F426112

General Info

Members Datasets Scaffolds Average Seq Length
372 272 744 152

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0003046|Ga0439436_0003046_1030_1545
Length 171
Sequence VDHRTRRKGIVKELRIRTLATVFVVAGVLSWAGARLWYSVGTLPSVPLAAPIVLALIAAVXXXTALSIRSRLKAQRERQPDAKGVDPLMAARAVVFGQASALVAALVCGMYGGVGVFLLEHLDVPARRDQAIYAGFSVLAGIGVIVAAFFLERVCKLPEDDDTNGGAARAA

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
53 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
56 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
62 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
63 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
64 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
65 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
66 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
67 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
68 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
183 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
184 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
185 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
188 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
189 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
190 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
191 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
192 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
193 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
194 2643221548 Streptomyces sp. Root55 Isolate Unclassified
195 2643221578 Streptomyces sp. Root63 Isolate Unclassified
196 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
197 2643221647 Streptomyces sp. Root369 Isolate Unclassified
198 2643221670 Streptomyces sp. Root431 Isolate Unclassified
199 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
200 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
201 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
202 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
203 2643221714 Streptomyces sp. Root264 Isolate Unclassified
204 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
205 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
206 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
207 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
208 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
209 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
210 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
211 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
212 2808606448 Streptomyces sp. 193411 Isolate Unclassified
213 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
214 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
215 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
216 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
217 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
218 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
219 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
220 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
221 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
222 2862574272 Streptomyces sp. AcE210 Isolate Nodule
223 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
224 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
225 2867428634 Streptomyces sp. RP5T Isolate Unclassified
226 2867475112 Streptomyces sp. TM32 Isolate Unclassified
227 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
228 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
229 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
230 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
231 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
232 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
233 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
234 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
235 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
236 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
237 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
238 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
239 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
240 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
241 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
242 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
243 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
244 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
245 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
246 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
247 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
248 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
249 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
250 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
251 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
252 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
253 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
254 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
255 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
256 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
257 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
258 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
259 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
260 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
261 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
262 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
263 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
264 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
265 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
266 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
267 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
268 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
269 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
270 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
271 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
272 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.08
Metatranscriptomes 0.81
Isolates 23.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0.81
Rhizoplane 1.08
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0003046 3300041404 Bacteria 5082
2 JGI24739J22299_10088002 3300001989 Bacteria 948
3 JGI24738J21930_10011622 3300002075 Bacteria 1933
4 rootH1_10009274 3300003316 Bacteria 3690
5 rootH2_10010236 3300003320 Bacteria 3491
6 rootL2_10015367 3300003322 Bacteria 4792
7 rootL2_10016661 3300003322 Bacteria 3862
8 Ga0006562J51391_1036307 3300003578 Bacteria 2540
9 Ga0006562J51391_1036308 3300003578 Bacteria 2593
10 Ga0070682_100700081 3300005337 Bacteria 812
11 Ga0070672_100528956 3300005543 Bacteria 1022
12 Ga0070665_100036884 3300005548 Bacteria 4916
13 Ga0068857_100608875 3300005577 Bacteria 1033
14 Ga0068856_100291121 3300005614 Bacteria 1650
15 Ga0068858_100526773 3300005842 Bacteria 1143
16 Ga0081455_10051454 3300005937 Bacteria 3533
17 Ga0105244_10115558 3300009036 Bacteria 1303
18 Ga0105245_10116988 3300009098 Bacteria 2486
19 Ga0105245_10653544 3300009098 Bacteria 1082
20 Ga0105248_10110959 3300009177 Bacteria 3093
21 Ga0105238_10139662 3300009551 Bacteria 2400
22 Ga0105239_10443196 3300010375 Bacteria 1473
23 Ga0105246_10001835 3300011119 Bacteria 12738
24 Ga0105246_10443983 3300011119 Bacteria 1088
25 Ga0157369_10084702 3300013105 Bacteria 3388
26 Ga0157372_10031477 3300013307 Bacteria 5809
27 Ga0157375_10224411 3300013308 Bacteria 2038
28 Ga0157375_11179181 3300013308 Bacteria 898
29 Ga0183367_1015 3300015688 Bacteria 298435
30 Ga0224712_10139794 3300022467 Bacteria 1065
31 Ga0207426_1008113 3300025302 Bacteria 4298
32 Ga0207426_1026130 3300025302 Bacteria 1959
33 Ga0207647_10004478 3300025904 Bacteria 10347
34 Ga0207685_10077361 3300025905 Bacteria 1366
35 Ga0207709_10468781 3300025935 Bacteria 977
36 Ga0207691_10123368 3300025940 Bacteria 2293
37 Ga0207711_10099115 3300025941 Bacteria 2575
38 Ga0207703_10670446 3300026035 Bacteria 985
39 Ga0207702_10019973 3300026078 Bacteria 5550
40 Ga0207675_100953077 3300026118 Bacteria 876
41 Ga0209371_1015527 3300027312 Bacteria 2042
42 Ga0268266_10029980 3300028379 Bacteria 4623
43 Ga0268266_10136972 3300028379 Bacteria 2194
44 Ga0307515_10080258 3300028794 Bacteria 4258
45 Ga0268256_1016621 3300030500 Bacteria 2101
46 Ga0307511_10087843 3300030521 Bacteria 2131
47 Ga0307512_10024800 3300030522 Bacteria 5328
48 Ga0307408_100466153 3300031548 Bacteria 1099
49 Ga0307514_10008462 3300031649 Bacteria 8762
50 Ga0307514_10032610 3300031649 Bacteria 4166
51 Ga0307514_10037847 3300031649 Bacteria 3820
52 Ga0307514_10329454 3300031649 Bacteria 831
53 Ga0307516_10008687 3300031730 Bacteria 11431
54 Ga0307518_10063133 3300031838 Bacteria 2689
55 Ga0307410_11225618 3300031852 Bacteria 654
56 Ga0307412_10527189 3300031911 Bacteria 988
57 Ga0307416_100423149 3300032002 Bacteria 1377
58 Ga0307510_10116459 3300033180 Bacteria 2393
59 Ga0395900_1139990 3300037418 Bacteria 696
60 Ga0395901_1263949 3300038443 Bacteria 701
61 Ga0439436_0006050 3300041404 Bacteria 3710
62 Ga0439439_0000554 3300041406 Bacteria 6514
63 Ga0439439_0046755 3300041406 Bacteria 1130
64 Ga0439466_0149811 3300041411 Bacteria 714
65 Ga0451845_0867583 3300041501 Bacteria 1145
66 Ga0451853_0483230 3300041512 Bacteria 2476
67 Ga0451853_3823001 3300041512 Bacteria 1972
68 Ga0439433_0000267 3300041999 Bacteria 8812
69 Ga0439433_0148473 3300041999 Bacteria 602
70 Ga0439448_0007468 3300042005 Bacteria 3172
71 Ga0439432_043303 3300042006 Bacteria 1421
72 Ga0439449_0007088 3300042007 Bacteria 4267
73 Ga0439449_0055863 3300042007 Bacteria 1458
74 Ga0439457_000625 3300042014 Bacteria 10447
75 Ga0439462_0025196 3300042015 Bacteria 1565
76 Ga0439462_0036474 3300042015 Bacteria 1308
77 Ga0450920_020838 3300042122 Bacteria 1264
78 Ga0450890_014772 3300042127 Bacteria 1024
79 Ga0450894_000385 3300042131 Bacteria 7618
80 Ga0450895_000416 3300042132 Bacteria 2405
81 Ga0450898_003683 3300042134 Bacteria 2215
82 Ga0450899_001065 3300042135 Bacteria 3120
83 Ga0450900_041860 3300042136 Bacteria 687
84 Ga0450902_050279 3300042137 Bacteria 715
85 Ga0450903_006249 3300042138 Bacteria 1984
86 Ga0450906_000280 3300042145 Bacteria 10129
87 Ga0466969_0074425 3300044656 Bacteria 1629
88 Ga0466969_0122041 3300044656 Bacteria 1212
89 Ga0466972_0002520 3300044658 Bacteria 9059
90 Ga0466972_0032726 3300044658 Bacteria 2552
91 Ga0466972_0048397 3300044658 Bacteria 2054
92 Ga0466965_0001711 3300044683 Bacteria 9016
93 Ga0466965_0061760 3300044683 Bacteria 1873
94 Ga0466966_0012043 3300044684 Bacteria 5732
95 Ga0466966_0017565 3300044684 Bacteria 4727
96 Ga0466961_0008758 3300044693 Bacteria 6452
97 Ga0466961_0072012 3300044693 Bacteria 2192
98 Ga0466963_0004306 3300044694 Bacteria 8257
99 Ga0466963_0006166 3300044694 Bacteria 7077
100 Ga0466963_0137008 3300044694 Bacteria 1694
101 Ga0466964_0042198 3300044706 Bacteria 1847
102 Ga0466964_0069090 3300044706 Bacteria 1489
103 Ga0466971_0009550 3300044719 Bacteria 4235
104 Ga0466971_0041929 3300044719 Bacteria 2056
105 Ga0466968_0041893 3300044735 Bacteria 1934
106 Ga0466970_0000265 3300044765 Bacteria 25600
107 Ga0466957_0000482 3300044842 Bacteria 19826
108 Ga0466957_0124423 3300044842 Bacteria 1646
109 Ga0466960_0171410 3300044901 Bacteria 1171
110 Ga0466959_0001725 3300045049 Bacteria 13588
111 Ga0466958_0000083 3300045836 Bacteria 28940
112 Ga0466967_0014425 3300045976 Bacteria 6155
113 Ga0466967_0545074 3300045976 Bacteria 1141
114 Ga0466967_2141512 3300045976 Bacteria 555
115 Ga0495627_007977 3300046453 Bacteria 4004
116 Ga0495603_0005365 3300046455 Bacteria 7644
117 Ga0495603_0030893 3300046455 Bacteria 3225
118 Ga0495629_0013418 3300046459 Bacteria 5910
119 Ga0495629_0152950 3300046459 Bacteria 1603
120 Ga0495629_0166934 3300046459 Bacteria 1528
121 Ga0495629_0214326 3300046459 Bacteria 1330
122 Ga0495629_0283804 3300046459 Bacteria 1136
123 Ga0495638_0081985 3300046460 Bacteria 1957
124 Ga0495638_0437434 3300046460 Bacteria 670
125 Ga0495651_0150613 3300046462 Bacteria 1677
126 Ga0495580_0234974 3300046472 Bacteria 1257
127 Ga0495582_0221291 3300046473 Bacteria 1083
128 Ga0495605_0313753 3300046474 Bacteria 662
129 Ga0495639_0014841 3300046475 Bacteria 3376
130 Ga0495662_0001260 3300046476 Bacteria 12502
131 Ga0495662_0033821 3300046476 Bacteria 2469
132 Ga0495664_0029769 3300046477 Bacteria 3195
133 Ga0495584_0398954 3300046491 Bacteria 699
134 Ga0495585_0059231 3300046492 Bacteria 2111
135 Ga0495594_0006912 3300046499 Bacteria 5838
136 Ga0495594_0017614 3300046499 Bacteria 3776
137 Ga0495596_0181996 3300046500 Bacteria 817
138 Ga0495596_0210280 3300046500 Bacteria 755
139 Ga0495583_0047930 3300046506 Bacteria 1962
140 Ga0495583_0104163 3300046506 Bacteria 1208
141 Ga0495583_0234498 3300046506 Bacteria 739
142 Ga0495606_0010908 3300046507 Bacteria 7478
143 Ga0495606_0302520 3300046507 Bacteria 866
144 Ga0495610_0026065 3300046512 Bacteria 3126
145 Ga0495610_0078819 3300046512 Bacteria 1518
146 Ga0495616_0005383 3300046513 Bacteria 7888
147 Ga0495618_0047298 3300046514 Bacteria 2715
148 Ga0495620_0002674 3300046515 Bacteria 10295
149 Ga0495620_0043993 3300046515 Bacteria 1942
150 Ga0495620_0044627 3300046515 Bacteria 1925
151 Ga0495628_0059914 3300046516 Bacteria 2987
152 Ga0495631_0007194 3300046518 Bacteria 5673
153 Ga0495631_0039117 3300046518 Bacteria 2106
154 Ga0495637_0010644 3300046520 Bacteria 4441
155 Ga0495648_0038823 3300046524 Bacteria 3038
156 Ga0495648_0069972 3300046524 Bacteria 2040
157 Ga0495666_0018030 3300046526 Bacteria 3516
158 Ga0495666_0077279 3300046526 Bacteria 1577
159 Ga0495642_0015570 3300046528 Bacteria 2958
160 Ga0495654_0033867 3300046530 Bacteria 2582
161 Ga0495665_0178539 3300046531 Bacteria 1104
162 Ga0495640_0012868 3300046533 Bacteria 6381
163 Ga0495640_0410536 3300046533 Bacteria 830
164 Ga0495609_0088403 3300046538 Bacteria 1349
165 Ga0495597_0007045 3300046542 Bacteria 5757
166 Ga0495645_0007656 3300046543 Bacteria 7515
167 Ga0495622_0002086 3300046557 Bacteria 9771
168 Ga0495622_0109155 3300046557 Bacteria 1267
169 Ga0495633_0004699 3300046558 Bacteria 8583
170 Ga0495633_0051204 3300046558 Bacteria 1946
171 Ga0495633_0233435 3300046558 Bacteria 841
172 Ga0495667_0212381 3300046559 Bacteria 1236
173 Ga0495656_0114791 3300046615 Bacteria 1264
174 Ga0495668_0121985 3300046616 Bacteria 1426
175 Ga0495668_0320250 3300046616 Bacteria 850
176 Ga0495634_0081157 3300046642 Bacteria 2121
177 Ga0495611_0123425 3300046648 Bacteria 1207
178 Ga0495611_0277544 3300046648 Bacteria 774
179 Ga0495625_0080905 3300046660 Bacteria 2261
180 Ga0495625_0133484 3300046660 Bacteria 1680
181 Ga0495635_0112149 3300046663 Bacteria 1862
182 Ga0495659_0132644 3300046664 Bacteria 989
183 Ga0495661_0032300 3300046665 Bacteria 3310
184 Ga0495661_0242828 3300046665 Bacteria 923
185 Ga0495588_0016821 3300046674 Bacteria 3539
186 Ga0495657_0083803 3300046675 Bacteria 2057
187 Ga0495657_0120047 3300046675 Bacteria 1656
188 Ga0495623_0107912 3300046679 Bacteria 1690
189 Ga0495658_0151089 3300046683 Bacteria 1426
190 Ga0495613_0000387 3300046689 Bacteria 38006
191 Ga0495613_0009859 3300046689 Bacteria 7104
192 Ga0495613_0039200 3300046689 Bacteria 3512
193 Ga0495613_0057001 3300046689 Bacteria 2868
194 Ga0495613_0333392 3300046689 Bacteria 1045
195 Ga0495624_0258464 3300046690 Bacteria 1052
196 Ga0495670_0019839 3300046691 Bacteria 3313
197 Ga0495671_0053881 3300046692 Bacteria 1995
198 Ga0495671_0341562 3300046692 Bacteria 718
199 Ga0495649_0036513 3300046694 Bacteria 2699
200 Ga0495589_0004926 3300046794 Bacteria 7078
201 Ga0495589_0015671 3300046794 Bacteria 3896
202 Ga0495589_0016283 3300046794 Bacteria 3821
203 Ga0495589_0061199 3300046794 Bacteria 1848
204 Ga0495589_0089765 3300046794 Bacteria 1493
205 Ga0495589_0111913 3300046794 Bacteria 1317
206 Ga0495660_0034736 3300046810 Bacteria 2819
207 Ga0495660_0108688 3300046810 Bacteria 1417
208 Ga0495581_0143674 3300047315 Bacteria 1392
209 Ga0495604_0109766 3300047317 Bacteria 2013
210 Ga0495636_0009043 3300047318 Bacteria 3917
211 Ga0495636_0013360 3300047318 Bacteria 3258
212 Ga0495636_0015289 3300047318 Bacteria 3059
213 Ga0495636_0221689 3300047318 Bacteria 868
214 Ga0495674_0153335 3300047319 Bacteria 1931
215 Ga0495676_0041155 3300047321 Bacteria 3805
216 Ga0495676_0043794 3300047321 Bacteria 3658
217 Ga0495676_0062196 3300047321 Bacteria 2915
218 Ga0495676_0100321 3300047321 Bacteria 2143
219 Ga0495676_0113231 3300047321 Bacteria 1986
220 Ga0495683_0045077 3300047323 Bacteria 2216
221 Ga0495683_0196622 3300047323 Bacteria 912
222 Ga0495683_0235541 3300047323 Bacteria 810
223 Ga0495687_001389 3300047443 Bacteria 22370
224 Ga0495687_036692 3300047443 Bacteria 2190
225 Ga0495687_057009 3300047443 Bacteria 1627
226 Ga0495687_064061 3300047443 Bacteria 1502
227 Ga0495687_088117 3300047443 Bacteria 1195
228 Ga0495687_122410 3300047443 Bacteria 936
229 Ga0495675_0018911 3300047444 Bacteria 4377
230 Ga0495677_0117937 3300047445 Bacteria 1011
231 Ga0495677_0296734 3300047445 Bacteria 635
232 Ga0495679_018950 3300047446 Bacteria 2430
233 Ga0495685_010959 3300047447 Bacteria 3049
234 Ga0495685_015051 3300047447 Bacteria 2634
235 Ga0495685_015908 3300047447 Bacteria 2569
236 Ga0495685_055370 3300047447 Bacteria 1341
237 Ga0495684_0071541 3300047471 Bacteria 2635
238 Ga0495686_0036160 3300047472 Bacteria 3170
239 Ga0495686_0105974 3300047472 Bacteria 1690
240 Ga0495593_0470821 3300047673 Bacteria 629
241 Ga0495602_0124390 3300048088 Bacteria 2069
242 Ga0495614_0000388 3300048089 Bacteria 17839
243 Ga0495614_0062030 3300048089 Bacteria 1606
244 Ga0495614_0128579 3300048089 Bacteria 1120
245 Ga0495614_0555159 3300048089 Bacteria 549
246 Ga0495626_0074754 3300048091 Bacteria 1515
247 Ga0496109_0055310 3300048912 Bacteria 3620
248 Ga0496111_0468355 3300048914 Bacteria 929
249 Ga0496114_1124474 3300048917 Bacteria 671
250 Ga0496125_0648042 3300048928 Bacteria 569
251 Ga0495682_0074722 3300049460 Bacteria 1219
252 Ga0501031_0317540 3300049568 Bacteria 1009
253 Ga0501032_0015155 3300049569 Bacteria 5444
254 Ga0501032_0058315 3300049569 Bacteria 2592
255 Ga0501034_0032795 3300049571 Bacteria 5273
256 Ga0501034_0078121 3300049571 Bacteria 3315
257 Ga0501034_0466863 3300049571 Bacteria 1178
258 Ga0501036_0390341 3300049572 Bacteria 1161
259 Ga0501037_0014639 3300049573 Bacteria 5772
260 Ga0501038_0078069 3300049574 Bacteria 2794
261 Ga0501039_0062980 3300049575 Bacteria 2874
262 Ga0501039_0261679 3300049575 Bacteria 1360
263 Ga0501042_0009583 3300049578 Bacteria 6461
264 Ga0501042_0174244 3300049578 Bacteria 1552
265 Ga0501043_0022684 3300049579 Bacteria 4922
266 Ga0501043_0102431 3300049579 Bacteria 2250
267 Ga0501046_0233644 3300049580 Bacteria 1357
268 Ga0501046_0404495 3300049580 Bacteria 986
269 Ga0501047_0000072 3300049581 Bacteria 126542
270 Ga0501047_0102222 3300049581 Bacteria 2745
271 Ga0501048_0068645 3300049582 Bacteria 2503
272 Ga0501069_0160143 3300049585 Bacteria 1296
273 Ga0501073_0040050 3300049589 Bacteria 3319
274 Ga0501080_0636505 3300049742 Bacteria 944
275 Ga0501035_0019947 3300049822 Bacteria 6158
276 Ga0501035_0048151 3300049822 Bacteria 3823
277 Ga0501035_0674760 3300049822 Bacteria 836
278 Ga0501044_0095789 3300049823 Bacteria 2990
279 Ga0495595_0620513 3300053084 Bacteria 553
280 Ga0500566_0032786 3300053094 Bacteria 3029
281 Ga0500560_018027 3300053107 Bacteria 1961
282 Ga0500628_006094 3300053129 Bacteria 2029
283 Ga0500573_0051941 3300053140 Bacteria 2357
284 Ga0500600_0154082 3300053149 Bacteria 1139
285 Ga0500600_0198690 3300053149 Bacteria 947
286 Ga0466962_0000156 3300061719 Bacteria 28746
287 2547411638 2547132111 Bacteria 8013147
288 2554257038 2554235005 Bacteria 6457341
289 2585298071 2582581312 Bacteria 7308206
290 2585305144 2582581313 Bacteria 10042643
291 2585318317 2582581314 Bacteria 11452267
292 2616701481 2616644814 Bacteria 11555299
293 2616903623 2616644941 Bacteria 8510691
294 2643763486 2643221548 Bacteria 8053412
295 2643899708 2643221578 Bacteria 9213798
296 2643947635 2643221587 Bacteria 7586415
297 2644266169 2643221647 Bacteria 10741251
298 2644390181 2643221670 Bacteria 6497041
299 2644403676 2643221673 Bacteria 9196637
300 2644435327 2643221677 Bacteria 7584031
301 2644437588 2643221678 Bacteria 9540101
302 2644463646 2643221682 Bacteria 6743283
303 2644627954 2643221714 Bacteria 9015452
304 2768642034 2767802112 Bacteria 6465194
305 2784589403 2784132148 Bacteria 8627943
306 2785342171 2784746763 Bacteria 9783172
307 2785370482 2784746768 Bacteria 10036182
308 2786671638 2786546132 Bacteria 10419719
309 2793980733 2791355406 Bacteria 11364898
310 2808843043 2808606359 Bacteria 9866990
311 2808921384 2808606375 Bacteria 9466072
312 2809233066 2808606448 Bacteria 8656184
313 2811845355 2808606982 Bacteria 7791042
314 2812357080 2811994879 Bacteria 9313447
315 2812479739 2811994917 Bacteria 7761064
316 2819698266 2818991463 Bacteria 7948711
317 2852640057 2852635781 Bacteria 8251373
318 2862179486 2862178590 Bacteria 8583590
319 2862286668 2862281513 Bacteria 9621493
320 2862387911 2862382967 Bacteria 10317375
321 2862510262 2862507626 Bacteria 9425308
322 2862578446 2862574272 Bacteria 10567477
323 2863411853 2863404153 Bacteria 9672205
324 2867348528 2867346516 Bacteria 7608576
325 2867435702 2867428634 Bacteria 9590268
326 2867475967 2867475112 Bacteria 6909112
327 2873154959 2873151551 Bacteria 8625867
328 2875394678 2875391855 Bacteria 7600475
329 2877680138 2877676314 Bacteria 9512378
330 2912718728 2912715099 Bacteria 9460473
331 2912731052 2912723979 Bacteria 8557534
332 2912761861 2912757875 Bacteria 7940295
333 2918504617 2918501144 Bacteria 8668083
334 2919471459 2919468124 Bacteria 9133025
335 2935392664 2935390628 Bacteria 7043367
336 2946049957 2946045630 Bacteria 8527308
337 2946068798 2946064051 Bacteria 8957905
338 2946076844 2946072368 Bacteria 8999607
339 2947228112 2947224130 Bacteria 9938529
340 2954005938 2954002825 Bacteria 9173742
341 2954385071 2954380949 Bacteria 10050426
342 2954677924 2954673503 Bacteria 9685905
343 2954686233 2954682443 Bacteria 9862841
344 2954695889 2954691527 Bacteria 10720516
345 2954711080 2954701450 Bacteria 10834262
346 2954715294 2954711539 Bacteria 10867210
347 2954725235 2954721474 Bacteria 10456478
348 2954736581 2954731030 Bacteria 10243860
349 2954744168 2954740390 Bacteria 10229294
350 2954755430 2954749733 Bacteria 10366972
351 2954763111 2954759201 Bacteria 9358192
352 2966602468 2966598605 Bacteria 7676064
353 2990063964 2990059506 Bacteria 9321252
354 2997454275 2997451912 Bacteria 8492419
355 3006397268 3006393351 Bacteria 6615579
356 3006428467 3006425503 Bacteria 6491253
357 3006492244 3006486233 Bacteria 8157040
358 3006500344 3006493962 Bacteria 8825450
359 8008566235 8008558824 Bacteria 10610750
360 8008578066 8008574985 Bacteria 7815457
361 8023629551 8023623736 Bacteria 8593882
362 8025479504 8025478263 Bacteria 8209203
363 8025538145 8025530807 Bacteria 8495698
364 8047897900 8047893842 Bacteria 11723082
365 8048133116 8048127548 Bacteria 11053136
366 8048360994 8048356638 Bacteria 11044339
367 8048374863 8048369669 Bacteria 11666822
368 8048383359 8048379754 Bacteria 11877923
369 8054166945 8054160619 Bacteria 7783213
370 8056454027 8056447290 Bacteria 7680491
371 8056669214 8056667051 Bacteria 6953971
372 8056833227 8056829672 Bacteria 9045328
373 Ga0439436_0003046
374 JGI24739J22299_10088002
375 JGI24738J21930_10011622
376 rootH1_10009274
377 rootH2_10010236
378 rootL2_10015367
379 rootL2_10016661
380 Ga0006562J51391_1036307
381 Ga0006562J51391_1036308
382 Ga0070682_100700081
383 Ga0070672_100528956
384 Ga0070665_100036884
385 Ga0068857_100608875
386 Ga0068856_100291121
387 Ga0068858_100526773
388 Ga0081455_10051454
389 Ga0105244_10115558
390 Ga0105245_10116988
391 Ga0105245_10653544
392 Ga0105248_10110959
393 Ga0105238_10139662
394 Ga0105239_10443196
395 Ga0105246_10001835
396 Ga0105246_10443983
397 Ga0157369_10084702
398 Ga0157372_10031477
399 Ga0157375_10224411
400 Ga0157375_11179181
401 Ga0183367_1015
402 Ga0224712_10139794
403 Ga0207426_1008113
404 Ga0207426_1026130
405 Ga0207647_10004478
406 Ga0207685_10077361
407 Ga0207709_10468781
408 Ga0207691_10123368
409 Ga0207711_10099115
410 Ga0207703_10670446
411 Ga0207702_10019973
412 Ga0207675_100953077
413 Ga0209371_1015527
414 Ga0268266_10029980
415 Ga0268266_10136972
416 Ga0307515_10080258
417 Ga0268256_1016621
418 Ga0307511_10087843
419 Ga0307512_10024800
420 Ga0307408_100466153
421 Ga0307514_10008462
422 Ga0307514_10032610
423 Ga0307514_10037847
424 Ga0307514_10329454
425 Ga0307516_10008687
426 Ga0307518_10063133
427 Ga0307410_11225618
428 Ga0307412_10527189
429 Ga0307416_100423149
430 Ga0307510_10116459
431 Ga0395900_1139990
432 Ga0395901_1263949
433 Ga0439436_0006050
434 Ga0439439_0000554
435 Ga0439439_0046755
436 Ga0439466_0149811
437 Ga0451845_0867583
438 Ga0451853_0483230
439 Ga0451853_3823001
440 Ga0439433_0000267
441 Ga0439433_0148473
442 Ga0439448_0007468
443 Ga0439432_043303
444 Ga0439449_0007088
445 Ga0439449_0055863
446 Ga0439457_000625
447 Ga0439462_0025196
448 Ga0439462_0036474
449 Ga0450920_020838
450 Ga0450890_014772
451 Ga0450894_000385
452 Ga0450895_000416
453 Ga0450898_003683
454 Ga0450899_001065
455 Ga0450900_041860
456 Ga0450902_050279
457 Ga0450903_006249
458 Ga0450906_000280
459 Ga0466969_0074425
460 Ga0466969_0122041
461 Ga0466972_0002520
462 Ga0466972_0032726
463 Ga0466972_0048397
464 Ga0466965_0001711
465 Ga0466965_0061760
466 Ga0466966_0012043
467 Ga0466966_0017565
468 Ga0466961_0008758
469 Ga0466961_0072012
470 Ga0466963_0004306
471 Ga0466963_0006166
472 Ga0466963_0137008
473 Ga0466964_0042198
474 Ga0466964_0069090
475 Ga0466971_0009550
476 Ga0466971_0041929
477 Ga0466968_0041893
478 Ga0466970_0000265
479 Ga0466957_0000482
480 Ga0466957_0124423
481 Ga0466960_0171410
482 Ga0466959_0001725
483 Ga0466958_0000083
484 Ga0466967_0014425
485 Ga0466967_0545074
486 Ga0466967_2141512
487 Ga0495627_007977
488 Ga0495603_0005365
489 Ga0495603_0030893
490 Ga0495629_0013418
491 Ga0495629_0152950
492 Ga0495629_0166934
493 Ga0495629_0214326
494 Ga0495629_0283804
495 Ga0495638_0081985
496 Ga0495638_0437434
497 Ga0495651_0150613
498 Ga0495580_0234974
499 Ga0495582_0221291
500 Ga0495605_0313753
501 Ga0495639_0014841
502 Ga0495662_0001260
503 Ga0495662_0033821
504 Ga0495664_0029769
505 Ga0495584_0398954
506 Ga0495585_0059231
507 Ga0495594_0006912
508 Ga0495594_0017614
509 Ga0495596_0181996
510 Ga0495596_0210280
511 Ga0495583_0047930
512 Ga0495583_0104163
513 Ga0495583_0234498
514 Ga0495606_0010908
515 Ga0495606_0302520
516 Ga0495610_0026065
517 Ga0495610_0078819
518 Ga0495616_0005383
519 Ga0495618_0047298
520 Ga0495620_0002674
521 Ga0495620_0043993
522 Ga0495620_0044627
523 Ga0495628_0059914
524 Ga0495631_0007194
525 Ga0495631_0039117
526 Ga0495637_0010644
527 Ga0495648_0038823
528 Ga0495648_0069972
529 Ga0495666_0018030
530 Ga0495666_0077279
531 Ga0495642_0015570
532 Ga0495654_0033867
533 Ga0495665_0178539
534 Ga0495640_0012868
535 Ga0495640_0410536
536 Ga0495609_0088403
537 Ga0495597_0007045
538 Ga0495645_0007656
539 Ga0495622_0002086
540 Ga0495622_0109155
541 Ga0495633_0004699
542 Ga0495633_0051204
543 Ga0495633_0233435
544 Ga0495667_0212381
545 Ga0495656_0114791
546 Ga0495668_0121985
547 Ga0495668_0320250
548 Ga0495634_0081157
549 Ga0495611_0123425
550 Ga0495611_0277544
551 Ga0495625_0080905
552 Ga0495625_0133484
553 Ga0495635_0112149
554 Ga0495659_0132644
555 Ga0495661_0032300
556 Ga0495661_0242828
557 Ga0495588_0016821
558 Ga0495657_0083803
559 Ga0495657_0120047
560 Ga0495623_0107912
561 Ga0495658_0151089
562 Ga0495613_0000387
563 Ga0495613_0009859
564 Ga0495613_0039200
565 Ga0495613_0057001
566 Ga0495613_0333392
567 Ga0495624_0258464
568 Ga0495670_0019839
569 Ga0495671_0053881
570 Ga0495671_0341562
571 Ga0495649_0036513
572 Ga0495589_0004926
573 Ga0495589_0015671
574 Ga0495589_0016283
575 Ga0495589_0061199
576 Ga0495589_0089765
577 Ga0495589_0111913
578 Ga0495660_0034736
579 Ga0495660_0108688
580 Ga0495581_0143674
581 Ga0495604_0109766
582 Ga0495636_0009043
583 Ga0495636_0013360
584 Ga0495636_0015289
585 Ga0495636_0221689
586 Ga0495674_0153335
587 Ga0495676_0041155
588 Ga0495676_0043794
589 Ga0495676_0062196
590 Ga0495676_0100321
591 Ga0495676_0113231
592 Ga0495683_0045077
593 Ga0495683_0196622
594 Ga0495683_0235541
595 Ga0495687_001389
596 Ga0495687_036692
597 Ga0495687_057009
598 Ga0495687_064061
599 Ga0495687_088117
600 Ga0495687_122410
601 Ga0495675_0018911
602 Ga0495677_0117937
603 Ga0495677_0296734
604 Ga0495679_018950
605 Ga0495685_010959
606 Ga0495685_015051
607 Ga0495685_015908
608 Ga0495685_055370
609 Ga0495684_0071541
610 Ga0495686_0036160
611 Ga0495686_0105974
612 Ga0495593_0470821
613 Ga0495602_0124390
614 Ga0495614_0000388
615 Ga0495614_0062030
616 Ga0495614_0128579
617 Ga0495614_0555159
618 Ga0495626_0074754
619 Ga0496109_0055310
620 Ga0496111_0468355
621 Ga0496114_1124474
622 Ga0496125_0648042
623 Ga0495682_0074722
624 Ga0501031_0317540
625 Ga0501032_0015155
626 Ga0501032_0058315
627 Ga0501034_0032795
628 Ga0501034_0078121
629 Ga0501034_0466863
630 Ga0501036_0390341
631 Ga0501037_0014639
632 Ga0501038_0078069
633 Ga0501039_0062980
634 Ga0501039_0261679
635 Ga0501042_0009583
636 Ga0501042_0174244
637 Ga0501043_0022684
638 Ga0501043_0102431
639 Ga0501046_0233644
640 Ga0501046_0404495
641 Ga0501047_0000072
642 Ga0501047_0102222
643 Ga0501048_0068645
644 Ga0501069_0160143
645 Ga0501073_0040050
646 Ga0501080_0636505
647 Ga0501035_0019947
648 Ga0501035_0048151
649 Ga0501035_0674760
650 Ga0501044_0095789
651 Ga0495595_0620513
652 Ga0500566_0032786
653 Ga0500560_018027
654 Ga0500628_006094
655 Ga0500573_0051941
656 Ga0500600_0154082
657 Ga0500600_0198690
658 Ga0466962_0000156
659 2547411638
660 2554257038
661 2585298071
662 2585305144
663 2585318317
664 2616701481
665 2616903623
666 2643763486
667 2643899708
668 2643947635
669 2644266169
670 2644390181
671 2644403676
672 2644435327
673 2644437588
674 2644463646
675 2644627954
676 2768642034
677 2784589403
678 2785342171
679 2785370482
680 2786671638
681 2793980733
682 2808843043
683 2808921384
684 2809233066
685 2811845355
686 2812357080
687 2812479739
688 2819698266
689 2852640057
690 2862179486
691 2862286668
692 2862387911
693 2862510262
694 2862578446
695 2863411853
696 2867348528
697 2867435702
698 2867475967
699 2873154959
700 2875394678
701 2877680138
702 2912718728
703 2912731052
704 2912761861
705 2918504617
706 2919471459
707 2935392664
708 2946049957
709 2946068798
710 2946076844
711 2947228112
712 2954005938
713 2954385071
714 2954677924
715 2954686233
716 2954695889
717 2954711080
718 2954715294
719 2954725235
720 2954736581
721 2954744168
722 2954755430
723 2954763111
724 2966602468
725 2990063964
726 2997454275
727 3006397268
728 3006428467
729 3006492244
730 3006500344
731 8008566235
732 8008578066
733 8023629551
734 8025479504
735 8025538145
736 8047897900
737 8048133116
738 8048360994
739 8048374863
740 8048383359
741 8054166945
742 8056454027
743 8056669214
744 8056833227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11377

DUF3180

Protein of unknown function (DUF3180)

19

159

0.96

Map