F426118

General Info

Members Datasets Scaffolds Average Seq Length
372 164 744 294

Family's Representative Sequence

Representative Sequence 3300042993|Ga0439440_0020252|Ga0439440_0020252_508_1428
Length 306
Sequence MRHGFLREGDPVNVDAFIEAERAQQRTVTRACELLEVSRAAYYARRTGNVSARQRTDAGLTEHIRQAHQTSKGRYGAPRIHAQLRRQGHRHGRKRIARLMRAAGLHGRTPRRWKRTTIPDPQAAQRADLIRRDFAVNAAAVNTRWCGDITYIPTWEGWLYLATVIDIASRRVVGFALADHLRTDLVADALTNAVAARDPAPGVIFHADRGCQYTSHDYSKLAGDLEVALSSGRTGQCWDNALAESFFASLKGECLDQQPWPTRAAARHATVEYIGWYNGTRLHSALGYQTPDEFEAIHEEVITQAA

Samples

Sample ID Description Type Environment
1 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
29 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
81 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
82 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
83 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
84 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
87 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
88 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
89 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
90 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
91 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
92 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
93 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
94 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
95 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
96 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
97 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
98 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439440_0020252 3300042993 Bacteria 1490
2 JGI25407J50210_10029027 3300003373 Bacteria 1434
3 JGI25407J50210_10030246 3300003373 Bacteria 1404
4 JGI25407J50210_10032445 3300003373 Bacteria 1351
5 JGI25407J50210_10058111 3300003373 Bacteria 974
6 Ga0070714_100570801 3300005435 Bacteria 1084
7 Ga0070707_100120133 3300005468 Bacteria 2551
8 Ga0070698_100406841 3300005471 Bacteria 1294
9 Ga0070665_100357886 3300005548 Bacteria 1465
10 Ga0070664_100118811 3300005564 Bacteria 2313
11 Ga0068856_100373099 3300005614 Bacteria 1446
12 Ga0068866_10026303 3300005718 Bacteria 2746
13 Ga0068861_100243180 3300005719 Bacteria 1532
14 Ga0081455_10054992 3300005937 Bacteria 3389
15 Ga0081455_10133971 3300005937 Bacteria 1933
16 Ga0081538_10005203 3300005981 Bacteria 11767
17 Ga0081538_10022607 3300005981 Bacteria 4552
18 Ga0081538_10025292 3300005981 Bacteria 4192
19 Ga0081538_10044071 3300005981 Bacteria 2789
20 Ga0081538_10046993 3300005981 Bacteria 2653
21 Ga0081538_10058000 3300005981 Bacteria 2250
22 Ga0081538_10076442 3300005981 Bacteria 1810
23 Ga0081538_10089563 3300005981 Bacteria 1597
24 Ga0081538_10101832 3300005981 Bacteria 1444
25 Ga0081538_10107824 3300005981 Bacteria 1378
26 Ga0081538_10125478 3300005981 Bacteria 1221
27 Ga0081539_10001327 3300005985 Bacteria 43146
28 Ga0081539_10002921 3300005985 Bacteria 22550
29 Ga0081539_10059460 3300005985 Bacteria 2104
30 Ga0070717_10491638 3300006028 Bacteria 1108
31 Ga0075432_10003447 3300006058 Bacteria 5351
32 Ga0075427_10010484 3300006194 Bacteria 1388
33 Ga0075428_100373702 3300006844 Bacteria 1528
34 Ga0075430_100300165 3300006846 Bacteria 1328
35 Ga0075433_10039926 3300006852 Bacteria 4060
36 Ga0075433_10058793 3300006852 Bacteria 3363
37 Ga0075434_100170198 3300006871 Bacteria 2198
38 Ga0075434_100328313 3300006871 Bacteria 1550
39 Ga0075429_100048814 3300006880 Bacteria 3680
40 Ga0111539_10439215 3300009094 Bacteria 1520
41 Ga0114129_10652699 3300009147 Bacteria 1358
42 Ga0114129_10690839 3300009147 Bacteria 1312
43 Ga0105237_10061591 3300009545 Bacteria 3752
44 Ga0105237_10288470 3300009545 Bacteria 1644
45 Ga0105239_10002129 3300010375 Bacteria 25505
46 Ga0157369_10132544 3300013105 Bacteria 2640
47 Ga0157374_10481423 3300013296 Bacteria 1244
48 Ga0157377_10098620 3300014745 Bacteria 1737
49 Ga0157377_10156896 3300014745 Bacteria 1412
50 Ga0213874_10048523 3300021377 Bacteria 1295
51 Ga0213875_10102997 3300021388 Bacteria 1332
52 Ga0228598_1033076 3300024227 Bacteria 1019
53 Ga0207699_10156102 3300025906 Bacteria 1515
54 Ga0207684_10315691 3300025910 Bacteria 1347
55 Ga0207654_10008544 3300025911 Bacteria 5185
56 Ga0207671_10005914 3300025914 Bacteria 11095
57 Ga0207663_10405163 3300025916 Bacteria 1044
58 Ga0207646_10032470 3300025922 Bacteria 4725
59 Ga0207659_10123137 3300025926 Bacteria 1990
60 Ga0207700_10003843 3300025928 Bacteria 8777
61 Ga0207664_10268355 3300025929 Bacteria 1494
62 Ga0207702_10022526 3300026078 Bacteria 5222
63 Ga0207641_10327471 3300026088 Bacteria 1454
64 Ga0207675_100299940 3300026118 Bacteria 1565
65 Ga0209966_1017148 3300027695 Bacteria 1377
66 Ga0207428_10124722 3300027907 Bacteria 1973
67 Ga0268266_10491942 3300028379 Bacteria 1170
68 Ga0265319_1006084 3300028563 Bacteria 5655
69 Ga0265334_10059760 3300028573 Bacteria 1439
70 Ga0265322_10033055 3300028654 Bacteria 1475
71 Ga0265338_10207379 3300028800 Bacteria 1473
72 Ga0265324_10077049 3300029957 Bacteria 1135
73 Ga0265324_10106680 3300029957 Bacteria 951
74 Ga0265332_10081790 3300031238 Bacteria 1369
75 Ga0265332_10124906 3300031238 Bacteria 1080
76 Ga0265340_10147991 3300031247 Bacteria 1071
77 Ga0265340_10153188 3300031247 Bacteria 1049
78 Ga0265316_10071794 3300031344 Bacteria 2668
79 Ga0307408_100115806 3300031548 Bacteria 2067
80 Ga0307408_100176568 3300031548 Bacteria 1709
81 Ga0307408_100209518 3300031548 Bacteria 1583
82 Ga0307408_100244398 3300031548 Bacteria 1477
83 Ga0307408_100291243 3300031548 Bacteria 1363
84 Ga0307408_100305902 3300031548 Bacteria 1333
85 Ga0265314_10020875 3300031711 Bacteria 5049
86 Ga0265342_10089484 3300031712 Bacteria 1766
87 Ga0307405_10004088 3300031731 Bacteria 6853
88 Ga0307405_10059576 3300031731 Bacteria 2406
89 Ga0307405_10189066 3300031731 Bacteria 1485
90 Ga0307405_10210689 3300031731 Bacteria 1418
91 Ga0307405_10233870 3300031731 Bacteria 1356
92 Ga0307405_10239281 3300031731 Bacteria 1343
93 Ga0307405_10436512 3300031731 Bacteria 1034
94 Ga0307413_10074385 3300031824 Bacteria 2151
95 Ga0307413_10103105 3300031824 Bacteria 1890
96 Ga0307413_10186888 3300031824 Bacteria 1483
97 Ga0307413_10222947 3300031824 Bacteria 1378
98 Ga0307413_10273762 3300031824 Bacteria 1265
99 Ga0307413_10339008 3300031824 Bacteria 1155
100 Ga0307410_10001822 3300031852 Bacteria 9904
101 Ga0307410_10071678 3300031852 Bacteria 2403
102 Ga0307410_10165213 3300031852 Bacteria 1662
103 Ga0307410_10236852 3300031852 Bacteria 1412
104 Ga0307410_10237621 3300031852 Bacteria 1410
105 Ga0307410_10253348 3300031852 Bacteria 1369
106 Ga0307410_10269356 3300031852 Bacteria 1331
107 Ga0307410_10348601 3300031852 Bacteria 1182
108 Ga0307406_10072710 3300031901 Bacteria 2258
109 Ga0307406_10163131 3300031901 Bacteria 1604
110 Ga0307406_10177251 3300031901 Bacteria 1548
111 Ga0307406_10211662 3300031901 Bacteria 1434
112 Ga0307406_10216220 3300031901 Bacteria 1421
113 Ga0307406_10222207 3300031901 Bacteria 1404
114 Ga0307406_10228669 3300031901 Bacteria 1387
115 Ga0307407_10167595 3300031903 Bacteria 1443
116 Ga0307407_10243297 3300031903 Bacteria 1228
117 Ga0307407_10314544 3300031903 Bacteria 1096
118 Ga0307407_10345842 3300031903 Bacteria 1051
119 Ga0307407_10375537 3300031903 Bacteria 1013
120 Ga0307412_10188507 3300031911 Bacteria 1557
121 Ga0307412_10269554 3300031911 Bacteria 1331
122 Ga0307412_10293653 3300031911 Bacteria 1281
123 Ga0307412_10463939 3300031911 Bacteria 1046
124 Ga0307409_100109317 3300031995 Bacteria 2314
125 Ga0307409_100158091 3300031995 Bacteria 1978
126 Ga0307409_100333892 3300031995 Bacteria 1423
127 Ga0307409_100345161 3300031995 Bacteria 1402
128 Ga0307409_100348485 3300031995 Bacteria 1396
129 Ga0307409_100365956 3300031995 Bacteria 1365
130 Ga0307409_100369818 3300031995 Bacteria 1359
131 Ga0307409_100541101 3300031995 Bacteria 1141
132 Ga0307409_100587805 3300031995 Bacteria 1098
133 Ga0307416_100048149 3300032002 Bacteria 3379
134 Ga0307416_100070995 3300032002 Bacteria 2890
135 Ga0307416_100232199 3300032002 Bacteria 1779
136 Ga0307416_100284110 3300032002 Bacteria 1633
137 Ga0307416_100335096 3300032002 Bacteria 1522
138 Ga0307416_100386919 3300032002 Bacteria 1431
139 Ga0307416_100429020 3300032002 Bacteria 1368
140 Ga0307416_100434800 3300032002 Bacteria 1360
141 Ga0307416_100435451 3300032002 Bacteria 1359
142 Ga0307416_100450389 3300032002 Bacteria 1339
143 Ga0307416_100635070 3300032002 Bacteria 1151
144 Ga0307414_10058716 3300032004 Bacteria 2712
145 Ga0307414_10139076 3300032004 Bacteria 1898
146 Ga0307414_10251057 3300032004 Bacteria 1470
147 Ga0307414_10278467 3300032004 Bacteria 1404
148 Ga0307414_10304084 3300032004 Bacteria 1350
149 Ga0307414_10307818 3300032004 Bacteria 1343
150 Ga0307414_10414336 3300032004 Bacteria 1173
151 Ga0307414_10418960 3300032004 Bacteria 1167
152 Ga0307411_10051251 3300032005 Bacteria 2692
153 Ga0307411_10179995 3300032005 Bacteria 1603
154 Ga0307411_10182393 3300032005 Bacteria 1594
155 Ga0307411_10241839 3300032005 Bacteria 1413
156 Ga0307411_10259879 3300032005 Bacteria 1370
157 Ga0307411_10263372 3300032005 Bacteria 1362
158 Ga0307411_10337982 3300032005 Bacteria 1222
159 Ga0307415_100007582 3300032126 Bacteria 5945
160 Ga0307415_100043544 3300032126 Bacteria 2995
161 Ga0307415_100044020 3300032126 Bacteria 2981
162 Ga0307415_100091000 3300032126 Bacteria 2208
163 Ga0307415_100150162 3300032126 Bacteria 1792
164 Ga0307415_100194240 3300032126 Bacteria 1604
165 Ga0307415_100225453 3300032126 Bacteria 1505
166 Ga0307415_100231071 3300032126 Bacteria 1489
167 Ga0307415_100283072 3300032126 Bacteria 1364
168 Ga0307415_100294351 3300032126 Bacteria 1341
169 Ga0307415_100300973 3300032126 Bacteria 1328
170 Ga0307415_100340417 3300032126 Bacteria 1258
171 Ga0307415_100471584 3300032126 Bacteria 1090
172 Ga0307415_100515942 3300032126 Bacteria 1048
173 Ga0373942_0034193 3300035207 Bacteria 1359
174 Ga0373933_0013861 3300035724 Bacteria 4472
175 Ga0373937_0010058 3300036401 Bacteria 8248
176 Ga0373937_0297864 3300036401 Bacteria 1524
177 Ga0395899_0031025 3300037312 Bacteria 4019
178 Ga0395899_0137811 3300037312 Bacteria 1738
179 Ga0395899_0146627 3300037312 Bacteria 1675
180 Ga0395899_0164361 3300037312 Bacteria 1566
181 Ga0395899_0213631 3300037312 Bacteria 1339
182 Ga0395900_0016160 3300037418 Bacteria 7602
183 Ga0395900_0027954 3300037418 Bacteria 5776
184 Ga0395900_0079041 3300037418 Bacteria 3379
185 Ga0395900_0114136 3300037418 Bacteria 2772
186 Ga0395900_0210674 3300037418 Bacteria 1962
187 Ga0395900_0285651 3300037418 Bacteria 1640
188 Ga0395900_0315782 3300037418 Bacteria 1544
189 Ga0395900_0343178 3300037418 Bacteria 1468
190 Ga0395898_0042476 3300037466 Bacteria 4485
191 Ga0395898_0044940 3300037466 Bacteria 4342
192 Ga0395898_0071839 3300037466 Bacteria 3343
193 Ga0395898_0118035 3300037466 Bacteria 2541
194 Ga0395898_0165327 3300037466 Bacteria 2116
195 Ga0395898_0334759 3300037466 Bacteria 1443
196 Ga0395898_0402852 3300037466 Bacteria 1304
197 Ga0395898_0549533 3300037466 Bacteria 1097
198 Ga0395905_0017745 3300037471 Bacteria 6758
199 Ga0395905_0072235 3300037471 Bacteria 3235
200 Ga0395905_0201574 3300037471 Bacteria 1865
201 Ga0395905_0206913 3300037471 Bacteria 1839
202 Ga0395905_0217985 3300037471 Bacteria 1786
203 Ga0395901_0010860 3300038443 Bacteria 9229
204 Ga0395901_0054126 3300038443 Bacteria 4170
205 Ga0395901_0150864 3300038443 Bacteria 2442
206 Ga0395901_0179788 3300038443 Bacteria 2218
207 Ga0395901_0296655 3300038443 Bacteria 1676
208 Ga0395901_0363621 3300038443 Bacteria 1491
209 Ga0395901_0364873 3300038443 Bacteria 1488
210 Ga0395901_0385688 3300038443 Bacteria 1441
211 Ga0395901_0450886 3300038443 Bacteria 1315
212 Ga0436363_0973557 3300039450 Bacteria 1534
213 Ga0436363_1256468 3300039450 Bacteria 1487
214 Ga0439443_003888 3300042003 Bacteria 1914
215 Ga0439443_005051 3300042003 Bacteria 1750
216 Ga0439443_009060 3300042003 Bacteria 1419
217 Ga0439443_011390 3300042003 Bacteria 1302
218 Ga0439448_0021999 3300042005 Bacteria 1978
219 Ga0439448_0031618 3300042005 Bacteria 1681
220 Ga0439448_0037275 3300042005 Bacteria 1561
221 Ga0439448_0042440 3300042005 Bacteria 1474
222 Ga0439448_0042500 3300042005 Bacteria 1473
223 Ga0439448_0050521 3300042005 Bacteria 1360
224 Ga0439448_0061440 3300042005 Bacteria 1242
225 Ga0439448_0068465 3300042005 Bacteria 1180
226 Ga0439448_0068514 3300042005 Bacteria 1180
227 Ga0439450_002015 3300042008 Bacteria 3111
228 Ga0439450_005793 3300042008 Bacteria 2192
229 Ga0439450_006273 3300042008 Bacteria 2134
230 Ga0439450_013263 3300042008 Bacteria 1652
231 Ga0439450_017277 3300042008 Bacteria 1502
232 Ga0439450_017860 3300042008 Bacteria 1484
233 Ga0439450_024221 3300042008 Bacteria 1322
234 Ga0439450_027973 3300042008 Bacteria 1251
235 Ga0439451_003457 3300042009 Bacteria 3201
236 Ga0439451_010659 3300042009 Bacteria 1852
237 Ga0439451_013324 3300042009 Bacteria 1662
238 Ga0439454_002163 3300042011 Bacteria 2026
239 Ga0439454_004117 3300042011 Bacteria 1657
240 Ga0439454_007320 3300042011 Bacteria 1380
241 Ga0439455_0003834 3300042012 Bacteria 2917
242 Ga0439455_0027486 3300042012 Bacteria 1394
243 Ga0439455_0029325 3300042012 Bacteria 1359
244 Ga0439455_0029914 3300042012 Bacteria 1348
245 Ga0439455_0037582 3300042012 Bacteria 1228
246 Ga0439456_013464 3300042013 Bacteria 1702
247 Ga0439456_014644 3300042013 Bacteria 1636
248 Ga0439456_017108 3300042013 Bacteria 1519
249 Ga0439463_008180 3300042016 Bacteria 2578
250 Ga0439463_012781 3300042016 Bacteria 2064
251 Ga0439463_013914 3300042016 Bacteria 1982
252 Ga0439463_019902 3300042016 Bacteria 1672
253 Ga0439463_022071 3300042016 Bacteria 1591
254 Ga0439463_027039 3300042016 Bacteria 1443
255 Ga0439463_028297 3300042016 Bacteria 1411
256 Ga0439463_038303 3300042016 Bacteria 1216
257 Ga0439463_047417 3300042016 Bacteria 1094
258 Ga0450915_000581 3300042119 Bacteria 1399
259 Ga0450915_000806 3300042119 Bacteria 1295
260 Ga0450888_001322 3300042126 Bacteria 2371
261 Ga0450900_004179 3300042136 Bacteria 1647
262 Ga0450905_010652 3300042142 Bacteria 1276
263 Ga0450889_004972 3300042144 Bacteria 1317
264 Ga0439458_0015989 3300042157 Bacteria 1704
265 Ga0439435_0011437 3300042436 Bacteria 2130
266 Ga0439435_0012836 3300042436 Bacteria 2039
267 Ga0439435_0038559 3300042436 Bacteria 1328
268 Ga0439444_0003278 3300042437 Bacteria 2278
269 Ga0439444_0003802 3300042437 Bacteria 2156
270 Ga0439444_0011347 3300042437 Bacteria 1441
271 Ga0439444_0011897 3300042437 Bacteria 1417
272 Ga0439444_0022643 3300042437 Bacteria 1121
273 Ga0439459_0017143 3300042438 Bacteria 1346
274 Ga0439459_0028398 3300042438 Bacteria 1123
275 Ga0439464_0008073 3300042439 Bacteria 2759
276 Ga0439464_0016075 3300042439 Bacteria 2022
277 Ga0439464_0021870 3300042439 Bacteria 1757
278 Ga0439464_0027694 3300042439 Bacteria 1576
279 Ga0439464_0043813 3300042439 Bacteria 1280
280 Ga0439464_0077849 3300042439 Bacteria 987
281 Ga0439460_0024993 3300042461 Bacteria 1659
282 Ga0439460_0030749 3300042461 Bacteria 1528
283 Ga0439460_0040127 3300042461 Bacteria 1370
284 Ga0439460_0042721 3300042461 Bacteria 1336
285 Ga0439460_0054377 3300042461 Bacteria 1207
286 Ga0450916_002615 3300042530 Bacteria 1927
287 Ga0450916_004591 3300042530 Bacteria 1564
288 Ga0450916_010679 3300042530 Bacteria 1151
289 Ga0450893_0010589 3300042532 Bacteria 1517
290 Ga0439440_0004301 3300042993 Bacteria 2791
291 Ga0439440_0014247 3300042993 Bacteria 1714
292 Ga0439440_0021711 3300042993 Bacteria 1449
293 Ga0439440_0025352 3300042993 Bacteria 1365
294 Ga0439440_0026326 3300042993 Bacteria 1345
295 Ga0439440_0026988 3300042993 Bacteria 1331
296 Ga0439440_0027189 3300042993 Bacteria 1327
297 Ga0466963_0159241 3300044694 Bacteria 1571
298 Ga0466959_0144208 3300045049 Bacteria 1681
299 Ga0466958_0164720 3300045836 Bacteria 1402
300 Ga0495651_0027804 3300046462 Bacteria 4408
301 Ga0495653_0032398 3300046463 Bacteria 4150
302 Ga0495662_0118686 3300046476 Bacteria 1298
303 Ga0495584_0096760 3300046491 Bacteria 1491
304 Ga0495607_0151642 3300046501 Bacteria 1186
305 Ga0495608_0078680 3300046511 Bacteria 2144
306 Ga0495666_0101946 3300046526 Bacteria 1352
307 Ga0495652_0398247 3300046529 Bacteria 975
308 Ga0495598_0068333 3300046537 Bacteria 1113
309 Ga0495667_0013019 3300046559 Bacteria 5635
310 Ga0495656_0084574 3300046615 Bacteria 1439
311 Ga0495656_0090039 3300046615 Bacteria 1401
312 Ga0495656_0131342 3300046615 Bacteria 1192
313 Ga0495611_0189581 3300046648 Bacteria 960
314 Ga0495635_0188783 3300046663 Bacteria 1399
315 Ga0495657_0020765 3300046675 Bacteria 4721
316 Ga0495669_0044605 3300046684 Bacteria 1975
317 Ga0495674_0249331 3300047319 Bacteria 1461
318 Ga0495680_0010596 3300047322 Bacteria 8222
319 Ga0495680_0197331 3300047322 Bacteria 1445
320 Ga0495684_0077718 3300047471 Bacteria 2519
321 Ga0495684_0080225 3300047471 Bacteria 2477
322 Ga0495602_0330719 3300048088 Bacteria 1105
323 Ga0496102_0165843 3300048905 Bacteria 2078
324 Ga0496110_0054564 3300048913 Bacteria 3515
325 Ga0496111_0087360 3300048914 Bacteria 2282
326 Ga0496118_0041962 3300048921 Bacteria 3616
327 Ga0496126_0230700 3300048929 Bacteria 1551
328 Ga0501031_0154544 3300049568 Bacteria 1499
329 Ga0501032_0156781 3300049569 Bacteria 1495
330 Ga0501036_0266883 3300049572 Bacteria 1433
331 Ga0501037_0145633 3300049573 Bacteria 1694
332 Ga0501038_0010822 3300049574 Bacteria 8337
333 Ga0501039_0211373 3300049575 Bacteria 1525
334 Ga0501040_0181635 3300049576 Bacteria 1491
335 Ga0501041_0003969 3300049577 Bacteria 8536
336 Ga0501042_0174983 3300049578 Bacteria 1548
337 Ga0501043_0278942 3300049579 Bacteria 1281
338 Ga0501046_0208506 3300049580 Bacteria 1451
339 Ga0501047_0000147 3300049581 Bacteria 85481
340 Ga0501047_0229728 3300049581 Bacteria 1709
341 Ga0501048_0188998 3300049582 Bacteria 1459
342 Ga0501067_0218313 3300049583 Bacteria 1062
343 Ga0501070_0001435 3300049586 Bacteria 21323
344 Ga0501071_0201325 3300049587 Bacteria 1495
345 Ga0501072_0068961 3300049588 Bacteria 2791
346 Ga0501074_0076658 3300049590 Bacteria 2399
347 Ga0501074_0194183 3300049590 Bacteria 1447
348 Ga0501075_0198409 3300049591 Bacteria 1530
349 Ga0501076_0235952 3300049592 Bacteria 1495
350 Ga0501077_0158178 3300049593 Bacteria 1438
351 Ga0501221_041635 3300049704 Bacteria 1004
352 Ga0501079_0219117 3300049741 Bacteria 1486
353 Ga0501081_0072032 3300049743 Bacteria 2409
354 Ga0501035_0259842 3300049822 Bacteria 1472
355 Ga0501045_0202603 3300049824 Bacteria 1478
356 nmdc:mga05p37_532350_c1 3300050507 Bacteria 1342
357 nmdc:mga05p37_670468_c1 3300050507 Bacteria 1158
358 nmdc:mga09592_31503_c1 3300050508 Bacteria 3857
359 nmdc:mga0qj67_280454_c1 3300050509 Bacteria 1351
360 nmdc:mga06r32_368585_c1 3300050510 Bacteria 1420
361 nmdc:mga08y16_149557_c1 3300050511 Bacteria 2428
362 nmdc:mga0n895_115816_c1 3300050512 Bacteria 2699
363 nmdc:mga0n895_30900_c1 3300050512 Bacteria 5123
364 nmdc:mga0n895_335945_c1 3300050512 Bacteria 1531
365 nmdc:mga0rr50_162436_c1 3300050513 Bacteria 1814
366 nmdc:mga0a205_122448_c1 3300050515 Bacteria 2501
367 nmdc:mga0a205_32174_c1 3300050515 Bacteria 5030
368 Ga0495619_0324363 3300053085 Bacteria 1066
369 Ga0501084_0256693 3300054114 Bacteria 1475
370 Ga0501082_0246611 3300060353 Bacteria 1554
371 Ga0530510_0205752 3300061734 Bacteria 1462
372 2831940534 2831935698 Bacteria 5963223
373 Ga0439440_0020252
374 JGI25407J50210_10029027
375 JGI25407J50210_10030246
376 JGI25407J50210_10032445
377 JGI25407J50210_10058111
378 Ga0070714_100570801
379 Ga0070707_100120133
380 Ga0070698_100406841
381 Ga0070665_100357886
382 Ga0070664_100118811
383 Ga0068856_100373099
384 Ga0068866_10026303
385 Ga0068861_100243180
386 Ga0081455_10054992
387 Ga0081455_10133971
388 Ga0081538_10005203
389 Ga0081538_10022607
390 Ga0081538_10025292
391 Ga0081538_10044071
392 Ga0081538_10046993
393 Ga0081538_10058000
394 Ga0081538_10076442
395 Ga0081538_10089563
396 Ga0081538_10101832
397 Ga0081538_10107824
398 Ga0081538_10125478
399 Ga0081539_10001327
400 Ga0081539_10002921
401 Ga0081539_10059460
402 Ga0070717_10491638
403 Ga0075432_10003447
404 Ga0075427_10010484
405 Ga0075428_100373702
406 Ga0075430_100300165
407 Ga0075433_10039926
408 Ga0075433_10058793
409 Ga0075434_100170198
410 Ga0075434_100328313
411 Ga0075429_100048814
412 Ga0111539_10439215
413 Ga0114129_10652699
414 Ga0114129_10690839
415 Ga0105237_10061591
416 Ga0105237_10288470
417 Ga0105239_10002129
418 Ga0157369_10132544
419 Ga0157374_10481423
420 Ga0157377_10098620
421 Ga0157377_10156896
422 Ga0213874_10048523
423 Ga0213875_10102997
424 Ga0228598_1033076
425 Ga0207699_10156102
426 Ga0207684_10315691
427 Ga0207654_10008544
428 Ga0207671_10005914
429 Ga0207663_10405163
430 Ga0207646_10032470
431 Ga0207659_10123137
432 Ga0207700_10003843
433 Ga0207664_10268355
434 Ga0207702_10022526
435 Ga0207641_10327471
436 Ga0207675_100299940
437 Ga0209966_1017148
438 Ga0207428_10124722
439 Ga0268266_10491942
440 Ga0265319_1006084
441 Ga0265334_10059760
442 Ga0265322_10033055
443 Ga0265338_10207379
444 Ga0265324_10077049
445 Ga0265324_10106680
446 Ga0265332_10081790
447 Ga0265332_10124906
448 Ga0265340_10147991
449 Ga0265340_10153188
450 Ga0265316_10071794
451 Ga0307408_100115806
452 Ga0307408_100176568
453 Ga0307408_100209518
454 Ga0307408_100244398
455 Ga0307408_100291243
456 Ga0307408_100305902
457 Ga0265314_10020875
458 Ga0265342_10089484
459 Ga0307405_10004088
460 Ga0307405_10059576
461 Ga0307405_10189066
462 Ga0307405_10210689
463 Ga0307405_10233870
464 Ga0307405_10239281
465 Ga0307405_10436512
466 Ga0307413_10074385
467 Ga0307413_10103105
468 Ga0307413_10186888
469 Ga0307413_10222947
470 Ga0307413_10273762
471 Ga0307413_10339008
472 Ga0307410_10001822
473 Ga0307410_10071678
474 Ga0307410_10165213
475 Ga0307410_10236852
476 Ga0307410_10237621
477 Ga0307410_10253348
478 Ga0307410_10269356
479 Ga0307410_10348601
480 Ga0307406_10072710
481 Ga0307406_10163131
482 Ga0307406_10177251
483 Ga0307406_10211662
484 Ga0307406_10216220
485 Ga0307406_10222207
486 Ga0307406_10228669
487 Ga0307407_10167595
488 Ga0307407_10243297
489 Ga0307407_10314544
490 Ga0307407_10345842
491 Ga0307407_10375537
492 Ga0307412_10188507
493 Ga0307412_10269554
494 Ga0307412_10293653
495 Ga0307412_10463939
496 Ga0307409_100109317
497 Ga0307409_100158091
498 Ga0307409_100333892
499 Ga0307409_100345161
500 Ga0307409_100348485
501 Ga0307409_100365956
502 Ga0307409_100369818
503 Ga0307409_100541101
504 Ga0307409_100587805
505 Ga0307416_100048149
506 Ga0307416_100070995
507 Ga0307416_100232199
508 Ga0307416_100284110
509 Ga0307416_100335096
510 Ga0307416_100386919
511 Ga0307416_100429020
512 Ga0307416_100434800
513 Ga0307416_100435451
514 Ga0307416_100450389
515 Ga0307416_100635070
516 Ga0307414_10058716
517 Ga0307414_10139076
518 Ga0307414_10251057
519 Ga0307414_10278467
520 Ga0307414_10304084
521 Ga0307414_10307818
522 Ga0307414_10414336
523 Ga0307414_10418960
524 Ga0307411_10051251
525 Ga0307411_10179995
526 Ga0307411_10182393
527 Ga0307411_10241839
528 Ga0307411_10259879
529 Ga0307411_10263372
530 Ga0307411_10337982
531 Ga0307415_100007582
532 Ga0307415_100043544
533 Ga0307415_100044020
534 Ga0307415_100091000
535 Ga0307415_100150162
536 Ga0307415_100194240
537 Ga0307415_100225453
538 Ga0307415_100231071
539 Ga0307415_100283072
540 Ga0307415_100294351
541 Ga0307415_100300973
542 Ga0307415_100340417
543 Ga0307415_100471584
544 Ga0307415_100515942
545 Ga0373942_0034193
546 Ga0373933_0013861
547 Ga0373937_0010058
548 Ga0373937_0297864
549 Ga0395899_0031025
550 Ga0395899_0137811
551 Ga0395899_0146627
552 Ga0395899_0164361
553 Ga0395899_0213631
554 Ga0395900_0016160
555 Ga0395900_0027954
556 Ga0395900_0079041
557 Ga0395900_0114136
558 Ga0395900_0210674
559 Ga0395900_0285651
560 Ga0395900_0315782
561 Ga0395900_0343178
562 Ga0395898_0042476
563 Ga0395898_0044940
564 Ga0395898_0071839
565 Ga0395898_0118035
566 Ga0395898_0165327
567 Ga0395898_0334759
568 Ga0395898_0402852
569 Ga0395898_0549533
570 Ga0395905_0017745
571 Ga0395905_0072235
572 Ga0395905_0201574
573 Ga0395905_0206913
574 Ga0395905_0217985
575 Ga0395901_0010860
576 Ga0395901_0054126
577 Ga0395901_0150864
578 Ga0395901_0179788
579 Ga0395901_0296655
580 Ga0395901_0363621
581 Ga0395901_0364873
582 Ga0395901_0385688
583 Ga0395901_0450886
584 Ga0436363_0973557
585 Ga0436363_1256468
586 Ga0439443_003888
587 Ga0439443_005051
588 Ga0439443_009060
589 Ga0439443_011390
590 Ga0439448_0021999
591 Ga0439448_0031618
592 Ga0439448_0037275
593 Ga0439448_0042440
594 Ga0439448_0042500
595 Ga0439448_0050521
596 Ga0439448_0061440
597 Ga0439448_0068465
598 Ga0439448_0068514
599 Ga0439450_002015
600 Ga0439450_005793
601 Ga0439450_006273
602 Ga0439450_013263
603 Ga0439450_017277
604 Ga0439450_017860
605 Ga0439450_024221
606 Ga0439450_027973
607 Ga0439451_003457
608 Ga0439451_010659
609 Ga0439451_013324
610 Ga0439454_002163
611 Ga0439454_004117
612 Ga0439454_007320
613 Ga0439455_0003834
614 Ga0439455_0027486
615 Ga0439455_0029325
616 Ga0439455_0029914
617 Ga0439455_0037582
618 Ga0439456_013464
619 Ga0439456_014644
620 Ga0439456_017108
621 Ga0439463_008180
622 Ga0439463_012781
623 Ga0439463_013914
624 Ga0439463_019902
625 Ga0439463_022071
626 Ga0439463_027039
627 Ga0439463_028297
628 Ga0439463_038303
629 Ga0439463_047417
630 Ga0450915_000581
631 Ga0450915_000806
632 Ga0450888_001322
633 Ga0450900_004179
634 Ga0450905_010652
635 Ga0450889_004972
636 Ga0439458_0015989
637 Ga0439435_0011437
638 Ga0439435_0012836
639 Ga0439435_0038559
640 Ga0439444_0003278
641 Ga0439444_0003802
642 Ga0439444_0011347
643 Ga0439444_0011897
644 Ga0439444_0022643
645 Ga0439459_0017143
646 Ga0439459_0028398
647 Ga0439464_0008073
648 Ga0439464_0016075
649 Ga0439464_0021870
650 Ga0439464_0027694
651 Ga0439464_0043813
652 Ga0439464_0077849
653 Ga0439460_0024993
654 Ga0439460_0030749
655 Ga0439460_0040127
656 Ga0439460_0042721
657 Ga0439460_0054377
658 Ga0450916_002615
659 Ga0450916_004591
660 Ga0450916_010679
661 Ga0450893_0010589
662 Ga0439440_0004301
663 Ga0439440_0014247
664 Ga0439440_0021711
665 Ga0439440_0025352
666 Ga0439440_0026326
667 Ga0439440_0026988
668 Ga0439440_0027189
669 Ga0466963_0159241
670 Ga0466959_0144208
671 Ga0466958_0164720
672 Ga0495651_0027804
673 Ga0495653_0032398
674 Ga0495662_0118686
675 Ga0495584_0096760
676 Ga0495607_0151642
677 Ga0495608_0078680
678 Ga0495666_0101946
679 Ga0495652_0398247
680 Ga0495598_0068333
681 Ga0495667_0013019
682 Ga0495656_0084574
683 Ga0495656_0090039
684 Ga0495656_0131342
685 Ga0495611_0189581
686 Ga0495635_0188783
687 Ga0495657_0020765
688 Ga0495669_0044605
689 Ga0495674_0249331
690 Ga0495680_0010596
691 Ga0495680_0197331
692 Ga0495684_0077718
693 Ga0495684_0080225
694 Ga0495602_0330719
695 Ga0496102_0165843
696 Ga0496110_0054564
697 Ga0496111_0087360
698 Ga0496118_0041962
699 Ga0496126_0230700
700 Ga0501031_0154544
701 Ga0501032_0156781
702 Ga0501036_0266883
703 Ga0501037_0145633
704 Ga0501038_0010822
705 Ga0501039_0211373
706 Ga0501040_0181635
707 Ga0501041_0003969
708 Ga0501042_0174983
709 Ga0501043_0278942
710 Ga0501046_0208506
711 Ga0501047_0000147
712 Ga0501047_0229728
713 Ga0501048_0188998
714 Ga0501067_0218313
715 Ga0501070_0001435
716 Ga0501071_0201325
717 Ga0501072_0068961
718 Ga0501074_0076658
719 Ga0501074_0194183
720 Ga0501075_0198409
721 Ga0501076_0235952
722 Ga0501077_0158178
723 Ga0501221_041635
724 Ga0501079_0219117
725 Ga0501081_0072032
726 Ga0501035_0259842
727 Ga0501045_0202603
728 nmdc:mga05p37_532350_c1
729 nmdc:mga05p37_670468_c1
730 nmdc:mga09592_31503_c1
731 nmdc:mga0qj67_280454_c1
732 nmdc:mga06r32_368585_c1
733 nmdc:mga08y16_149557_c1
734 nmdc:mga0n895_115816_c1
735 nmdc:mga0n895_30900_c1
736 nmdc:mga0n895_335945_c1
737 nmdc:mga0rr50_162436_c1
738 nmdc:mga0a205_122448_c1
739 nmdc:mga0a205_32174_c1
740 Ga0495619_0324363
741 Ga0501084_0256693
742 Ga0501082_0246611
743 Ga0530510_0205752
744 2831940534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13333

rve_2

Integrase core domain

244

297

0.98

PF00665

rve

Integrase core domain

138

237

0.97

PF13683

rve_3

Integrase core domain

225

291

0.97

PF13276

HTH_21

HTH-like domain

54

113

0.93

Map