteria 1915
243 Ga0265314_10110865 3300031711 Bacteria 1744
244 Ga0265342_10048030 3300031712 Bacteria 2560
245 Ga0316576_10109966 3300031727 Bacteria 2065
246 Ga0316576_10251600 3300031727 Bacteria 1326
247 Ga0316578_10016652 3300031728 Bacteria 3983
248 Ga0316578_10043548 3300031728 Bacteria 2607
249 Ga0316577_10042622 3300031733 Bacteria 2539
250 Ga0307416_101063791 3300032002 Bacteria 913
251 Ga0316583_10231194 3300032133 Unclassified 641
252 Ga0316580_10016532 3300032139 Bacteria 2265
253 Ga0316580_10085352 3300032139 Bacteria 966
254 Ga0373926_0002728 3300035083 Bacteria 5631
255 Ga0373940_0075247 3300035088 Unclassified 989
256 Ga0373949_0056527 3300035090 Bacteria 1001
257 Ga0373923_0243861 3300035111 Unclassified 840
258 Ga0373923_0314425 3300035111 Unclassified 743
259 Ga0373936_0008909 3300035113 Bacteria 3783
260 Ga0373939_0006855 3300035114 Unclassified 2755
261 Ga0373939_0029038 3300035114 Bacteria 1579
262 Ga0373945_0092306 3300035116 Bacteria 1174
263 Ga0373943_0008881 3300035170 Bacteria 4502
264 Ga0373943_0061284 3300035170 Bacteria 1880
265 Ga0373946_0044957 3300035171 Unclassified 1825
266 Ga0373955_0013463 3300035172 Bacteria 3958
267 Ga0373942_0043504 3300035207 Unclassified 1234
268 Ga0373962_0053894 3300035242 Unclassified 1165
269 Ga0316574_0000784 3300035398 Bacteria 13746
270 Ga0373924_0536853 3300035410 Unclassified 526
271 Ga0373931_0017265 3300035691 Bacteria 3566
272 Ga0373931_0100245 3300035691 Unclassified 1628
273 Ga0373935_0013341 3300035692 Bacteria 4957
274 Ga0373935_0233126 3300035692 Bacteria 1283
275 Ga0373935_0624472 3300035692 Bacteria 789
276 Ga0373927_0017628 3300035695 Bacteria 4698
277 Ga0373933_0181632 3300035724 Archaea 1342
278 Ga0373947_0051458 3300035725 Bacteria 2478
279 Ga0373947_0319771 3300035725 Unclassified 1038
280 Ga0373937_0109288 3300036401 Bacteria 2571
281 Ga0316582_0060764 3300036647 Bacteria 2423
282 Ga0316582_0078225 3300036647 Bacteria 2154
283 Ga0316584_0003175 3300036712 Bacteria 10624
284 Ga0316584_0231165 3300036712 Bacteria 1355
285 Ga0373925_0004499 3300037068 Bacteria 10532
286 Ga0373925_0029621 3300037068 Bacteria 4016
287 Ga0373925_0170188 3300037068 Bacteria 1720
288 Ga0373925_0373708 3300037068 Bacteria 1160
289 Ga0436364_0496975 3300037853 Unclassified 647
290 Ga0395901_0649025 3300038443 Bacteria 1059
291 Ga0436365_1428873 3300039437 Unclassified 963
292 Ga0436365_1749526 3300039437 Bacteria 565
293 Ga0436363_0657380 3300039450 Bacteria 4401
294 Ga0436363_0771223 3300039450 Unclassified 1136
295 Ga0466966_0118504 3300044684 Bacteria 1628
296 Ga0466964_0053295 3300044706 Bacteria 1665
297 Ga0451576_0222872 3300045051 Bacteria 1969
298 Ga0466967_0595615 3300045976 Unclassified 1091
299 Ga0466967_0661873 3300045976 Unclassified 1033
300 Ga0495603_0389247 3300046455 Unclassified 799
301 Ga0495603_0491316 3300046455 Bacteria 703
302 Ga0495629_0005723 3300046459 Bacteria 9275
303 Ga0495580_0000108 3300046472 Bacteria 55508
304 Ga0495580_0000162 3300046472 Bacteria 49248
305 Ga0495580_0005525 3300046472 Bacteria 10437
306 Ga0495582_0002288 3300046473 Bacteria 10720
307 Ga0495582_0003774 3300046473 Bacteria 8540
308 Ga0495639_0019911 3300046475 Bacteria 2930
309 Ga0495666_0046081 3300046526 Bacteria 2103
310 Ga0495642_0158048 3300046528 Unclassified 982
311 Ga0495642_0293641 3300046528 Bacteria 712
312 Ga0495665_0002622 3300046531 Bacteria 9700
313 Ga0495665_0249459 3300046531 Unclassified 914
314 Ga0495640_0773418 3300046533 Unclassified 573
315 Ga0495646_0250151 3300046680 Unclassified 950
316 Ga0495658_0107691 3300046683 Bacteria 1672
317 Ga0495669_0334455 3300046684 Bacteria 731
318 Ga0495624_0251869 3300046690 Unclassified 1068
319 Ga0495581_0318315 3300047315 Unclassified 909
320 Ga0495581_0480909 3300047315 Unclassified 722
321 Ga0495684_0785656 3300047471 Unclassified 623
322 Ga0496104_0514462 3300048907 Bacteria 1108
323 Ga0501039_0425576 3300049575 Unclassified 1043
324 Ga0501040_0000998 3300049576 Bacteria 17905
325 Ga0501042_0977234 3300049578 Unclassified 617
326 Ga0501046_0091625 3300049580 Bacteria 2338
327 Ga0501067_0100996 3300049583 Bacteria 1603
328 Ga0501068_0299568 3300049584 Bacteria 1029
329 Ga0501068_0923366 3300049584 Unclassified 575
330 Ga0501072_0014873 3300049588 Bacteria 5965
331 Ga0501072_0782600 3300049588 Unclassified 748
332 Ga0501074_0507932 3300049590 Bacteria 854
333 Ga0501075_0324870 3300049591 Bacteria 1172
334 Ga0501076_0099163 3300049592 Bacteria 2347
335 Ga0501077_0018142 3300049593 Bacteria 4450
336 Ga0501077_0049516 3300049593 Bacteria 2670
337 Ga0501081_0033508 3300049743 Bacteria 3491
338 Ga0501081_1086750 3300049743 Bacteria 605
339 Ga0501045_0438497 3300049824 Bacteria 971
340 nmdc:mga05p37_17271_c1 3300050507 Bacteria 8704
341 nmdc:mga05p37_182_c1 3300050507 Bacteria 61525
342 nmdc:mga05p37_20618_c1 3300050507 Bacteria 7976
343 nmdc:mga05p37_293061_c1 3300050507 Bacteria 1936
344 nmdc:mga09592_15513_c1 3300050508 Bacteria 6228
345 nmdc:mga09592_9587_c1 3300050508 Bacteria 7866
346 nmdc:mga0qj67_2632_c1 3300050509 Bacteria 12859
347 nmdc:mga06r32_11107_c1 3300050510 Bacteria 8106
348 nmdc:mga08y16_35405_c1 3300050511 Bacteria 5243
349 nmdc:mga0n895_12025_c1 3300050512 Bacteria 7747
350 nmdc:mga0n895_1870978_c1 3300050512 Bacteria 560
351 nmdc:mga0n895_482593_c1 3300050512 Bacteria 1250
352 nmdc:mga0n895_59666_c1 3300050512 Bacteria 3764
353 nmdc:mga0n895_73392_c1 3300050512 Bacteria 3397
354 nmdc:mga0n895_7875_c1 3300050512 Bacteria 9187
355 nmdc:mga0rr50_182066_c1 3300050513 Bacteria 1718
356 nmdc:mga0rr50_208040_c1 3300050513 Bacteria 1611
357 nmdc:mga0rr50_345977_c1 3300050513 Bacteria 1250
358 nmdc:mga0rr50_4259_c1 3300050513 Bacteria 8376
359 nmdc:mga0rr50_640354_c1 3300050513 Unclassified 907
360 nmdc:mga0rr50_6532_c1 3300050513 Bacteria 7111
361 nmdc:mga0rr50_71469_c1 3300050513 Bacteria 2648
362 nmdc:mga08x19_282948_c1 3300050514 Bacteria 1149
363 nmdc:mga08x19_3234_c1 3300050514 Bacteria 9764
364 nmdc:mga08x19_6778_c1 3300050514 Bacteria 6802
365 nmdc:mga08x19_779471_c1 3300050514 Bacteria 679
366 nmdc:mga0a205_156392_c1 3300050515 Bacteria 2178
367 nmdc:mga0a205_222903_c1 3300050515 Bacteria 1771
368 nmdc:mga0a205_241_c1 3300050515 Bacteria 38813
369 nmdc:mga0a205_329120_c1 3300050515 Bacteria 1398
370 Ga0501084_0130597 3300054114 Bacteria 2115
371 Ga0501084_0706548 3300054114 Unclassified 850
372 Ga0590071_009831 3300059421 Bacteria 2243
373 Ga0495672_0002140
374 LJNas_1000225
375 LJNas_1000809
376 Ga0065715_10349781
377 Ga0070683_100207061
378 Ga0070690_100041176
379 Ga0068869_100007625
380 Ga0068869_101272934
381 Ga0070680_100144978
382 Ga0070680_100982869
383 Ga0070682_100127221
384 Ga0068868_100036536
385 Ga0070660_100412733
386 Ga0070689_100083620
387 Ga0070691_10738535
388 Ga0070661_101037135
389 Ga0070671_100161795
390 Ga0070674_100218242
391 Ga0070673_100662084
392 Ga0070673_101008465
393 Ga0070659_100168242
394 Ga0070667_100803348
395 Ga0070709_10014156
396 Ga0070709_10018916
397 Ga0070709_10036997
398 Ga0070709_10502233
399 Ga0070714_100070075
400 Ga0070714_100118158
401 Ga0070714_100774878
402 Ga0070713_100077583
403 Ga0070713_100081175
404 Ga0070713_101965674
405 Ga0070711_100314370
406 Ga0070705_100009940
407 Ga0070694_100248612
408 Ga0070708_100308854
409 Ga0070708_100709741
410 Ga0070708_100754377
411 Ga0070662_100292309
412 Ga0070681_10277452
413 Ga0068867_100105738
414 Ga0070706_100008711
415 Ga0070706_100317384
416 Ga0070706_101509301
417 Ga0070707_100001967
418 Ga0070707_100111969
419 Ga0070707_100117911
420 Ga0070707_100654819
421 Ga0070698_100003803
422 Ga0070698_100048409
423 Ga0070698_100725527
424 Ga0070698_101186369
425 Ga0070699_100015965
426 Ga0070699_100048349
427 Ga0070699_100063657
428 Ga0070699_100068761
429 Ga0070699_100168391
430 Ga0070699_100192686
431 Ga0070679_100543766
432 Ga0070684_100012153
433 Ga0070684_100094719
434 Ga0070697_100039773
435 Ga0070697_100074968
436 Ga0070697_100136732
437 Ga0068853_100130614
438 Ga0070696_100210426
439 Ga0070693_100138057
440 Ga0070693_100783068
441 Ga0068855_100001344
442 Ga0068855_100391582
443 Ga0070664_100000740
444 Ga0068857_100000267
445 Ga0068854_100006172
446 Ga0068854_100120520
447 Ga0068856_100001308
448 Ga0068856_100001875
449 Ga0068856_100357009
450 Ga0070702_100165562
451 Ga0070702_100716512
452 Ga0068852_100187072
453 Ga0068859_100000431
454 Ga0068859_100232178
455 Ga0068864_100022854
456 Ga0068864_100041973
457 Ga0068870_10294361
458 Ga0068863_100012967
459 Ga0068858_100001258
460 Ga0068858_100034064
461 Ga0068860_100007026
462 Ga0081540_1232442
463 Ga0070717_10008561
464 Ga0070717_10118488
465 Ga0070717_10766499
466 Ga0075432_10074366
467 Ga0070716_100138057
468 Ga0070712_100075426
469 Ga0070712_100196597
470 Ga0070712_100283063
471 Ga0070712_100363004
472 Ga0075427_10010807
473 Ga0097621_100000044
474 Ga0097621_100151895
475 Ga0068871_100000510
476 Ga0068871_100030554
477 Ga0068871_100788140
478 Ga0075428_100702009
479 Ga0075428_101641683
480 Ga0075430_100027986
481 Ga0075431_100243113
482 Ga0075431_100288852
483 Ga0075431_100960358
484 Ga0075433_10000340
485 Ga0075433_10203817
486 Ga0075433_10232635
487 Ga0075433_10929214
488 Ga0075434_100000683
489 Ga0075434_100161088
490 Ga0075434_100520642
491 Ga0075429_100002568
492 Ga0075429_100180786
493 Ga0068865_100004763
494 Ga0075436_100002463
495 Ga0075436_100003448
496 Ga0075436_100044648
497 Ga0075436_100532166
498 Ga0097620_100000431
499 Ga0097620_100232165
500 Ga0075435_100016232
501 Ga0075435_100034611
502 Ga0075435_100034956
503 Ga0075435_100038138
504 Ga0075435_100099420
505 Ga0075435_100332905
506 Ga0099794_10011568
507 Ga0105240_10006579
508 Ga0105240_10477368
509 Ga0111539_10000304
510 Ga0114129_10003561
511 Ga0114129_10320198
512 Ga0114129_12027649
513 Ga0114129_12749579
514 Ga0105243_10752815
515 Ga0105241_10044073
516 Ga0105248_10022221
517 Ga0105238_10062825
518 Ga0105238_10686246
519 Ga0105239_10102013
520 Ga0157371_10455577
521 Ga0157369_10204446
522 Ga0157374_10000299
523 Ga0157378_10001436
524 Ga0157378_10263371
525 Ga0157372_10001884
526 Ga0163163_12240631
527 Ga0213876_10398526
528 Ga0224570_100734
529 Ga0224569_101151
530 Ga0224571_101804
531 Ga0224572_1025128
532 Ga0228598_1000663
533 Ga0228598_1022728
534 Ga0207699_10004630
535 Ga0207699_10031243
536 Ga0207699_10369051
537 Ga0207699_10496832
538 Ga0207643_10279843
539 Ga0207684_10000343
540 Ga0207684_10010147
541 Ga0207684_10089450
542 Ga0207684_10113740
543 Ga0207684_10155318
544 Ga0207654_10171190
545 Ga0207707_10022765
546 Ga0207707_10309750
547 Ga0207695_10182951
548 Ga0207693_10051298
549 Ga0207693_10536372
550 Ga0207663_10716831
551 Ga0207663_10987123
552 Ga0207660_10273017
553 Ga0207652_10466180
554 Ga0207646_10007940
555 Ga0207646_10030443
556 Ga0207646_10692932
557 Ga0207681_10200292
558 Ga0207700_10223905
559 Ga0207700_10274629
560 Ga0207700_11646658
561 Ga0207664_10076392
562 Ga0207664_10128571
563 Ga0207664_10173598
564 Ga0207644_10406824
565 Ga0207690_10077495
566 Ga0207690_11163758
567 Ga0207706_10315265
568 Ga0207670_11620820
569 Ga0207669_10172027
570 Ga0207704_10407607
571 Ga0207665_10003313
572 Ga0207711_10020228
573 Ga0207661_10033686
574 Ga0207661_10095520
575 Ga0207679_10057455
576 Ga0207667_10001953
577 Ga0207667_10016317
578 Ga0207651_10068297
579 Ga0207651_10077170
580 Ga0207712_10389553
581 Ga0207712_11748308
582 Ga0207640_10009658
583 Ga0207658_10662536
584 Ga0207677_10000805
585 Ga0207677_10022175
586 Ga0207703_10105629
587 Ga0207639_10163759
588 Ga0207708_10540450
589 Ga0207702_10163042
590 Ga0207702_10477419
591 Ga0207641_10037399
592 Ga0207648_10008798
593 Ga0207648_10093796
594 Ga0207676_10024495
595 Ga0207674_10002441
596 Ga0207698_11589139
597 Ga0209588_1062771
598 Ga0207428_10000009
599 Ga0265356_1001498
600 Ga0268264_10058013
601 Ga0268264_10148065
602 Ga0265338_10015316
603 Ga0265338_10047911
604 Ga0265338_10651995
605 Ga0265762_1003364
606 Ga0265762_1008789
607 Ga0265760_10001620
608 Ga0265760_10013093
609 Ga0265760_10090128
610 Ga0265340_10010056
611 Ga0265339_10092385
612 Ga0265339_10307842
613 Ga0265316_10019396
614 Ga0316579_10052151
615 Ga0265314_10110865
616 Ga0265342_10048030
617 Ga0316576_10109966
618 Ga0316576_10251600
619 Ga0316578_10016652
620 Ga0316578_10043548
621 Ga0316577_10042622
622 Ga0307416_101063791
623 Ga0316583_10231194
624 Ga0316580_10016532
625 Ga0316580_10085352
626 Ga0373926_0002728
627 Ga0373940_0075247
628 Ga0373949_0056527
629 Ga0373923_0243861
630 Ga0373923_0314425
631 Ga0373936_0008909
632 Ga0373939_0006855
633 Ga0373939_0029038
634 Ga0373945_0092306
635 Ga0373943_0008881
636 Ga0373943_0061284
637 Ga0373946_0044957
638 Ga0373955_0013463
639 Ga0373942_0043504
640 Ga0373962_0053894
641 Ga0316574_0000784
642 Ga0373924_0536853
643 Ga0373931_0017265
644 Ga0373931_0100245
645 Ga0373935_0013341
646 Ga0373935_0233126
647 Ga0373935_0624472
648 Ga0373927_0017628
649 Ga0373933_0181632
650 Ga0373947_0051458
651 Ga0373947_0319771
652 Ga0373937_0109288
653 Ga0316582_0060764
654 Ga0316582_0078225
655 Ga0316584_0003175
656 Ga0316584_0231165
657 Ga0373925_0004499
658 Ga0373925_0029621
659 Ga0373925_0170188
660 Ga0373925_0373708
661 Ga0436364_0496975
662 Ga0395901_0649025
663 Ga0436365_1428873
664 Ga0436365_1749526
665 Ga0436363_0657380
666 Ga0436363_0771223
667 Ga0466966_0118504
668 Ga0466964_0053295
669 Ga0451576_0222872
670 Ga0466967_0595615
671 Ga0466967_0661873
672 Ga0495603_0389247
673 Ga0495603_0491316
674 Ga0495629_0005723
675 Ga0495580_0000108
676 Ga0495580_0000162
677 Ga0495580_0005525
678 Ga0495582_0002288
679 Ga0495582_0003774
680 Ga0495639_0019911
681 Ga0495666_0046081
682 Ga0495642_0158048
683 Ga0495642_0293641
684 Ga0495665_0002622
685 Ga0495665_0249459
686 Ga0495640_0773418
687 Ga0495646_0250151
688 Ga0495658_0107691
689 Ga0495669_0334455
690 Ga0495624_0251869
691 Ga0495581_0318315
692 Ga0495581_0480909
693 Ga0495684_0785656
694 Ga0496104_0514462
695 Ga0501039_0425576
696 Ga0501040_0000998
697 Ga0501042_0977234
698 Ga0501046_0091625
699 Ga0501067_0100996
700 Ga0501068_0299568
701 Ga0501068_0923366
702 Ga0501072_0014873
703 Ga0501072_0782600
704 Ga0501074_0507932
705 Ga0501075_0324870
706 Ga0501076_0099163
707 Ga0501077_0018142
708 Ga0501077_0049516
709 Ga0501081_0033508
710 Ga0501081_1086750
711 Ga0501045_0438497
712 nmdc:mga05p37_17271_c1
713 nmdc:mga05p37_182_c1
714 nmdc:mga05p37_20618_c1
715 nmdc:mga05p37_293061_c1
716 nmdc:mga09592_15513_c1
717 nmdc:mga09592_9587_c1
718 nmdc:mga0qj67_2632_c1
719 nmdc:mga06r32_11107_c1
720 nmdc:mga08y16_35405_c1
721 nmdc:mga0n895_12025_c1
722 nmdc:mga0n895_1870978_c1
723 nmdc:mga0n895_482593_c1
724 nmdc:mga0n895_59666_c1
725 nmdc:mga0n895_73392_c1
726 nmdc:mga0n895_7875_c1
727 nmdc:mga0rr50_182066_c1
728 nmdc:mga0rr50_208040_c1
729 nmdc:mga0rr50_345977_c1
730 nmdc:mga0rr50_4259_c1
731 nmdc:mga0rr50_640354_c1
732 nmdc:mga0rr50_6532_c1
733 nmdc:mga0rr50_71469_c1
734 nmdc:mga08x19_282948_c1
735 nmdc:mga08x19_3234_c1
736 nmdc:mga08x19_6778_c1
737 nmdc:mga08x19_779471_c1
738 nmdc:mga0a205_156392_c1
739 nmdc:mga0a205_222903_c1
740 nmdc:mga0a205_241_c1
741 nmdc:mga0a205_329120_c1
742 Ga0501084_0130597
743 Ga0501084_0706548
744 Ga0590071_009831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

39

137

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ptf-assembly1.cif.gz_A crystal structure of protein mth_863 from methanobacterium thermoautotrophicum bound to fmn 0.773 34 85
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7654 35 146
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7281 35 146
7jjb-assembly1.cif.gz_A crystal structure of zn(ii)-bound zint-like domain of streptococcus pneumoniae adca 0.7002 81 100
3h96-assembly2.cif.gz_B msmeg_3358 f420 reductase 0.6971 20 149
ID Description Score Start End Superfamily
af_P95144_3_116_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7976 33 95 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7292 29 149 2.30.110.10
af_P9WP13_9_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7203 16 149 2.30.110.10
3r5pA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7176 31 146 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7126 29 149 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1Q7PH71-F1-model_v4 Nitroreductase 0.9937 18 149 GO:0016491
AF-A0A2V9V939-F1-model_v4 Nitroreductase 0.9899 41 149
AF-A0A534UJU4-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9813 8 149 GO:0016020
GO:0016491
AF-A0A2V9V939-F1-model_v4 Nitroreductase 0.9809 41 149
AF-A0A2V9TUJ5-F1-model_v4 Nitroreductase 0.9778 29 115 GO:0016491

Map